Diaphorina citri psyllid: psy8696


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MFVVFQMPSSGGDEAGPATSRDDRSLQMSNSPYHLLHRESSAFVPVVPTRSIHMYQGDELMAMMADKRKELALREEAACVAAAHAAAAAAMLLPHPTPPHSLLDGLPNTSSPYGFPPGSNPSTSSSFPFPGSSSSLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccc
*FVVF***********************************SAFVPVVPTRSIHMYQGDELMAMMADKRKELALREEAACVAAAHAAAAAAMLL*********************************************GTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDH*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVVFQMPSSGGDEAGPATSRDDRSLQMSNSPYHLLHRESSAFVPVVPTRSIHMYQGDELMAMMADKRKELALREEAACVAAAHAAAAAAMLLPHPTPPHSLLDGLPNTSSPYGFPPGSNPSTSSSFPFPGSSSSLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein odd-skipped-related 2 confidentQ6AY34
Protein bowel Putative transcription factor. Required for leg joint formation, acting downstream of Notch to pattern the leg tarsal segments. Functions in the terminal pathway during embryogenesis, acting downstream of tll in the posterior of the embryo. Acts in a hierarchy downstream of drm and lin during foregut and hindgut patterning and morphogenesis. Involved in cell rearrangement during elongation of the embryonic hindgut. Regulates expression of hindgut patterning genes to establish the small intestine region of the embryonic hindgut. Required in the foregut for spatially localized gene expression and morphogenesis of the proventriculus.confidentQ9VQU9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048565 [BP]digestive tract developmentprobableGO:0032502, GO:0055123, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 135-212
View the alignment between query and template
View the model in PyMOL
Template: 1EJ6, chain B
Confidence level:probable
Coverage over the Query: 133-161
View the alignment between query and template
View the model in PyMOL
Template: 3DB5, chain A
Confidence level:probable
Coverage over the Query: 41-58
View the alignment between query and template
View the model in PyMOL