Diaphorina citri psyllid: psy8714

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560--
MHLRVKKLVPASEIKLARPSLISLLTPLQRMNGACSVHEWVGPLFGDLVLFKMTSVCGHIMGLDFTSKYNNWDKVDPLELFSCPTEKREATPKLKLPAFLANEAKDCEFLVLWLDCDKEGENICFEVMEAVRHQININSPKTVWRARFSAITDKDIKAAMWNLVKPNIFEARSVDARQELDLRIGCAFTRYQTKFFQGKYGDLDASLISYGPCQTPTLGFCVERHDKIRTFKPEPYWLLDLTLNLNGVAVSVTWSRGHIFDKSTCNVFFKAVEKEKHVTVVDVQSSTKSKTKPQALNTVELMRVASSGLGMGPHHAMQIAERLYTQGYVSYPRTETTQYPENFDLVAVLRQQESSPDWGDHVREVLSNGISKPRKGKDVGDHPPITPTKLATRTQLDGDAWRLYDYIVRHFIGTLCGDLVYTQKVAKFSVADEMFTMEAKYLLHPGFTGVMTWSAMKNESIPDFKPGDLIPIQSVKMVERKTTPPDYLTESELISLMEKHGIGTDASIPVHINNICQRNYVTVTSGRRLVPTSLGIVLVHGYQKIDRELVEPTMRSAYRVQA
ccccccEEEEEcccccHHHHHHHHHcccccccccCEEEEEccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccCCcccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEEEECccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccEEEEEEEEEEECccccccccccccccccccccccccEEEccEECcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHcccEEEEccccEECccHHHHHHHHHHHHcccccccHHHHHHHHHHc
**LRVKKLVPASEIKLARPSLISLLTPLQRMNGACSVHEWVGPLFGDLVLFKMTSVCGHIMGLDFTSKYNNWDKVDPLELFSCPTEKREATPKLKLPAFLANEAKDCEFLVLWLDCDKEGENICFEVMEAVRHQININSPKTVWRARFSAITDKDIKAAMWNLVKPNIFEARSVDARQELDLRIGCAFTRYQTKFFQGKYGDLDASLISYGPCQTPTLGFCVERHDKIRTFKPEPYWLLDLTLNLNGVAVSVTWSRGHIFDKSTCNVFFKAVEKEKHVT****************LNTVELMRVASSGLGMGPHHAMQIAERLYTQGYVSYPRTETTQYPENFDLVAVLRQQESSPDWGDHV*******************HPPITPTKLATRTQLDGDAWRLYDYIVRHFIGTLCGDLVYTQKVAKFSVADEMFTMEAKYLLHPGFTGVMTWSAMKNESIPDFKPGDLIPIQSVKMV***TTPPDYLTESELISLMEKHGIGTDASIPVHINNICQRNYVTVTSGRRLVPTSLGIVLVHGYQKIDRELVEPTMRSAYRVQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLRVKKLVPASEIKLARPSLISLLTPLQRMNGACSVHEWVGPLFGDLVLFKMTSVCGHIMGLDFTSKYNNWDKVDPLELFSCPTEKREATPKLKLPAFLANEAKDCEFLVLWLDCDKEGENICFEVMEAVRHQININSPKTVWRARFSAITDKDIKAAMWNLVKPNIFEARSVDARQELDLRIGCAFTRYQTKFFQGKYGDLDASLISYGPCQTPTLGFCVERHDKIRTFKPEPYWLLDLTLNLNGVAVSVTWSRGHIFDKSTCNVFFKAVEKEKHVTVVDVQSSTKSKTKPQALNTVELMRVASSGLGMGPHHAMQIAERLYTQGYVSYPRTETTQYPENFDLVAVLRQQESSPDWGDHVREVLSNGISKPRKGKDVGDHPPITPTKLATRTQLDGDAWRLYDYIVRHFIGTLCGDLVYTQKVAKFSVADEMFTMEAKYLLHPGFTGVMTWSAMKNESIPDFKPGDLIPIQSVKMVERKTTPPDYLTESELISLMEKHGIGTDASIPVHINNICQRNYVTVTSGRRLVPTSLGIVLVHGYQKIDRELVEPTMRSAYRVQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA topoisomerase 3-beta-1 Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 3'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Possesses negatively supercoiled DNA relaxing activity.confidentO95985
DNA topoisomerase 3-beta-1 Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 3'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Possesses negatively supercoiled DNA relaxing activity.confidentQ9Z321
DNA topoisomerase 3 Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand than undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 3'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone.confidentO60126

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000793 [CC]condensed chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003917 [MF]DNA topoisomerase type I activityprobableGO:0003824, GO:0003916, GO:0003674, GO:0016853
GO:0007000 [BP]nucleolus organizationprobableGO:0006996, GO:0006997, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0006265 [BP]DNA topological changeprobableGO:0071103, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0006261 [BP]DNA-dependent DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0000712 [BP]resolution of meiotic recombination intermediatesprobableGO:0048610, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0051307, GO:0051304, GO:0044699, GO:0006139, GO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0044260, GO:1901360, GO:0045132, GO:0071704, GO:0007049, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0035825, GO:0007059, GO:0007131, GO:0046483, GO:0006310, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0000737 [BP]DNA catabolic process, endonucleolyticprobableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004520 [MF]endodeoxyribonuclease activityprobableGO:0016787, GO:0004536, GO:0004519, GO:0016788, GO:0003824, GO:0003674, GO:0004518
GO:0043007 [BP]maintenance of rDNAprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0016043, GO:0071704, GO:0071840, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0043570, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045910 [BP]negative regulation of DNA recombinationprobableGO:0009892, GO:0010605, GO:0051052, GO:0019222, GO:0060255, GO:0031323, GO:0031324, GO:0080090, GO:0000018, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0051053, GO:0050789, GO:0048523, GO:0045934
GO:0000070 [BP]mitotic sister chromatid segregationprobableGO:0006996, GO:0044699, GO:0000819, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0044763, GO:0022402, GO:0048285, GO:0007059, GO:0007067, GO:0007049, GO:0051276
GO:0031422 [CC]RecQ helicase-Topo III complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.99.-.-Other isomerases.probable
5.99.1.-Sole sub-subclass for isomerases that do not belong in the other subclasses.probable
5.99.1.2DNA topoisomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I7D, chain A
Confidence level:very confident
Coverage over the Query: 6-562
View the alignment between query and template
View the model in PyMOL