Query         psy8715
Match_columns 164
No_of_seqs    196 out of 736
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:25:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8715.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8715hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1314|consensus              100.0 4.7E-51   1E-55  352.5  12.3  161    3-163   181-350 (414)
  2 KOG1315|consensus               99.0 3.5E-10 7.6E-15   97.8   6.6   82    6-92    190-281 (307)
  3 KOG1313|consensus               98.7 1.5E-08 3.3E-13   86.5   5.7   84    7-90    204-303 (309)
  4 KOG1311|consensus               98.5 1.6E-07 3.4E-12   79.9   5.8   65    6-77    199-264 (299)
  5 COG5273 Uncharacterized protei  95.7   0.024 5.3E-07   49.2   5.7   63   15-77    199-278 (309)
  6 PF14654 Epiglycanin_C:  Mucin,  78.1     3.5 7.5E-05   30.7   3.7   37    2-39     14-50  (106)
  7 KOG4792|consensus               70.8     2.8 6.1E-05   35.8   1.9   26  136-161   234-260 (293)
  8 KOG0509|consensus               70.2       2 4.3E-05   40.8   0.9   42   36-77    541-583 (600)
  9 PF12852 Cupin_6:  Cupin         66.9     9.3  0.0002   29.8   4.0   20  145-164    55-74  (186)
 10 PF12729 4HB_MCP_1:  Four helix  58.0      18 0.00039   26.4   4.0   33   11-43      8-40  (181)
 11 PF05568 ASFV_J13L:  African sw  57.6      30 0.00066   27.7   5.3    9   58-66     68-76  (189)
 12 PF04584 Pox_A28:  Poxvirus A28  56.6      11 0.00023   29.6   2.5   79   19-99      9-112 (140)
 13 PF06716 DUF1201:  Protein of u  53.4      40 0.00086   21.9   4.4   27    8-34      6-32  (54)
 14 KOG3416|consensus               53.0       8 0.00017   30.0   1.4   21  140-160    53-73  (134)
 15 PF01146 Caveolin:  Caveolin;    53.0      33 0.00071   27.0   4.8   29    9-37     74-102 (148)
 16 KOG2729|consensus               51.0      41 0.00088   26.3   5.0   17   59-76     37-53  (137)
 17 PF05814 DUF843:  Baculovirus p  50.6      41 0.00089   24.2   4.6   33   20-53     30-62  (83)
 18 PF11779 DUF3317:  Protein of u  50.0      44 0.00096   22.0   4.4   35    3-37     22-57  (58)
 19 PF14015 DUF4231:  Protein of u  48.3      65  0.0014   22.8   5.5   39   16-54     57-96  (112)
 20 smart00739 KOW KOW (Kyprides,   42.8      21 0.00046   19.0   1.7   13  149-161     2-14  (28)
 21 PF03311 Cornichon:  Cornichon   41.0      51  0.0011   25.0   4.2   41   14-71      8-48  (128)
 22 PF14685 Tricorn_PDZ:  Tricorn   39.8      23 0.00049   25.4   1.9   39  114-160    12-51  (88)
 23 KOG2417|consensus               39.0      32  0.0007   31.3   3.1   72   17-107    81-152 (462)
 24 PF07653 SH3_2:  Variant SH3 do  35.9      38 0.00082   21.2   2.3   13  147-159    16-28  (55)
 25 PF09879 DUF2106:  Predicted me  35.4      27 0.00058   27.6   1.9   10   58-67     56-65  (153)
 26 PRK09570 rpoH DNA-directed RNA  34.4      30 0.00065   24.5   1.8   15  147-161    50-64  (79)
 27 PF11044 TMEMspv1-c74-12:  Plec  34.3 1.3E+02  0.0028   19.3   4.6   27   10-36      6-32  (49)
 28 PF06143 Baculo_11_kDa:  Baculo  34.0 1.1E+02  0.0023   22.0   4.6   30   16-45     39-68  (84)
 29 TIGR03064 sortase_srtB sortase  33.1 1.1E+02  0.0024   25.5   5.3   21   74-94     68-89  (232)
 30 PF01191 RNA_pol_Rpb5_C:  RNA p  32.3      34 0.00073   23.9   1.8   15  147-161    47-61  (74)
 31 PF14851 FAM176:  FAM176 family  32.3      67  0.0015   25.4   3.7   22    7-28     20-41  (153)
 32 PF06072 Herpes_US9:  Alphaherp  30.7      65  0.0014   21.8   2.9   22   11-32     38-59  (60)
 33 PF14604 SH3_9:  Variant SH3 do  30.3      51  0.0011   20.5   2.2   15  146-160    12-26  (49)
 34 COG3477 Predicted periplasmic/  29.9 1.5E+02  0.0032   24.1   5.2   15   63-77    133-147 (176)
 35 PRK14725 pyruvate kinase; Prov  29.9      62  0.0013   31.1   3.6   53  107-160   278-346 (608)
 36 PF03079 ARD:  ARD/ARD' family;  29.8      23  0.0005   27.9   0.7   18  146-163   116-133 (157)
 37 PF06837 Fijivirus_P9-2:  Fijiv  29.6 1.1E+02  0.0023   25.5   4.4   33    2-34    108-140 (214)
 38 PHA03048 IMV membrane protein;  29.5      73  0.0016   23.3   3.2   37    8-45     44-80  (93)
 39 KOG1226|consensus               29.4      59  0.0013   32.0   3.4   48    5-52    709-756 (783)
 40 PF09125 COX2-transmemb:  Cytoc  29.4      93   0.002   19.1   3.1   21    8-28     14-34  (38)
 41 PF05767 Pox_A14:  Poxvirus vir  29.3   1E+02  0.0022   22.5   3.9   28    8-35     45-72  (92)
 42 PF00467 KOW:  KOW motif;  Inte  28.8      31 0.00067   19.7   0.9   11  151-161     1-11  (32)
 43 PF11808 DUF3329:  Domain of un  28.4 1.5E+02  0.0032   20.9   4.6   25   20-48     32-56  (90)
 44 PF03376 Adeno_E3B:  Adenovirus  28.1   2E+02  0.0044   19.8   5.7   17    2-19      8-24  (67)
 45 PF10883 DUF2681:  Protein of u  28.0 1.6E+02  0.0034   21.2   4.7   36   16-51      8-47  (87)
 46 smart00326 SH3 Src homology 3   27.5      60  0.0013   19.1   2.2   18  143-160    15-32  (58)
 47 COG0361 InfA Translation initi  27.1 1.4E+02  0.0031   20.9   4.2   29  130-158    27-56  (75)
 48 PF14250 AbrB-like:  AbrB-like   26.9      67  0.0015   22.4   2.5   45  108-163    23-67  (71)
 49 COG2063 FlgH Flagellar basal b  26.6      47   0.001   28.1   2.0   24  129-158    58-81  (230)
 50 TIGR00008 infA translation ini  26.3      46   0.001   22.9   1.6   14  145-158    41-54  (68)
 51 PF01505 Vault:  Major Vault Pr  25.4      57  0.0012   20.0   1.8   29  130-158     7-35  (43)
 52 PF10260 SAYSvFN:  Uncharacteri  24.8 1.8E+02   0.004   20.1   4.4   48   27-106    22-69  (71)
 53 COG2012 RPB5 DNA-directed RNA   24.1      57  0.0012   23.3   1.7   16  146-161    52-67  (80)
 54 PF07438 DUF1514:  Protein of u  24.1      87  0.0019   21.5   2.6   15   11-25      3-17  (66)
 55 PF07172 GRP:  Glycine rich pro  23.8      86  0.0019   22.7   2.7   10    9-18      5-14  (95)
 56 PF12072 DUF3552:  Domain of un  23.7 1.1E+02  0.0024   24.6   3.7   23   11-33      2-24  (201)
 57 PF07883 Cupin_2:  Cupin domain  23.2      35 0.00075   21.6   0.5   22  142-163    34-55  (71)
 58 COG1935 Uncharacterized conser  22.4      62  0.0013   24.8   1.8   17  144-160    34-50  (122)
 59 cd06555 ASCH_PF0470_like ASC-1  22.4      63  0.0014   24.1   1.8   31  129-160    13-43  (109)
 60 PF05683 Fumerase_C:  Fumarase   22.4      39 0.00085   28.0   0.7   27  132-158    26-52  (205)
 61 PTZ00241 40S ribosomal protein  22.1      61  0.0013   25.9   1.8   21  138-158   106-126 (158)
 62 PF03120 DNA_ligase_OB:  NAD-de  22.1      63  0.0014   22.9   1.7   15  146-160    47-61  (82)
 63 KOG2384|consensus               22.0      47   0.001   27.8   1.1   37   71-109     6-58  (223)
 64 PF10332 DUF2418:  Protein of u  21.8 3.2E+02   0.007   19.8   5.5   31   17-50     38-68  (99)
 65 TIGR01080 rplX_A_E ribosomal p  21.7      56  0.0012   24.6   1.4   27  136-162    22-55  (114)
 66 PF07732 Cu-oxidase_3:  Multico  21.4      43 0.00092   24.7   0.7   15  144-158    25-39  (117)
 67 PF12606 RELT:  Tumour necrosis  21.4   1E+02  0.0022   20.0   2.4   17   17-33      7-23  (50)
 68 PF15179 Myc_target_1:  Myc tar  21.3 1.2E+02  0.0027   24.9   3.4   22   11-32     21-42  (197)
 69 PRK01191 rpl24p 50S ribosomal   21.1      65  0.0014   24.6   1.7   17  145-161    42-58  (120)
 70 PRK12442 translation initiatio  20.7      61  0.0013   23.4   1.4   15  144-158    42-56  (87)
 71 PF15179 Myc_target_1:  Myc tar  20.7 1.6E+02  0.0036   24.3   4.0   30    9-38     15-44  (197)
 72 COG3763 Uncharacterized protei  20.6 1.9E+02   0.004   20.2   3.7   19   11-29      6-24  (71)
 73 PF12380 Peptidase_C62:  Gill-a  20.5      42  0.0009   28.0   0.6   48   38-99     13-68  (284)
 74 PHA03049 IMV membrane protein;  20.4 1.4E+02   0.003   20.7   3.0   31   15-45      4-35  (68)
 75 PF08173 YbgT_YccB:  Membrane b  20.4 1.5E+02  0.0032   17.0   2.7   16   13-28      4-19  (28)
 76 PF05961 Chordopox_A13L:  Chord  20.1 1.5E+02  0.0032   20.5   3.1   31   15-45      4-35  (68)

No 1  
>KOG1314|consensus
Probab=100.00  E-value=4.7e-51  Score=352.50  Aligned_cols=161  Identities=42%  Similarity=0.709  Sum_probs=155.1

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhh----cC--CCccCCcccchHhHHHHhh
Q psy8715           3 LSPGKRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRK----RQ--DKFVYPYNLGWKKNIHLVF   76 (164)
Q Consensus         3 ~~~~~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr----~~--~~~~~PYDlG~~~Nl~~Vf   76 (164)
                      +++.++++.+|+++|+++|+|++++||+.|++.|++|+|.||+|+.+|+.+||    .+  +++.+|||+||+.|+++||
T Consensus       181 ft~~~li~~vfslgla~gv~la~t~Lf~~qlk~Il~nrt~IE~wi~~Ka~~rr~~~~~d~~~~f~ypydlgWr~n~r~vf  260 (414)
T KOG1314|consen  181 FTLSSLIALVFSLGLAIGVVLALTMLFFIQLKQILNNRTGIESWIVEKAMDRREYYFNDDEGEFTYPYDLGWRINLREVF  260 (414)
T ss_pred             ccHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHcCCcchHHHHHHHHHHHHHhhccCCCCceeeeccccccccHHHHh
Confidence            56778899999999999999999999999999999999999999999999887    23  7899999999999999999


Q ss_pred             Cc--ccCCCCceecccCCccccccchHHHHHHHHhhhcCCCeEEeeccCceEeee-cccceeecccCCCCcCcccccCCC
Q psy8715          77 GS--SSISNGITWPVVEGCHQYSLTMEQLEQKNIKKAHSQPVLVVKNYNGRCLPL-MFGLKVSWHTPCFDIARINLQVNE  153 (164)
Q Consensus        77 GW--~p~gDGi~wpv~~~c~qy~lt~eql~qk~~kr~r~~~~~~~~~~~g~~~~~-~~g~~~~~~~P~~de~ri~~~~gd  153 (164)
                      -|  .+.|||+.|||.+||+||+||.|||+||++||+|+|.|+|+++++|+|||+ ++|++|++..||+|||||+|+|||
T Consensus       261 ~~~~~~~gdg~~wPv~~gc~qytlt~eql~qk~~kr~rsr~~~~~~~~tG~~~p~~k~G~~v~~~~pc~ddprisL~p~d  340 (414)
T KOG1314|consen  261 FQNKKEEGDGIEWPVVEGCVQYTLTIEQLTQKLDKRGRSRLFKCIEDVTGDCCPIFKQGIKVYEANPCTDDPRISLPPGD  340 (414)
T ss_pred             hhccccCCCCccccccCcccccceeHHHHHHHHHhhcCeEEEEeccCCCCCcccccccceeeeeeccCCCCcccccCCCc
Confidence            98  789999999999999999999999999999999999999999999999998 999999999999999999999999


Q ss_pred             EEEEeeeecc
Q psy8715         154 TVLVTRFRNE  163 (164)
Q Consensus       154 ~~~vtr~~~~  163 (164)
                      .|+|||+..|
T Consensus       341 ~i~~tr~~~~  350 (414)
T KOG1314|consen  341 GIKATRGFNH  350 (414)
T ss_pred             ceeeeeeeec
Confidence            9999999987


No 2  
>KOG1315|consensus
Probab=99.05  E-value=3.5e-10  Score=97.84  Aligned_cols=82  Identities=27%  Similarity=0.298  Sum_probs=65.3

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCccCCcccchHhHHHHhhC-----c--
Q psy8715           6 GKRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKNIHLVFG-----S--   78 (164)
Q Consensus         6 ~~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~Nl~~VfG-----W--   78 (164)
                      ...+.++|++++++.+.++++.|+.||++||++|+||||.+......   .+....+.|++  ..|++|+||     |  
T Consensus       190 ~~~~~~~~~~~~~~~f~i~l~~~l~~h~~Li~~N~TTiE~~~~~~~~---~~~~~~~~~~~--~~n~~~vfg~~~~~wl~  264 (307)
T KOG1315|consen  190 LLLFFIVFLFLVAIAFSISLSGLLCFHTYLILKNKTTIEAYKSPVFR---SGLHNKNGFNL--YVNFREVFGSNLLYWLL  264 (307)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchhHhhhcccccc---ccccccCCcce--eecHHHHhCCCceEEec
Confidence            34688899999999999999999999999999999999996543221   22344566776  789999999     4  


Q ss_pred             ---ccCCCCceecccCC
Q psy8715          79 ---SSISNGITWPVVEG   92 (164)
Q Consensus        79 ---~p~gDGi~wpv~~~   92 (164)
                         .+.+||..+|.+..
T Consensus       265 P~~~s~~~~~~~~~~~~  281 (307)
T KOG1315|consen  265 PIDSSWGDGVSFPLRGD  281 (307)
T ss_pred             cccCccccCcccccccc
Confidence               66788888887653


No 3  
>KOG1313|consensus
Probab=98.74  E-value=1.5e-08  Score=86.47  Aligned_cols=84  Identities=26%  Similarity=0.227  Sum_probs=70.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCccCCcccchHhHHHHhhC-------c-
Q psy8715           7 KRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKNIHLVFG-------S-   78 (164)
Q Consensus         7 ~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~Nl~~VfG-------W-   78 (164)
                      .+..++.++.+++.+++++|.|..||.++|..+.|+||..++.|.+++......+|||+.|.++||+.+||       | 
T Consensus       204 ~~t~~~~~~fls~~~lv~vg~l~~W~~vlI~~G~tsi~~~~~~~e~k~~~a~~R~~~~n~g~k~nWr~fLg~~~~r~~wk  283 (309)
T KOG1313|consen  204 TRTSIANLWFLSVRVLVAVGLLTAWHAVLISRGETSIEQLINIKERKRYLAHLRSNPTNFGGKANWRNFLGLFRGRHFWK  283 (309)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhheeeehhhhhHHHHHHHHHhHhHHHhccCCCcccchHHHHHHhhccccCCceeE
Confidence            34566778889999999999999999999999999999999888876553334589999999999999999       5 


Q ss_pred             --------ccCCCCceeccc
Q psy8715          79 --------SSISNGITWPVV   90 (164)
Q Consensus        79 --------~p~gDGi~wpv~   90 (164)
                              .|.+.|-+|++.
T Consensus       284 ~v~lPt~~~p~~~~~~~~~~  303 (309)
T KOG1313|consen  284 TVLLPTIRKPVKYGDSKEKS  303 (309)
T ss_pred             EEeccccccccccCCccccc
Confidence                    677888888743


No 4  
>KOG1311|consensus
Probab=98.52  E-value=1.6e-07  Score=79.92  Aligned_cols=65  Identities=23%  Similarity=0.202  Sum_probs=53.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCc-cCCcccchHhHHHHhhC
Q psy8715           6 GKRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKF-VYPYNLGWKKNIHLVFG   77 (164)
Q Consensus         6 ~~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~-~~PYDlG~~~Nl~~VfG   77 (164)
                      ......++.+++++.++++++.|+.+|+++|.+|+||+|....  .+     ... .+|||.|.++|++++||
T Consensus       199 ~~~~~~~~l~~~~~~~~~~~~~l~~fh~~li~~~~Tt~e~~~~--~~-----~~~~~~~~~~g~~~n~~~~~~  264 (299)
T KOG1311|consen  199 AGTFLSALLGLLSALFLAFTSALLCFHIYLIKSGSTTYESIKS--LD-----FVSRSNPYDLGLLKNLQEVFG  264 (299)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhheeeEecCcchhhhhhc--cc-----cccccCCCchhHHHHHHHHhC
Confidence            3455666667789999999999999999999999999988543  11     223 48999999999999999


No 5  
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=95.67  E-value=0.024  Score=49.23  Aligned_cols=63  Identities=25%  Similarity=0.299  Sum_probs=47.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhh--------c---------CCCccCCcccchHhHHHHhhC
Q psy8715          15 LLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRK--------R---------QDKFVYPYNLGWKKNIHLVFG   77 (164)
Q Consensus        15 ~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr--------~---------~~~~~~PYDlG~~~Nl~~VfG   77 (164)
                      ..+++.+++.+.+|+.+|.++++.|+|++|.+...+..+.-        .         ..+...|+++|.-+|+..+++
T Consensus       199 ~~~~~~~f~~~~~~~~~~~~~~~~~~t~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~i~~  278 (309)
T COG5273         199 SLLGVVFFIITTLLLLFLIYLILNNLTTIEFIQISRGGSTLEFFPLCRESNLPFTNIFDSSEGALPLDLGIGQNLSTIKG  278 (309)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhccceecccccchhccCCcCceeccCCCccccccccCccccceeecC
Confidence            57778889999999999999999999999998765443211        0         122456777777777777776


No 6  
>PF14654 Epiglycanin_C:  Mucin, catalytic, TM and cytoplasmic tail region
Probab=78.09  E-value=3.5  Score=30.65  Aligned_cols=37  Identities=19%  Similarity=0.270  Sum_probs=21.7

Q ss_pred             CCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Q psy8715           2 CLSPGKRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKN   39 (164)
Q Consensus         2 ~~~~~~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~N   39 (164)
                      -|+|++.|++.++.+++ +|.+++|++|+.--++=++|
T Consensus        14 sL~PWeIfLItLasVvv-avGl~aGLfFcvR~~lslrn   50 (106)
T PF14654_consen   14 SLKPWEIFLITLASVVV-AVGLFAGLFFCVRNSLSLRN   50 (106)
T ss_pred             CccchHHHHHHHHHHHH-HHHHHHHHHHHhhhcccccc
Confidence            37899988877665443 35555666665533443433


No 7  
>KOG4792|consensus
Probab=70.78  E-value=2.8  Score=35.80  Aligned_cols=26  Identities=27%  Similarity=0.438  Sum_probs=20.7

Q ss_pred             ecccC-CCCcCcccccCCCEEEEeeee
Q psy8715         136 SWHTP-CFDIARINLQVNETVLVTRFR  161 (164)
Q Consensus       136 ~~~~P-~~de~ri~~~~gd~~~vtr~~  161 (164)
                      +=+-| ..|-+-++|++||+|.||+..
T Consensus       234 q~RVPnAYDkTaL~levGdiVkVTk~n  260 (293)
T KOG4792|consen  234 QKRVPNAYDKTALALEVGDIVKVTKKN  260 (293)
T ss_pred             hhcCCCccChhhhhhhcCcEEEEEeec
Confidence            33567 567778999999999999853


No 8  
>KOG0509|consensus
Probab=70.22  E-value=2  Score=40.79  Aligned_cols=42  Identities=17%  Similarity=0.097  Sum_probs=32.0

Q ss_pred             HhcCcchhhhHhhhhhhhhh-cCCCccCCcccchHhHHHHhhC
Q psy8715          36 ILKNQTNIEDWIVEKATKRK-RQDKFVYPYNLGWKKNIHLVFG   77 (164)
Q Consensus        36 Il~NqTTIE~~~~~k~~~rr-~~~~~~~PYDlG~~~Nl~~VfG   77 (164)
                      ++.+.||+|.|...+...-. +..+...|++.|+.+|+.+++=
T Consensus       541 ~c~~~tt~e~~n~~r~~~~~~~~~~~~~~~s~g~~~Nl~df~~  583 (600)
T KOG0509|consen  541 ACLHLTTNEQINVKRYEHLGIKRGPTRSPFSPGPIRNLVDFFL  583 (600)
T ss_pred             eeecccHHHHHHHHHhhccccccCcCCCCCCchhhhcchheee
Confidence            56678899998776554332 4456788999999999999873


No 9  
>PF12852 Cupin_6:  Cupin
Probab=66.90  E-value=9.3  Score=29.76  Aligned_cols=20  Identities=25%  Similarity=0.310  Sum_probs=17.8

Q ss_pred             CcccccCCCEEEEeeeeccC
Q psy8715         145 ARINLQVNETVLVTRFRNEE  164 (164)
Q Consensus       145 ~ri~~~~gd~~~vtr~~~~~  164 (164)
                      +.+.|+.||+|.+.|+..|.
T Consensus        55 ~~~~L~~GDivllp~g~~H~   74 (186)
T PF12852_consen   55 EPIRLEAGDIVLLPRGTAHV   74 (186)
T ss_pred             CeEEecCCCEEEEcCCCCeE
Confidence            45999999999999999883


No 10 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=57.96  E-value=18  Score=26.45  Aligned_cols=33  Identities=18%  Similarity=0.211  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchh
Q psy8715          11 HWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNI   43 (164)
Q Consensus        11 ~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTI   43 (164)
                      ++++|++.+++++.+|++.++.+.-+-.+..++
T Consensus         8 L~~~f~~~~~l~~~~~~~~~~~l~~~~~~~~~i   40 (181)
T PF12729_consen    8 LILGFGLIILLLLIVGIVGLYSLSQINQNVEEI   40 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455666777778888888889888888777665


No 11 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=57.60  E-value=30  Score=27.67  Aligned_cols=9  Identities=33%  Similarity=0.685  Sum_probs=7.0

Q ss_pred             CCccCCccc
Q psy8715          58 DKFVYPYNL   66 (164)
Q Consensus        58 ~~~~~PYDl   66 (164)
                      -.|+|||+-
T Consensus        68 iQfinpyqD   76 (189)
T PF05568_consen   68 IQFINPYQD   76 (189)
T ss_pred             ccccCcccc
Confidence            458999985


No 12 
>PF04584 Pox_A28:  Poxvirus A28 family;  InterPro: IPR007664 The poxvirus A28 protein is expressed at late times during the virus replication cycle and is a membrane component of the intracellular mature virion. Repression of A28 inhibits cell-to-cell spread, suggesting that all poxviruses use a common A28-dependent mechanism of cell penetration []. An N-terminal hydrophobic sequence, present in all poxvirus A28 orthologues, anchors the protein in the virion surface membrane so that most of it is exposed to the cytoplasm [].; GO: 0016032 viral reproduction, 0019031 viral envelope
Probab=56.56  E-value=11  Score=29.61  Aligned_cols=79  Identities=23%  Similarity=0.253  Sum_probs=47.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhh--hhh--c--------CCCccCCcccchHhHHHHhh----------
Q psy8715          19 VGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKAT--KRK--R--------QDKFVYPYNLGWKKNIHLVF----------   76 (164)
Q Consensus        19 i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~--~rr--~--------~~~~~~PYDlG~~~Nl~~Vf----------   76 (164)
                      +.++.+...|+++|+|.|..|--.|-.+....+.  +.+  +        -++-...||  .++=|+-|.          
T Consensus         9 ii~at~aic~i~fQ~y~iYeNYdnI~EFN~~~~~LEYskt~g~~~iDr~V~DPND~~~D--vkqKWRCv~~~~~yvs~S~   86 (140)
T PF04584_consen    9 IILATAAICFILFQLYYIYENYDNIKEFNDAHSALEYSKTIGGNYIDRRVFDPNDEVYD--VKQKWRCVKYNNVYVSASE   86 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhHHHHHHhhccceeEeecCCCccccceeeCCCCcccC--hhhceEEEeeCCeEEEEEe
Confidence            3344556678899999999998777654432221  111  1        123334455  355555544          


Q ss_pred             -Cc--ccCCCCceecccCCccccccc
Q psy8715          77 -GS--SSISNGITWPVVEGCHQYSLT   99 (164)
Q Consensus        77 -GW--~p~gDGi~wpv~~~c~qy~lt   99 (164)
                       |.  .+.|....|+..++|-.|+++
T Consensus        87 FGF~s~~~~~~~~f~~~~dCid~~Fs  112 (140)
T PF04584_consen   87 FGFKSNSGGNIRKFTTLEDCIDYTFS  112 (140)
T ss_pred             cceEecCCCCceecCCHHHHHHHhcC
Confidence             22  445677788888888887764


No 13 
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=53.41  E-value=40  Score=21.90  Aligned_cols=27  Identities=11%  Similarity=0.128  Sum_probs=17.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy8715           8 RLFHWGPLLAIVGVVIAVGMLFYFQVK   34 (164)
Q Consensus         8 ~~~~if~~vL~i~v~iavg~Ll~~hi~   34 (164)
                      +.++.+.|++.+.+++++...++|-.|
T Consensus         6 Rs~L~~~F~~lIC~Fl~~~~~F~~F~~   32 (54)
T PF06716_consen    6 RSYLLLAFGFLICLFLFCLVVFIWFVY   32 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456677777777777777666555444


No 14 
>KOG3416|consensus
Probab=53.03  E-value=8  Score=30.01  Aligned_cols=21  Identities=14%  Similarity=0.099  Sum_probs=18.8

Q ss_pred             CCCCcCcccccCCCEEEEeee
Q psy8715         140 PCFDIARINLQVNETVLVTRF  160 (164)
Q Consensus       140 P~~de~ri~~~~gd~~~vtr~  160 (164)
                      -.|||+.=.++|||+|+.|++
T Consensus        53 svW~e~~~~~~PGDIirLt~G   73 (134)
T KOG3416|consen   53 SVWDEEGCLIQPGDIIRLTGG   73 (134)
T ss_pred             EEecCcCcccCCccEEEeccc
Confidence            378999999999999999986


No 15 
>PF01146 Caveolin:  Caveolin;  InterPro: IPR001612 Caveolins [, , ] are a family of integral membrane proteins which are the principal components of caveolae membranes. Cavoleae are flask-shaped plasma membrane invaginations whose exact cellular function is not yet clear. Caveolins may act as scaffolding proteins within caveolar membranes by compartmentalizing and concentrating signalling molecules. Various classes of signalling molecules, including G-protein subunits, receptor and non-receptor tyrosine kinases, endothelial nitric oxide synthase (eNOS), and small GTPases, bind Cav-1 through its 'caveolin-scaffolding domain'. Currently, three different forms of caveolins are known: caveolin-1 (or VIP21), caveolin-2 and caveolin-3 (or M-caveolin). Caveolins are proteins of about 20 Kd, they form high molecular mass homo-oligomers. Structurally they seem to have N-terminal and C-terminal hydrophilic segments and a long central transmembrane domain that probably forms a hairpin in the membrane. Both extremities are known to face the cytoplasm. Caveolae are enriched with cholesterol and Cav-1 is one of the few proteins that binds cholesterol tightly and specifically.
Probab=52.99  E-value=33  Score=27.03  Aligned_cols=29  Identities=10%  Similarity=-0.001  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy8715           9 LFHWGPLLAIVGVVIAVGMLFYFQVKAIL   37 (164)
Q Consensus         9 ~~~if~~vL~i~v~iavg~Ll~~hi~lIl   37 (164)
                      +.++++..+|+...+..+.|.+.|+|.+.
T Consensus        74 Ls~ilaiP~A~~~Gi~FA~lsf~hIW~v~  102 (148)
T PF01146_consen   74 LSLILAIPLAFLWGILFACLSFLHIWCVM  102 (148)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566677777777888888889998764


No 16 
>KOG2729|consensus
Probab=50.99  E-value=41  Score=26.31  Aligned_cols=17  Identities=29%  Similarity=0.579  Sum_probs=13.3

Q ss_pred             CccCCcccchHhHHHHhh
Q psy8715          59 KFVYPYNLGWKKNIHLVF   76 (164)
Q Consensus        59 ~~~~PYDlG~~~Nl~~Vf   76 (164)
                      +++||+|...+-| +-|+
T Consensus        37 DyiNPid~c~rlN-~lVl   53 (137)
T KOG2729|consen   37 DYINPIDLCSRLN-RLVL   53 (137)
T ss_pred             ccCCHHHHHHHHh-HHHh
Confidence            5899999998888 4444


No 17 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=50.64  E-value=41  Score=24.15  Aligned_cols=33  Identities=27%  Similarity=0.278  Sum_probs=23.8

Q ss_pred             HHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhh
Q psy8715          20 GVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATK   53 (164)
Q Consensus        20 ~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~   53 (164)
                      .+.+++.+++..|+|.+ +.+++..+.-.++++.
T Consensus        30 ~LilfviF~~~L~~yy~-kteS~~~dL~t~k~K~   62 (83)
T PF05814_consen   30 LLILFVIFFCVLQVYYI-KTESTPQDLQTEKAKS   62 (83)
T ss_pred             HHHHHHHHHHHHHHHHc-CCCCcHHHHhhhhhhh
Confidence            34555666777899877 8888888877666653


No 18 
>PF11779 DUF3317:  Protein of unknown function (DUF3317);  InterPro: IPR024512 Serine palmitoyltransferase (SPT) catalyzes the first committed step in sphingolipid biosynthesis. In mammals, two small subunits of serine palmitoyltransferase, ssSPTa and ssSPTb, substantially enhance the activity of SPT, conferring full enzyme activity upon it []. The 2 ssSPT isoforms share a conserved hydrophobic central domain, which is predicted to reside in the membrane.  This entry represents the small subunits of serine palmitoyltransferase. It also includes a number of putative uncharacterised proteins from fungi and plants.
Probab=49.95  E-value=44  Score=21.97  Aligned_cols=35  Identities=20%  Similarity=0.271  Sum_probs=21.0

Q ss_pred             CCcchhH-HHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy8715           3 LSPGKRL-FHWGPLLAIVGVVIAVGMLFYFQVKAIL   37 (164)
Q Consensus         3 ~~~~~~~-~~if~~vL~i~v~iavg~Ll~~hi~lIl   37 (164)
                      |+|++++ +.++.+++...++.++...+=-|+..++
T Consensus        22 lepwEk~~fn~~~~~l~~l~~~~~~~ylP~h~~~~~   57 (58)
T PF11779_consen   22 LEPWEKFLFNSFLLLLLSLILYATYLYLPSHIRFII   57 (58)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHh
Confidence            6788863 3344445555555566666667777654


No 19 
>PF14015 DUF4231:  Protein of unknown function (DUF4231)
Probab=48.27  E-value=65  Score=22.77  Aligned_cols=39  Identities=13%  Similarity=0.113  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHhcCcchhhhHhhhhhhhh
Q psy8715          16 LAIVGVVIAVGMLFYFQVK-AILKNQTNIEDWIVEKATKR   54 (164)
Q Consensus        16 vL~i~v~iavg~Ll~~hi~-lIl~NqTTIE~~~~~k~~~r   54 (164)
                      +++.+++++.+....++.. .-..+++|-|..+.++..+.
T Consensus        57 ~l~~~~~~~~~~~~~~~~~~~W~~~r~tae~lk~e~~~~~   96 (112)
T PF14015_consen   57 ILSALAAILASLAAFFRFHERWIRYRATAESLKREKWLYL   96 (112)
T ss_pred             HHHHHHHHHHHHHHHhchhHHHHHHHHHHHHHHHHHHHHH
Confidence            4444444444444444433 35778889998887777654


No 20 
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=42.77  E-value=21  Score=18.98  Aligned_cols=13  Identities=31%  Similarity=0.258  Sum_probs=11.0

Q ss_pred             ccCCCEEEEeeee
Q psy8715         149 LQVNETVLVTRFR  161 (164)
Q Consensus       149 ~~~gd~~~vtr~~  161 (164)
                      +++||.|+|+.+.
T Consensus         2 ~~~G~~V~I~~G~   14 (28)
T smart00739        2 FEVGDTVRVIAGP   14 (28)
T ss_pred             CCCCCEEEEeECC
Confidence            5799999999864


No 21 
>PF03311 Cornichon:  Cornichon protein;  InterPro: IPR003377  The drosophila cornichon protein (gene: cni) [] is required in the germline for dorsal-ventral signalling. The dorsal-ventral pattern formation involves a reorganisation of the microtubule network correlated with the movement of the oocyte nucleus, and depending on the initial correct establishment of the anterior-posterior axis via a signal from the oocyte produced by cornichon and gurken and received by torpedo protein in the follicle cells. The biochemical function of the cornichon protein is currently not known. It is a protein of 144 residues that seems to contain three transmembrane regions. ; GO: 0035556 intracellular signal transduction, 0016020 membrane
Probab=41.03  E-value=51  Score=25.00  Aligned_cols=41  Identities=12%  Similarity=0.237  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCccCCcccchHhH
Q psy8715          14 PLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKN   71 (164)
Q Consensus        14 ~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~N   71 (164)
                      .+++++.+..++.++..+|+-.+.    ..|             .++.||+|.--+-|
T Consensus         8 ~~i~alll~~~ll~~~vy~ii~l~----DLe-------------~D~iNp~d~c~~lN   48 (128)
T PF03311_consen    8 LWILALLLTAALLFIVVYFIICLS----DLE-------------CDYINPIDLCSRLN   48 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----HHH-------------hccCCHHHHHHHHH
Confidence            466666666666666777766532    222             25789999866655


No 22 
>PF14685 Tricorn_PDZ:  Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A.
Probab=39.82  E-value=23  Score=25.38  Aligned_cols=39  Identities=13%  Similarity=0.182  Sum_probs=20.4

Q ss_pred             CCeEEeeccCce-EeeecccceeecccCCCCcCcccccCCCEEEEeee
Q psy8715         114 QPVLVVKNYNGR-CLPLMFGLKVSWHTPCFDIARINLQVNETVLVTRF  160 (164)
Q Consensus       114 ~~~~~~~~~~g~-~~~~~~g~~~~~~~P~~de~ri~~~~gd~~~vtr~  160 (164)
                      ..|++.+-+.|. |-| .      .++|+. +|-+.+++||.|..--+
T Consensus        12 ~~y~I~~I~~gd~~~~-~------~~sPL~-~pGv~v~~GD~I~aInG   51 (88)
T PF14685_consen   12 GGYRIARIYPGDPWNP-N------ARSPLA-QPGVDVREGDYILAING   51 (88)
T ss_dssp             TEEEEEEE-BS-TTSS-S-------B-GGG-GGS----TT-EEEEETT
T ss_pred             CEEEEEEEeCCCCCCc-c------ccCCcc-CCCCCCCCCCEEEEECC
Confidence            447777777775 555 2      267875 59999999999986433


No 23 
>KOG2417|consensus
Probab=39.00  E-value=32  Score=31.31  Aligned_cols=72  Identities=21%  Similarity=0.316  Sum_probs=38.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCccCCcccchHhHHHHhhCcccCCCCceecccCCcccc
Q psy8715          17 AIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKNIHLVFGSSSISNGITWPVVEGCHQY   96 (164)
Q Consensus        17 L~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~Nl~~VfGW~p~gDGi~wpv~~~c~qy   96 (164)
                      +++.+++.+.++-+||.|++++|.- +-.             +...|+..+.|--+.-.| |   .=|-.||.-+.-+-.
T Consensus        81 l~~ill~lv~~ip~Y~~y~ii~~i~-v~~-------------k~~~~~s~l~w~~FlYff-W---kiGdpFPmlSakhGi  142 (462)
T KOG2417|consen   81 LSLILLTLVFMIPYYHCYLIIRNIG-VRR-------------KLALPFTILFWFIFLYFF-W---KIGDPFPMLSAKHGI  142 (462)
T ss_pred             HHHHHHHHHHHHHHHhheeeeeccc-chH-------------HHHhHHHHHHHHHHHHHH-H---HhCCCCCCCCcccce
Confidence            4444555566677888888888765 221             123456666555554433 5   111223332211111


Q ss_pred             ccchHHHHHHH
Q psy8715          97 SLTMEQLEQKN  107 (164)
Q Consensus        97 ~lt~eql~qk~  107 (164)
                       +|+||+-.+-
T Consensus       143 -ftieQliSRv  152 (462)
T KOG2417|consen  143 -FTIEQLISRV  152 (462)
T ss_pred             -eeHHHHHhhh
Confidence             7799987653


No 24 
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=35.90  E-value=38  Score=21.24  Aligned_cols=13  Identities=8%  Similarity=0.258  Sum_probs=10.1

Q ss_pred             ccccCCCEEEEee
Q psy8715         147 INLQVNETVLVTR  159 (164)
Q Consensus       147 i~~~~gd~~~vtr  159 (164)
                      |.+++||+|.|.+
T Consensus        16 Ls~~~Gd~i~v~~   28 (55)
T PF07653_consen   16 LSFKKGDVIEVLG   28 (55)
T ss_dssp             -EB-TTEEEEEEE
T ss_pred             eEEecCCEEEEEE
Confidence            9999999999983


No 25 
>PF09879 DUF2106:  Predicted membrane protein (DUF2106);  InterPro: IPR011313 [NiFe] hydrogenases function in H2 metabolism in a variety of microorganisms, enabling them to use H2 as a source of reducing equivalent under aerobic and anaerobic conditions [NiFe] hydrogenases consist of two subunits, hydrogenase large and hydrogenase small. The large subunit contains the binuclear [NiFe] active site, while the small subunit binds at least one [4Fe-4S] cluster []. Energy-converting [NiFe] hydrogenases (or [NiFe]-hydrogenase-3-type) form a distinct group within the [NiFe] hydrogenase family [, ]. Members of this subgroup include:  Hydrogenase 3 and 4 (Hyc and Hyf) from Escherichia coli  CO-induced hydrogenase (Coo) from Rhodospirillum rubrum  Mbh hydrogenase from Pyrococcus furiosus  Eha and Ehb hydrogenases from Methanothermobacter species Ech hydrogenase from Methanosarcina barkeri   Energy-converting [NiFe] hydrogenases are membrane-bound enzymes with a six-subunit core: the large and small hydrogenase subunits, plus two hydrophilic proteins and two integral membrane proteins. Their large and small subunits show little sequence similarity to other [NiFe] hydrogenases, except for key conserved residues coordinating the active site and [FeS] cluster. However, they show considerable sequence similarity to the six-subunit, energy-conserving NADH:quinone oxidoreductases (complex I), which are present in cytoplasmic membranes of many bacteria and in inner mitochondrial membranes. However, the reactions they catalyse differ significantly from complex I. Energy-converting [NiFe] hydrogenases function as ion pumps. Eha and Ehb hydrogenases contain extra subunits in addition to those shared by other energy-converting [NiFe] hydrogenases (or [NiFe]-hydrogenase-3-type). Eha contains a 6[4Fe-4S] polyferredoxin, a 10[4F-4S] polyferredoxin, ten other predicted integral membrane proteins (EhaA IPR011306 from INTERPRO, EhaB IPR011314 from INTERPRO, EhaC IPR011316 from INTERPRO, EhaD IPR011308 from INTERPRO, EhaE IPR011317 from INTERPRO, EhaF IPR011313 from INTERPRO, EhaG IPR011311 from INTERPRO, EhaI IPR011318 from INTERPRO, EhaK IPR011319 from INTERPRO, EhaL IPR011305 from INTERPRO) and four hydrophobic subunits (EhaM, EhaR IPR014502 from INTERPRO, EhS, EhT) []. The ten predicted integral membrane proteins are absent from Ech, Coo, Hyc and Hyf complexes, which may have simpler membrane components than Eha. Eha and Ehb catalyse the reduction of low-potential redox carriers (e.g. ferredoxins or polyferredoxins), which then might function as electron donors to oxidoreductases. Based on sequence similarity and genome context analysis, other organisms such as Methanopyrus kandleri, Methanocaldococcus jannaschii, and Methanothermobacter marburgensis also encode Eha-like [NiFe]-hydrogenase-3-type complexes and have very similar eha operon structure. This entry represents small membrane proteins that are predicted to be the EhaF transmembrane subunits of multi-subunit membrane-bound [NiFe]-hydrogenase Eha complexes.
Probab=35.37  E-value=27  Score=27.64  Aligned_cols=10  Identities=30%  Similarity=0.614  Sum_probs=7.8

Q ss_pred             CCccCCcccc
Q psy8715          58 DKFVYPYNLG   67 (164)
Q Consensus        58 ~~~~~PYDlG   67 (164)
                      +.-.+|||+|
T Consensus        56 ~~pLaPYDRG   65 (153)
T PF09879_consen   56 KSPLAPYDRG   65 (153)
T ss_pred             CCCCCcccCC
Confidence            3457899998


No 26 
>PRK09570 rpoH DNA-directed RNA polymerase subunit H; Reviewed
Probab=34.38  E-value=30  Score=24.52  Aligned_cols=15  Identities=13%  Similarity=0.253  Sum_probs=13.3

Q ss_pred             ccccCCCEEEEeeee
Q psy8715         147 INLQVNETVLVTRFR  161 (164)
Q Consensus       147 i~~~~gd~~~vtr~~  161 (164)
                      +.+++||+|.+||..
T Consensus        50 ~g~k~GdVvkI~R~S   64 (79)
T PRK09570         50 IGAKPGDVIKIVRKS   64 (79)
T ss_pred             cCCCCCCEEEEEECC
Confidence            689999999999964


No 27 
>PF11044 TMEMspv1-c74-12:  Plectrovirus spv1-c74 ORF 12 transmembrane protein;  InterPro: IPR022743  This is a group of proteins expressed by Plectroviruses. The Plectroviruses are single-stranded DNA viruses belonging to the Inoviridae. This entry represents putative transmembrane proteins of unknown function. 
Probab=34.28  E-value=1.3e+02  Score=19.34  Aligned_cols=27  Identities=22%  Similarity=0.410  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy8715          10 FHWGPLLAIVGVVIAVGMLFYFQVKAI   36 (164)
Q Consensus        10 ~~if~~vL~i~v~iavg~Ll~~hi~lI   36 (164)
                      ..+|+.++.++++.-+|++.+--+..|
T Consensus         6 t~iFsvvIil~If~~iGl~IyQkikqI   32 (49)
T PF11044_consen    6 TTIFSVVIILGIFAWIGLSIYQKIKQI   32 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345666666666666666655555544


No 28 
>PF06143 Baculo_11_kDa:  Baculovirus 11 kDa family;  InterPro: IPR009313 This is a family of uncharacterised Baculovirus proteins that are all about 11 kDa in size.
Probab=34.01  E-value=1.1e+02  Score=22.04  Aligned_cols=30  Identities=20%  Similarity=0.180  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCcchhhh
Q psy8715          16 LAIVGVVIAVGMLFYFQVKAILKNQTNIED   45 (164)
Q Consensus        16 vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~   45 (164)
                      +++..+++.+..+|+.=++.|.+|.-..|.
T Consensus        39 Vic~~lVfVii~lFi~ll~~i~~~~e~~~~   68 (84)
T PF06143_consen   39 VICCFLVFVIIVLFILLLYNINKNAEQDRA   68 (84)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhHH
Confidence            444444444555555555556655544433


No 29 
>TIGR03064 sortase_srtB sortase, SrtB family. Members of this transpeptidase family are, in most cases, designated sortase B, product of the srtB gene. This protein shows only distant similarity to the sortase A family, for which there may be several members in a single bacterial genome. Typical SrtB substrate motifs include NAKTN, NPKSS, etc, and otherwise resemble the LPXTG sorting signals recognized by sortase A proteins.
Probab=33.07  E-value=1.1e+02  Score=25.52  Aligned_cols=21  Identities=29%  Similarity=0.450  Sum_probs=16.3

Q ss_pred             HhhCc-ccCCCCceecccCCcc
Q psy8715          74 LVFGS-SSISNGITWPVVEGCH   94 (164)
Q Consensus        74 ~VfGW-~p~gDGi~wpv~~~c~   94 (164)
                      ++.|| .-+|-.+.+||..+-+
T Consensus        68 D~vgWi~ipgT~IdyPVvq~~d   89 (232)
T TIGR03064        68 DIVGWITVPGTHIDYPVVQGKD   89 (232)
T ss_pred             CEEEEEEECCcccccCeeeCCC
Confidence            47789 7788899999876643


No 30 
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=32.35  E-value=34  Score=23.91  Aligned_cols=15  Identities=13%  Similarity=0.220  Sum_probs=11.4

Q ss_pred             ccccCCCEEEEeeee
Q psy8715         147 INLQVNETVLVTRFR  161 (164)
Q Consensus       147 i~~~~gd~~~vtr~~  161 (164)
                      +.+++||.|.++|-.
T Consensus        47 ~g~k~GdVvkI~R~S   61 (74)
T PF01191_consen   47 LGAKPGDVVKIIRKS   61 (74)
T ss_dssp             TT--TTSEEEEEEEE
T ss_pred             cCCCCCCEEEEEecC
Confidence            578999999999964


No 31 
>PF14851 FAM176:  FAM176 family
Probab=32.34  E-value=67  Score=25.45  Aligned_cols=22  Identities=14%  Similarity=0.208  Sum_probs=16.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q psy8715           7 KRLFHWGPLLAIVGVVIAVGML   28 (164)
Q Consensus         7 ~~~~~if~~vL~i~v~iavg~L   28 (164)
                      +++.+.|..++++++++.+++|
T Consensus        20 E~~aLYFv~gVC~GLlLtLcll   41 (153)
T PF14851_consen   20 ERFALYFVSGVCAGLLLTLCLL   41 (153)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4677888888888888777666


No 32 
>PF06072 Herpes_US9:  Alphaherpesvirus tegument protein US9;  InterPro: IPR009278 This family consists of several US9 and related proteins from the Alphaherpesviruses. The function of the US9 protein is unknown although in Bovine herpesvirus 5 Us9 is essential for the anterograde spread of the virus from the olfactory mucosa to the bulb [].; GO: 0019033 viral tegument
Probab=30.67  E-value=65  Score=21.76  Aligned_cols=22  Identities=14%  Similarity=0.108  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy8715          11 HWGPLLAIVGVVIAVGMLFYFQ   32 (164)
Q Consensus        11 ~if~~vL~i~v~iavg~Ll~~h   32 (164)
                      +++.+++..++...+|.|+.+|
T Consensus        38 ~v~~~~~~c~~S~~lG~~~~~~   59 (60)
T PF06072_consen   38 IVFAVVALCVLSGGLGALVAWH   59 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcc
Confidence            3444444555566666666655


No 33 
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=30.32  E-value=51  Score=20.45  Aligned_cols=15  Identities=7%  Similarity=0.224  Sum_probs=11.0

Q ss_pred             cccccCCCEEEEeee
Q psy8715         146 RINLQVNETVLVTRF  160 (164)
Q Consensus       146 ri~~~~gd~~~vtr~  160 (164)
                      -+.+++||+|.|.+.
T Consensus        12 ELs~~~Gd~i~v~~~   26 (49)
T PF14604_consen   12 ELSFKKGDVITVLEK   26 (49)
T ss_dssp             B-EB-TTEEEEEEEE
T ss_pred             EeeEcCCCEEEEEEe
Confidence            399999999999854


No 34 
>COG3477 Predicted periplasmic/secreted protein [Function unknown]
Probab=29.92  E-value=1.5e+02  Score=24.07  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=13.2

Q ss_pred             CcccchHhHHHHhhC
Q psy8715          63 PYNLGWKKNIHLVFG   77 (164)
Q Consensus        63 PYDlG~~~Nl~~VfG   77 (164)
                      ++|+-+.+|+.|+||
T Consensus       133 lw~~p~~Eh~SEifG  147 (176)
T COG3477         133 LWDLPFYEHLSEIFG  147 (176)
T ss_pred             cccCcHHHHHHHHHH
Confidence            577778899999999


No 35 
>PRK14725 pyruvate kinase; Provisional
Probab=29.88  E-value=62  Score=31.07  Aligned_cols=53  Identities=15%  Similarity=0.167  Sum_probs=34.7

Q ss_pred             HHhhhcCCCeEEeeccCceEee-ecc------cceeecc---------cCCCCcCcccccCCCEEEEeee
Q psy8715         107 NIKKAHSQPVLVVKNYNGRCLP-LMF------GLKVSWH---------TPCFDIARINLQVNETVLVTRF  160 (164)
Q Consensus       107 ~~kr~r~~~~~~~~~~~g~~~~-~~~------g~~~~~~---------~P~~de~ri~~~~gd~~~vtr~  160 (164)
                      .|.|.+.|.++|++...+.++- .++      |..+...         .|-. |..|.|++||.+.+|+.
T Consensus       278 ~DaRg~~R~l~V~~~~~~~~~~~~~~~~Y~~~G~~l~~~~~~~~~v~~~p~~-~~~i~L~~Gd~l~lt~~  346 (608)
T PRK14725        278 TDARGKKRKLTVTEVDDEGVLAEGSQTAYLANGTLLRLGRHDSTRVGGLPPV-EQKLRLKVGDRLVLTRD  346 (608)
T ss_pred             eeccccceeeeEEeecCceeEEeecceeeeccCceeeecccccccccccccc-CcceEecCCCEEEEecC
Confidence            3667889999998877765543 222      3222222         2322 34699999999999986


No 36 
>PF03079 ARD:  ARD/ARD' family;  InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ []. ARD and ARD' can be experimentally interconverted by removal of the bound metal ion and reconstitution with the appropriate metal ion. The two enzymes share the same substrate, 1,2-dihydroxy-3-keto-5-(methylthio)pentene, but yield different products. ARD' yields the alpha-keto precursor of methionine (and formate), thus forming part of the ubiquitous methionine salvage pathway that converts 5'-methylthioadenosine (MTA) to methionine. This pathway is responsible for the tight control of the concentration of MTA, which is a powerful inhibitor of polyamine biosynthesis and transmethylation reactions []. ARD yields methylthiopropanoate, carbon monoxide and formate, and thus prevents the conversion of MTA to methionine. The role of the ARD catalysed reaction is unclear: methylthiopropanoate is cytotoxic, and carbon monoxide can activate guanylyl cyclase, leading to increased intracellular cGMP levels [, ].  This family also contains other proteins, whose functions are not well characterised.; GO: 0010309 acireductone dioxygenase [iron(II)-requiring] activity, 0055114 oxidation-reduction process; PDB: 1VR3_A 1ZRR_A 2HJI_A.
Probab=29.78  E-value=23  Score=27.94  Aligned_cols=18  Identities=17%  Similarity=0.139  Sum_probs=13.7

Q ss_pred             cccccCCCEEEEeeeecc
Q psy8715         146 RINLQVNETVLVTRFRNE  163 (164)
Q Consensus       146 ri~~~~gd~~~vtr~~~~  163 (164)
                      ||.+++||+|.|=.+..|
T Consensus       116 ri~~e~GDli~vP~g~~H  133 (157)
T PF03079_consen  116 RILCEKGDLIVVPAGTYH  133 (157)
T ss_dssp             EEEEETTCEEEE-TT--E
T ss_pred             EEEEcCCCEEecCCCCce
Confidence            789999999999888877


No 37 
>PF06837 Fijivirus_P9-2:  Fijivirus P9-2 protein;  InterPro: IPR009650 This family consists of several Fijivirus specific P9-2 proteins from Rice black streaked dwarf virus (RBSDV) and Fiji disease virus. The function of this family is unknown.
Probab=29.58  E-value=1.1e+02  Score=25.50  Aligned_cols=33  Identities=12%  Similarity=0.115  Sum_probs=19.8

Q ss_pred             CCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy8715           2 CLSPGKRLFHWGPLLAIVGVVIAVGMLFYFQVK   34 (164)
Q Consensus         2 ~~~~~~~~~~if~~vL~i~v~iavg~Ll~~hi~   34 (164)
                      |-+|..+...-..+.+.+.+++.+...+.||.+
T Consensus       108 ~CNpl~R~~~SivfTi~fy~~~~V~iyLv~~ff  140 (214)
T PF06837_consen  108 CCNPLIRGIFSIVFTILFYTLLFVSIYLVYFFF  140 (214)
T ss_pred             hcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            567776544444444556666667777666654


No 38 
>PHA03048 IMV membrane protein; Provisional
Probab=29.49  E-value=73  Score=23.27  Aligned_cols=37  Identities=8%  Similarity=0.045  Sum_probs=20.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhh
Q psy8715           8 RLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIED   45 (164)
Q Consensus         8 ~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~   45 (164)
                      +.+.+++|++++.+.+.+..+..|--|-- -|.+.+|.
T Consensus        44 Ralsii~FIlgivl~lG~~ifsmy~r~C~-~~~~~~~~   80 (93)
T PHA03048         44 RALSGIAFVLGIVMTIGMLIYSMWGRYCT-PSKVVIDN   80 (93)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcccC-CCcccCcc
Confidence            56677788887776665554444443322 34434443


No 39 
>KOG1226|consensus
Probab=29.44  E-value=59  Score=32.05  Aligned_cols=48  Identities=13%  Similarity=0.268  Sum_probs=35.4

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhhhh
Q psy8715           5 PGKRLFHWGPLLAIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEKAT   52 (164)
Q Consensus         5 ~~~~~~~if~~vL~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k~~   52 (164)
                      |+..++.++..+++.++++.+++|++|-+...+.++--.=.++.++.+
T Consensus       709 ~~~~~~~i~lgvv~~ivligl~llliwkll~~~~DrrE~akFe~er~~  756 (783)
T KOG1226|consen  709 PGPNILAIVLGVVAGIVLIGLALLLIWKLLTTIHDRREFAKFEKERLN  756 (783)
T ss_pred             CCCcEeeehHHHHHHHHHHHHHHHHHHHHhheecccHHhhhhhHHHHh
Confidence            344566777778888899999999999977777777665556655554


No 40 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=29.37  E-value=93  Score=19.09  Aligned_cols=21  Identities=19%  Similarity=0.116  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHH
Q psy8715           8 RLFHWGPLLAIVGVVIAVGML   28 (164)
Q Consensus         8 ~~~~if~~vL~i~v~iavg~L   28 (164)
                      +-+++|++++.+.+.+.++..
T Consensus        14 r~Wi~F~l~mi~vFi~li~yt   34 (38)
T PF09125_consen   14 RGWIAFALAMILVFIALIGYT   34 (38)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HhHHHHHHHHHHHHHHHHHHH
Confidence            456666666555444444433


No 41 
>PF05767 Pox_A14:  Poxvirus virion envelope protein A14;  InterPro: IPR008785 This family consists of several Poxvirus virion envelope protein A14-like sequences. A14 is a component of the virion membrane and has been found to be an H1 phosphatase substrate in vivo and in vitro. A14 is hyperphosphorylated on serine residues in the absence of H1 expression [].; GO: 0019031 viral envelope
Probab=29.26  E-value=1e+02  Score=22.54  Aligned_cols=28  Identities=4%  Similarity=0.008  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy8715           8 RLFHWGPLLAIVGVVIAVGMLFYFQVKA   35 (164)
Q Consensus         8 ~~~~if~~vL~i~v~iavg~Ll~~hi~l   35 (164)
                      +.+.+++|++++.+.+.+..+..|--|-
T Consensus        45 RalSii~FI~giil~lG~~i~s~ygr~C   72 (92)
T PF05767_consen   45 RALSIICFILGIILTLGIVIFSMYGRYC   72 (92)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            5677788888887776665555554443


No 42 
>PF00467 KOW:  KOW motif;  InterPro: IPR005824 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The KOW (Kyprides, Ouzounis, Woese) motif is found in a variety of ribosomal proteins and the bacterial transcription antitermination proteins NusG []. ; PDB: 3BBO_W 2HGJ_X 2HGQ_X 2HGU_X 1NPP_B 1M1G_D 1NPR_A 2XHC_A 2KVQ_G 2JVV_A ....
Probab=28.81  E-value=31  Score=19.68  Aligned_cols=11  Identities=36%  Similarity=0.208  Sum_probs=9.3

Q ss_pred             CCCEEEEeeee
Q psy8715         151 VNETVLVTRFR  161 (164)
Q Consensus       151 ~gd~~~vtr~~  161 (164)
                      +||.|+|+++.
T Consensus         1 ~Gd~V~V~~G~   11 (32)
T PF00467_consen    1 VGDTVKVISGP   11 (32)
T ss_dssp             TTSEEEESSST
T ss_pred             CCCEEEEeEcC
Confidence            69999999875


No 43 
>PF11808 DUF3329:  Domain of unknown function (DUF3329);  InterPro: IPR021766  This family of proteins are functionally uncharacterised. This family is only found in bacteria. ; GO: 0004673 protein histidine kinase activity
Probab=28.39  E-value=1.5e+02  Score=20.93  Aligned_cols=25  Identities=8%  Similarity=0.576  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHhcCcchhhhHhh
Q psy8715          20 GVVIAVGMLFYFQVKAILKNQTNIEDWIV   48 (164)
Q Consensus        20 ~v~iavg~Ll~~hi~lIl~NqTTIE~~~~   48 (164)
                      ++++++.+++++|+|.+.    -.|.|..
T Consensus        32 ~l~~~l~~~l~wh~~~l~----rL~~WL~   56 (90)
T PF11808_consen   32 ALLLGLLLYLFWHLYQLY----RLERWLR   56 (90)
T ss_pred             HHHHHHHHHHHHHHHHHH----HHHHHHh
Confidence            344455566777777554    4666643


No 44 
>PF03376 Adeno_E3B:  Adenovirus E3B protein;  InterPro: IPR005041 Adenoviruses are medium-sized, non-enveloped viruses containing double-stranded DNA. They can cause a variety of diseases including pneumonia, cystitis, conjunctivitis and diarrhoea, all of which can be fatal to patients who are immunocompromised []. These viruses have many mechanisms to evade the host immune response, including several proteins which are expressed as part of the early transcription unit 3 (E3) []. One of the regions of E3, known as the E3B region, encodes three proteins known as 10.4K, 14.5K and 14.7K. Two of these proteins, 10.4K and 14.5K, form the RID complex (receptor internalisation and degradation) which protects the infected cell from host-induced lysis by clearing the the TNF and Fas receptors from the cell surface []. Other receptors, such as the epidermal growth factor receptor, are also known to be cleared by RID [].  This entry represents the E3B region 10.4K protein, also known as the RID alpha subunit.; GO: 0016020 membrane
Probab=28.10  E-value=2e+02  Score=19.76  Aligned_cols=17  Identities=18%  Similarity=0.309  Sum_probs=8.7

Q ss_pred             CCCcchhHHHHHHHHHHH
Q psy8715           2 CLSPGKRLFHWGPLLAIV   19 (164)
Q Consensus         2 ~~~~~~~~~~if~~vL~i   19 (164)
                      ||.|+.. .++|+++-++
T Consensus         8 Cl~pf~v-Ylif~fv~c~   24 (67)
T PF03376_consen    8 CLPPFAV-YLIFAFVTCT   24 (67)
T ss_pred             ccchHHH-HHHHHHHHHH
Confidence            7777653 3444444333


No 45 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=27.97  E-value=1.6e+02  Score=21.24  Aligned_cols=36  Identities=28%  Similarity=0.274  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhcC----cchhhhHhhhhh
Q psy8715          16 LAIVGVVIAVGMLFYFQVKAILKN----QTNIEDWIVEKA   51 (164)
Q Consensus        16 vL~i~v~iavg~Ll~~hi~lIl~N----qTTIE~~~~~k~   51 (164)
                      +..+++++++++.++|++.-+-+=    ++.+|....+++
T Consensus         8 ~~~~~v~~~i~~y~~~k~~ka~~~~~kL~~en~qlk~Ek~   47 (87)
T PF10883_consen    8 GGVGAVVALILAYLWWKVKKAKKQNAKLQKENEQLKTEKA   47 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344556666777788888876665    566666655544


No 46 
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=27.48  E-value=60  Score=19.13  Aligned_cols=18  Identities=11%  Similarity=0.209  Sum_probs=14.0

Q ss_pred             CcCcccccCCCEEEEeee
Q psy8715         143 DIARINLQVNETVLVTRF  160 (164)
Q Consensus       143 de~ri~~~~gd~~~vtr~  160 (164)
                      ++..+.+++||.|.|...
T Consensus        15 ~~~~l~~~~Gd~v~v~~~   32 (58)
T smart00326       15 DPDELSFKKGDIITVLEK   32 (58)
T ss_pred             CCCCCCCCCCCEEEEEEc
Confidence            344589999999998754


No 47 
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=27.06  E-value=1.4e+02  Score=20.91  Aligned_cols=29  Identities=24%  Similarity=0.117  Sum_probs=19.3

Q ss_pred             cccceeecccCCCCcC-cccccCCCEEEEe
Q psy8715         130 MFGLKVSWHTPCFDIA-RINLQVNETVLVT  158 (164)
Q Consensus       130 ~~g~~~~~~~P~~de~-ri~~~~gd~~~vt  158 (164)
                      +-|..+.-+.|=---- +|.+.|||.|.|.
T Consensus        27 edg~~~~ahI~GKmr~~~i~I~~GD~V~Ve   56 (75)
T COG0361          27 ENGHERLAHISGKMRKNRIRILPGDVVLVE   56 (75)
T ss_pred             cCCcEEEEEccCcchheeEEeCCCCEEEEE
Confidence            5555555555532233 8999999999984


No 48 
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=26.86  E-value=67  Score=22.40  Aligned_cols=45  Identities=13%  Similarity=0.115  Sum_probs=33.9

Q ss_pred             HhhhcCCCeEEeeccCceEeeecccceeecccCCCCcCcccccCCCEEEEeeeecc
Q psy8715         108 IKKAHSQPVLVVKNYNGRCLPLMFGLKVSWHTPCFDIARINLQVNETVLVTRFRNE  163 (164)
Q Consensus       108 ~kr~r~~~~~~~~~~~g~~~~~~~g~~~~~~~P~~de~ri~~~~gd~~~vtr~~~~  163 (164)
                      .++.|...|++.=.-+|.-+-         ..-.|.  .+-|+|||.-.+.=++||
T Consensus        23 ~~~GR~~syr~~Vq~NGnLLI---------G~AYT~--~m~L~PGdEFeI~LgrKh   67 (71)
T PF14250_consen   23 GRRGRKASYRVSVQGNGNLLI---------GSAYTK--QMGLKPGDEFEIKLGRKH   67 (71)
T ss_pred             CCCCcCceEEEEEecCCCEEE---------cHHHHH--HhCCCCCCEEEEEeCcce
Confidence            567788888876666665443         445665  599999999999999988


No 49 
>COG2063 FlgH Flagellar basal body L-ring protein [Cell motility and secretion]
Probab=26.56  E-value=47  Score=28.06  Aligned_cols=24  Identities=21%  Similarity=0.425  Sum_probs=20.4

Q ss_pred             ecccceeecccCCCCcCcccccCCCEEEEe
Q psy8715         129 LMFGLKVSWHTPCFDIARINLQVNETVLVT  158 (164)
Q Consensus       129 ~~~g~~~~~~~P~~de~ri~~~~gd~~~vt  158 (164)
                      +..|     ..|+++|+| +..+||+|.|+
T Consensus        58 ~~~~-----~~~Lf~D~R-A~~vGDilTV~   81 (230)
T COG2063          58 WNYG-----YQPLFEDRR-ASNVGDILTIV   81 (230)
T ss_pred             cCcc-----cchhhcccc-cccCCCEEEEE
Confidence            4777     789999876 89999999986


No 50 
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=26.27  E-value=46  Score=22.86  Aligned_cols=14  Identities=21%  Similarity=0.214  Sum_probs=12.6

Q ss_pred             CcccccCCCEEEEe
Q psy8715         145 ARINLQVNETVLVT  158 (164)
Q Consensus       145 ~ri~~~~gd~~~vt  158 (164)
                      .||.+.+||.|.|.
T Consensus        41 ~rI~I~~GD~V~Ve   54 (68)
T TIGR00008        41 HYIRILPGDKVKVE   54 (68)
T ss_pred             ccEEECCCCEEEEE
Confidence            58999999999985


No 51 
>PF01505 Vault:  Major Vault Protein repeat;  InterPro: IPR002499 Vaults are the largest ribonucleoprotein particles known, having a mass of approximately 13 MDa. They are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction and may also play a role in nucleo-cytoplasmic transport. Vaults are present in most normal tissues, but are more highly expressed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine []. Overexpression of these proteins is linked with multidrug-resistance in cancer cells. The mammalian vault structure is highly regular and consists of approximately 96 molecules of the 100 kDa major vault protein (MVP), 2 molecules of the 240 kDa minor vault protein TEP1, 8 molecules of the 193 kDa minor vault protein VPARP and at least 6 copies of a small untranslated RNA of 88-141 bases. The MVP molecules form the core of the complex, which is a barrel-like structure with an invaginated waist and two protruding caps. The complex can unfold into two symmetrical flower-like structures with 8 petals each supposedly consisting of 6 MVP molecules [].  The MVP protein is composed of two distinct domains []. The N-terminal domain contains ~8 copies of the vault repeat (or MVP repeat) in tandem. The MVP repeat is composed of ~53 amino acids and forms a structural part of the vault wall. The C-terminal part of MVP may be involved in oligomerization and be located in the vault cap, while the MVP repeats in the N-terminal part can be packed like staves in a barrel to form the vault wall. The 3D structure of the repeat forms a fold that consists of a three stranded (B) antiparallel beta-sheet in a unique topology B2-B1-B3 and two loops. MVP repeats can be interaction-mediating modules, as MVP repeats 3 and 4 bind VPARP, which is one of the other vault proteins.; PDB: 3GF5_A 3GNG_A 3GNF_B 2ZUO_G 2QZV_B 2ZV5_c 2ZV4_Y 1Y7X_A.
Probab=25.45  E-value=57  Score=20.00  Aligned_cols=29  Identities=21%  Similarity=0.086  Sum_probs=23.2

Q ss_pred             cccceeecccCCCCcCcccccCCCEEEEe
Q psy8715         130 MFGLKVSWHTPCFDIARINLQVNETVLVT  158 (164)
Q Consensus       130 ~~g~~~~~~~P~~de~ri~~~~gd~~~vt  158 (164)
                      ..++.+..-.+++|+--..-++||.++|+
T Consensus         7 ~~al~l~A~~~f~D~~g~~R~~Ge~WLv~   35 (43)
T PF01505_consen    7 NEALHLRALRDFTDSDGVKRKAGEEWLVT   35 (43)
T ss_dssp             TEEEEEEESSSEESTTSSEECTTEEEEEE
T ss_pred             CCcEEEEEeecEECCCCCEEeCCCEEEEe
Confidence            45566766778889777889999999996


No 52 
>PF10260 SAYSvFN:  Uncharacterized conserved domain (SAYSvFN);  InterPro: IPR019387  This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. 
Probab=24.76  E-value=1.8e+02  Score=20.10  Aligned_cols=48  Identities=23%  Similarity=0.318  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHhcCcchhhhHhhhhhhhhhcCCCccCCcccchHhHHHHhhCcccCCCCceecccCCccccccchHHHHHH
Q psy8715          27 MLFYFQVKAILKNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKNIHLVFGSSSISNGITWPVVEGCHQYSLTMEQLEQK  106 (164)
Q Consensus        27 ~Ll~~hi~lIl~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~Nl~~VfGW~p~gDGi~wpv~~~c~qy~lt~eql~qk  106 (164)
                      .+.+-=+++|..|--+ +.         +  +.-...|+. .-+|++...|                   +|+.||+...
T Consensus        22 f~i~s~f~~I~~Nl~~-~r---------~--~ge~SAYSV-FN~~~~~i~G-------------------tl~aE~~ere   69 (71)
T PF10260_consen   22 FFILSGFYLIFTNLGT-PR---------K--PGELSAYSV-FNKGCERIPG-------------------TLTAEQFERE   69 (71)
T ss_pred             HHHHHHHHHHHHcCCC-CC---------C--CCCccchhh-hCCCccccCC-------------------CCCHHHHHHh
Confidence            3334445556667665 22         1  112445654 3468888887                   6888887643


No 53 
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=24.09  E-value=57  Score=23.25  Aligned_cols=16  Identities=13%  Similarity=0.206  Sum_probs=13.5

Q ss_pred             cccccCCCEEEEeeee
Q psy8715         146 RINLQVNETVLVTRFR  161 (164)
Q Consensus       146 ri~~~~gd~~~vtr~~  161 (164)
                      -+.+.+||+|.++|-.
T Consensus        52 ~lgak~GdvVkIvRkS   67 (80)
T COG2012          52 ALGAKPGDVVKIVRKS   67 (80)
T ss_pred             HccCCCCcEEEEEecC
Confidence            3778999999999964


No 54 
>PF07438 DUF1514:  Protein of unknown function (DUF1514);  InterPro: IPR009999 This entry is represented by Bacteriophage phi PVL, Orf60. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several Staphylococcus aureus and related bacteriophage proteins of around 65 residues in length. The function of this family is unknown.
Probab=24.08  E-value=87  Score=21.53  Aligned_cols=15  Identities=7%  Similarity=0.193  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHHHHHH
Q psy8715          11 HWGPLLAIVGVVIAV   25 (164)
Q Consensus        11 ~if~~vL~i~v~iav   25 (164)
                      ++++++|++++++++
T Consensus         3 IiiSIvLai~lLI~l   17 (66)
T PF07438_consen    3 IIISIVLAIALLISL   17 (66)
T ss_pred             hhHHHHHHHHHHHHH
Confidence            445555555554444


No 55 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=23.83  E-value=86  Score=22.71  Aligned_cols=10  Identities=30%  Similarity=0.109  Sum_probs=3.8

Q ss_pred             HHHHHHHHHH
Q psy8715           9 LFHWGPLLAI   18 (164)
Q Consensus         9 ~~~if~~vL~   18 (164)
                      .++++.++|+
T Consensus         5 ~~llL~l~LA   14 (95)
T PF07172_consen    5 AFLLLGLLLA   14 (95)
T ss_pred             HHHHHHHHHH
Confidence            3344433333


No 56 
>PF12072 DUF3552:  Domain of unknown function (DUF3552);  InterPro: IPR022711  This presumed domain is functionally uncharacterised. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with PF00013 from PFAM, PF01966 from PFAM. This domain has a single completely conserved residue A that may be functionally important. ; GO: 0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Probab=23.67  E-value=1.1e+02  Score=24.63  Aligned_cols=23  Identities=17%  Similarity=0.072  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy8715          11 HWGPLLAIVGVVIAVGMLFYFQV   33 (164)
Q Consensus        11 ~if~~vL~i~v~iavg~Ll~~hi   33 (164)
                      +|+..++++++++++|.++....
T Consensus         2 ~ii~~i~~~~vG~~~G~~~~~~~   24 (201)
T PF12072_consen    2 IIIIAIVALIVGIGIGYLVRKKI   24 (201)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Confidence            34555566666666666664433


No 57 
>PF07883 Cupin_2:  Cupin domain;  InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel). ; PDB: 2OPK_C 3BU7_B 2PHD_D 3NVC_A 3NKT_A 3NJZ_A 3NW4_A 3NST_A 3NL1_A 2H0V_A ....
Probab=23.17  E-value=35  Score=21.65  Aligned_cols=22  Identities=14%  Similarity=0.215  Sum_probs=18.3

Q ss_pred             CCcCcccccCCCEEEEeeeecc
Q psy8715         142 FDIARINLQVNETVLVTRFRNE  163 (164)
Q Consensus       142 ~de~ri~~~~gd~~~vtr~~~~  163 (164)
                      .|+-+..+++||.+.+-.+..|
T Consensus        34 ~~~~~~~l~~Gd~~~i~~~~~H   55 (71)
T PF07883_consen   34 VDGERVELKPGDAIYIPPGVPH   55 (71)
T ss_dssp             ETTEEEEEETTEEEEEETTSEE
T ss_pred             EccEEeEccCCEEEEECCCCeE
Confidence            4566899999999999887776


No 58 
>COG1935 Uncharacterized conserved protein [Function unknown]
Probab=22.41  E-value=62  Score=24.77  Aligned_cols=17  Identities=18%  Similarity=0.333  Sum_probs=13.6

Q ss_pred             cCcccccCCCEEEEeee
Q psy8715         144 IARINLQVNETVLVTRF  160 (164)
Q Consensus       144 e~ri~~~~gd~~~vtr~  160 (164)
                      +.-.+|++||.|.+|=-
T Consensus        34 ~tv~rl~~GDlVFlT~~   50 (122)
T COG1935          34 LTVLRLHEGDLVFLTST   50 (122)
T ss_pred             HHhhcCCCCCEEEEehh
Confidence            45688999999999843


No 59 
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=22.41  E-value=63  Score=24.06  Aligned_cols=31  Identities=19%  Similarity=0.262  Sum_probs=21.7

Q ss_pred             ecccceeecccCCCCcCcccccCCCEEEEeee
Q psy8715         129 LMFGLKVSWHTPCFDIARINLQVNETVLVTRF  160 (164)
Q Consensus       129 ~~~g~~~~~~~P~~de~ri~~~~gd~~~vtr~  160 (164)
                      |..|.|+. -.=+.|+.|-.+++||.|..+-+
T Consensus        13 I~~G~Kti-EiRlnD~kr~~ikvGD~I~f~~~   43 (109)
T cd06555          13 IKSGKKTI-EIRLNDEKRQQIKVGDKILFNDL   43 (109)
T ss_pred             HHcCCCEE-EEEecccchhcCCCCCEEEEEEc
Confidence            35555542 12267999999999999987653


No 60 
>PF05683 Fumerase_C:  Fumarase C-terminus;  InterPro: IPR004647 This entry represents various Fe-S type hydro-lyases, including the beta subunit from both L-tartrate dehydratase (TtdB; EC:4.2.1.32) and class 2 fumarate hydratase (FumC; (4.2.1.2 from EC) []. A number of Fe-S cluster-containing hydro-lyases share a conserved motif, including argininosuccinate lyase, adenylosuccinate lyase, aspartase, class I fumarate hydratase (fumarase), and tartrate dehydratase (see IPR000362 from INTERPRO). Proteins in this group represent a subset of closely related proteins or modules, including the Escherichia coli tartrate dehydratase beta chain and the C-terminal region of the class I fumarase (where the N-terminal region is homologous to the tartrate dehydratase alpha chain). The activity of the archaeal proteins in this group is unknown.; GO: 0016836 hydro-lyase activity; PDB: 2ISB_A.
Probab=22.35  E-value=39  Score=28.04  Aligned_cols=27  Identities=22%  Similarity=0.311  Sum_probs=16.8

Q ss_pred             cceeecccCCCCcCcccccCCCEEEEe
Q psy8715         132 GLKVSWHTPCFDIARINLQVNETVLVT  158 (164)
Q Consensus       132 g~~~~~~~P~~de~ri~~~~gd~~~vt  158 (164)
                      ...+-+.+|.++|---+|++||.|..+
T Consensus        26 ~~~~~L~tPlt~e~i~~L~vGD~V~Ls   52 (205)
T PF05683_consen   26 AREIELTTPLTEEDIRKLKVGDTVYLS   52 (205)
T ss_dssp             --EEEEESS--HHHHHH--TT-EEEEE
T ss_pred             eEEEEcCCCCCHHHHhhCCCCCEEEEe
Confidence            355667999999887799999999876


No 61 
>PTZ00241 40S ribosomal protein S11; Provisional
Probab=22.14  E-value=61  Score=25.93  Aligned_cols=21  Identities=14%  Similarity=0.252  Sum_probs=16.1

Q ss_pred             ccCCCCcCcccccCCCEEEEe
Q psy8715         138 HTPCFDIARINLQVNETVLVT  158 (164)
Q Consensus       138 ~~P~~de~ri~~~~gd~~~vt  158 (164)
                      ..+.=|+|.+.+++||+|.+.
T Consensus       106 k~~aHd~~~~~~kvGD~V~I~  126 (158)
T PTZ00241        106 NIPVHCSPCFDVKEGDIVVVG  126 (158)
T ss_pred             cEEEeCCccCCCCCCCEEEEE
Confidence            344556678889999999874


No 62 
>PF03120 DNA_ligase_OB:  NAD-dependent DNA ligase OB-fold domain;  InterPro: IPR004150 DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This family is a small domain found after the adenylation domain DNA_ligase_N in NAD+-dependent ligases (IPR001679 from INTERPRO). OB-fold domains generally are involved in nucleic acid binding.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 2OWO_A 1TAE_A 3UQ8_A 1DGS_A 1V9P_B 3SGI_A.
Probab=22.06  E-value=63  Score=22.94  Aligned_cols=15  Identities=40%  Similarity=0.758  Sum_probs=11.2

Q ss_pred             cccccCCCEEEEeee
Q psy8715         146 RINLQVNETVLVTRF  160 (164)
Q Consensus       146 ri~~~~gd~~~vtr~  160 (164)
                      +..+.+||.|.|+|.
T Consensus        47 ~~~i~~Gd~V~V~ra   61 (82)
T PF03120_consen   47 ELDIRIGDTVLVTRA   61 (82)
T ss_dssp             HTT-BBT-EEEEEEE
T ss_pred             HcCCCCCCEEEEEEC
Confidence            477899999999986


No 63 
>KOG2384|consensus
Probab=21.96  E-value=47  Score=27.81  Aligned_cols=37  Identities=27%  Similarity=0.308  Sum_probs=27.2

Q ss_pred             HHHHhhCc----------------ccCCCCceecccCCccccccchHHHHHHHHh
Q psy8715          71 NIHLVFGS----------------SSISNGITWPVVEGCHQYSLTMEQLEQKNIK  109 (164)
Q Consensus        71 Nl~~VfGW----------------~p~gDGi~wpv~~~c~qy~lt~eql~qk~~k  109 (164)
                      |-+..|||                -..|-|..|+-.  |+...++.-||+||.-+
T Consensus         6 n~rD~fgWTalmcaa~eg~~eavsyllgrg~a~vgv--~d~ssldaaqlaek~g~   58 (223)
T KOG2384|consen    6 NARDAFGWTALMCAAMEGSNEAVSYLLGRGVAFVGV--TDESSLDAAQLAEKGGA   58 (223)
T ss_pred             cchhhhcchHHHHHhhhcchhHHHHHhccCcccccc--cccccchHHHHHHhcCh
Confidence            56677887                346778877743  57778889999998754


No 64 
>PF10332 DUF2418:  Protein of unknown function (DUF2418);  InterPro: IPR018819  This entry represents the conserved 100 residue central region from a family of proteins found in fungi. It carries a characteristic EYD sequence motif. The function is not known. 
Probab=21.83  E-value=3.2e+02  Score=19.84  Aligned_cols=31  Identities=19%  Similarity=0.259  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcCcchhhhHhhhh
Q psy8715          17 AIVGVVIAVGMLFYFQVKAILKNQTNIEDWIVEK   50 (164)
Q Consensus        17 L~i~v~iavg~Ll~~hi~lIl~NqTTIE~~~~~k   50 (164)
                      ......+.+..++.++++++..   ..|..++++
T Consensus        38 ~~~~~~~~~~~l~s~~l~~li~---~f~~~ikD~   68 (99)
T PF10332_consen   38 VTSFTTLFLMVLLSFQLYFLIS---RFEQLIKDK   68 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH---HHHHHhhHH
Confidence            4445555666677777777664   555544443


No 65 
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic. This model represents the archaeal and eukaryotic branch of the ribosomal protein L24p/L26e family. Bacterial and organellar forms are represented by the related TIGR01079.
Probab=21.72  E-value=56  Score=24.61  Aligned_cols=27  Identities=11%  Similarity=0.041  Sum_probs=19.2

Q ss_pred             ecccCCCCcC-------cccccCCCEEEEeeeec
Q psy8715         136 SWHTPCFDIA-------RINLQVNETVLVTRFRN  162 (164)
Q Consensus       136 ~~~~P~~de~-------ri~~~~gd~~~vtr~~~  162 (164)
                      .+++|..+|.       .+.+..||.|.|++|..
T Consensus        22 ~~~a~ls~elr~~y~~r~~~IkkGD~V~Vi~Gk~   55 (114)
T TIGR01080        22 LMSAPLSKELREKYGKRALPVRKGDKVRIMRGDF   55 (114)
T ss_pred             eeecccCHHHHHHcCcccceeecCCEEEEecCCC
Confidence            3455555543       36789999999999863


No 66 
>PF07732 Cu-oxidase_3:  Multicopper oxidase;  InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08.  This entry represents multicopper oxidase type 3 (or coupled binuclear) domains. ; GO: 0005507 copper ion binding; PDB: 2QT6_B 3KW7_B 2R7E_A 3CDZ_A 1SDD_A 3G5W_D 3UAC_A 2YXV_A 3OD3_A 3NSY_A ....
Probab=21.43  E-value=43  Score=24.69  Aligned_cols=15  Identities=27%  Similarity=0.306  Sum_probs=13.8

Q ss_pred             cCcccccCCCEEEEe
Q psy8715         144 IARINLQVNETVLVT  158 (164)
Q Consensus       144 e~ri~~~~gd~~~vt  158 (164)
                      .|-|+++.||.|.|+
T Consensus        25 GPtI~v~~Gd~v~i~   39 (117)
T PF07732_consen   25 GPTIRVREGDTVRIT   39 (117)
T ss_dssp             EEEEEEETTEEEEEE
T ss_pred             CCEEEEEcCCeeEEE
Confidence            688999999999987


No 67 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=21.35  E-value=1e+02  Score=19.98  Aligned_cols=17  Identities=12%  Similarity=-0.011  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy8715          17 AIVGVVIAVGMLFYFQV   33 (164)
Q Consensus        17 L~i~v~iavg~Ll~~hi   33 (164)
                      +++++++.+.+++..|+
T Consensus         7 V~i~iv~~lLg~~I~~~   23 (50)
T PF12606_consen    7 VSIFIVMGLLGLSICTT   23 (50)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34444444444555543


No 68 
>PF15179 Myc_target_1:  Myc target protein 1
Probab=21.25  E-value=1.2e+02  Score=24.93  Aligned_cols=22  Identities=9%  Similarity=0.153  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy8715          11 HWGPLLAIVGVVIAVGMLFYFQ   32 (164)
Q Consensus        11 ~if~~vL~i~v~iavg~Ll~~h   32 (164)
                      +|++|.+++++.+.+|+|.+.=
T Consensus        21 lIlaF~vSm~iGLviG~li~~L   42 (197)
T PF15179_consen   21 LILAFCVSMAIGLVIGALIWAL   42 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4555555555555555554433


No 69 
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated
Probab=21.05  E-value=65  Score=24.56  Aligned_cols=17  Identities=24%  Similarity=0.229  Sum_probs=14.7

Q ss_pred             CcccccCCCEEEEeeee
Q psy8715         145 ARINLQVNETVLVTRFR  161 (164)
Q Consensus       145 ~ri~~~~gd~~~vtr~~  161 (164)
                      ..+.+..||.|.|.+|.
T Consensus        42 r~~~IkkGD~V~VisG~   58 (120)
T PRK01191         42 RSLPVRKGDTVKVMRGD   58 (120)
T ss_pred             ccceEeCCCEEEEeecC
Confidence            46789999999999885


No 70 
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=20.75  E-value=61  Score=23.45  Aligned_cols=15  Identities=20%  Similarity=0.315  Sum_probs=12.6

Q ss_pred             cCcccccCCCEEEEe
Q psy8715         144 IARINLQVNETVLVT  158 (164)
Q Consensus       144 e~ri~~~~gd~~~vt  158 (164)
                      --+|++-+||.|.|-
T Consensus        42 ~~rIrIl~GD~V~VE   56 (87)
T PRK12442         42 KHRIRILAGDRVTLE   56 (87)
T ss_pred             eeeEEecCCCEEEEE
Confidence            358999999999983


No 71 
>PF15179 Myc_target_1:  Myc target protein 1
Probab=20.66  E-value=1.6e+02  Score=24.25  Aligned_cols=30  Identities=27%  Similarity=0.485  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy8715           9 LFHWGPLLAIVGVVIAVGMLFYFQVKAILK   38 (164)
Q Consensus         9 ~~~if~~vL~i~v~iavg~Ll~~hi~lIl~   38 (164)
                      -+-.--+++++.|.+++|+++.-=+|.+++
T Consensus        15 ~f~~~~lIlaF~vSm~iGLviG~li~~Llt   44 (197)
T PF15179_consen   15 NFDWEDLILAFCVSMAIGLVIGALIWALLT   44 (197)
T ss_pred             hcchhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333456789999999999999999999874


No 72 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.63  E-value=1.9e+02  Score=20.22  Aligned_cols=19  Identities=5%  Similarity=-0.043  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy8715          11 HWGPLLAIVGVVIAVGMLF   29 (164)
Q Consensus        11 ~if~~vL~i~v~iavg~Ll   29 (164)
                      .++..++++.+.++.|+|+
T Consensus         6 ail~ivl~ll~G~~~G~fi   24 (71)
T COG3763           6 AILLIVLALLAGLIGGFFI   24 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3455556666666666443


No 73 
>PF12380 Peptidase_C62:  Gill-associated viral 3C-like peptidase;  InterPro: IPR024348 This protease is found in polyproteins from the positive-stranded RNA virus of prawns called yellow head virus or gill-associated virus (GAV). The GAV cysteine proteinase (3C-like proteinase) is predicted to be the key enzyme in the processing of the GAV replicase polyprotein precursors, polyprotein 1a and polyprotein 1ab. This protease employs a Cys(2968)-His(2879) catalytic dyad []. It is classified as family C62 in the MEROPS database.
Probab=20.51  E-value=42  Score=27.97  Aligned_cols=48  Identities=31%  Similarity=0.512  Sum_probs=34.0

Q ss_pred             cCcchhhhHhhhhhhhhhcCCCccCCcccchHhHHHHhhCc------ccCCCCceeccc--CCccccccc
Q psy8715          38 KNQTNIEDWIVEKATKRKRQDKFVYPYNLGWKKNIHLVFGS------SSISNGITWPVV--EGCHQYSLT   99 (164)
Q Consensus        38 ~NqTTIE~~~~~k~~~rr~~~~~~~PYDlG~~~Nl~~VfGW------~p~gDGi~wpv~--~~c~qy~lt   99 (164)
                      -|.|++|..             ..+|||. .++|+..|.|-      -.+|.-++||..  +.|..-+||
T Consensus        13 gn~t~vedl-------------nkhpynk-yr~nivrvygergdlngflsgk~l~fprhifd~ctdntlt   68 (284)
T PF12380_consen   13 GNNTRVEDL-------------NKHPYNK-YRSNIVRVYGERGDLNGFLSGKFLHFPRHIFDSCTDNTLT   68 (284)
T ss_pred             CCccchhhh-------------ccCchhh-hhhhheEeeccccccccccccceeccchhhhcccccccee
Confidence            377888872             3578987 68999999982      456777888853  557655554


No 74 
>PHA03049 IMV membrane protein; Provisional
Probab=20.45  E-value=1.4e+02  Score=20.68  Aligned_cols=31  Identities=10%  Similarity=0.092  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HhcCcchhhh
Q psy8715          15 LLAIVGVVIAVGMLFYFQVKA-ILKNQTNIED   45 (164)
Q Consensus        15 ~vL~i~v~iavg~Ll~~hi~l-Il~NqTTIE~   45 (164)
                      -++.+++++++.+|..|-+|. ..++|++.++
T Consensus         4 d~~l~iICVaIi~lIvYgiYnkk~~~q~~~p~   35 (68)
T PHA03049          4 DIILVIICVVIIGLIVYGIYNKKTTTSQNPPS   35 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccCCCCCC
Confidence            345556777788888888887 4445555543


No 75 
>PF08173 YbgT_YccB:  Membrane bound YbgT-like protein;  InterPro: IPR012994 This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in Escherichia coli. Members have a consensus motif (MWYFXW), which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to proteobacteria [].
Probab=20.39  E-value=1.5e+02  Score=17.04  Aligned_cols=16  Identities=25%  Similarity=0.146  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy8715          13 GPLLAIVGVVIAVGML   28 (164)
Q Consensus        13 f~~vL~i~v~iavg~L   28 (164)
                      |+.+|+++++++++.+
T Consensus         4 faWilG~~lA~~~~i~   19 (28)
T PF08173_consen    4 FAWILGVLLACAFGIL   19 (28)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5566666666666554


No 76 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=20.05  E-value=1.5e+02  Score=20.53  Aligned_cols=31  Identities=10%  Similarity=0.103  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HhcCcchhhh
Q psy8715          15 LLAIVGVVIAVGMLFYFQVKA-ILKNQTNIED   45 (164)
Q Consensus        15 ~vL~i~v~iavg~Ll~~hi~l-Il~NqTTIE~   45 (164)
                      -++.+++++++.+|.+|-+|. ...+|++..+
T Consensus         4 d~iLi~ICVaii~lIlY~iYnr~~~~q~~~~~   35 (68)
T PF05961_consen    4 DFILIIICVAIIGLILYGIYNRKKTTQNTNPS   35 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccCCCCCc
Confidence            345556677777788888887 3444444433


Done!