Diaphorina citri psyllid: psy8716


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MDQLFEVSFSPLAATGKAMSQELKCPIDDFELLCWSMGNKGKSYILCPYCYNNPPYRDMKKGSGCNVCTHPTCGQALLSTGIASCLQCEGGVLVLDLSSAPKWKICCNKCDIIIHVFPDAQKVQVCTENNCDCVQFTSNDK
cccccEEEECccccccccccccccccccccEEEEEEccccccCEECcccccccccccccccccccccccccccccHHccccccccccccccEEEECccccccEEEEccccccEEEcccccEEEEccccccccccccccccc
*DQLFEVSFSP*********QELKCPIDDFELLCWSMGNKGKSYILCPYCYNNPPYRDMKKGSGCNVCTHPTCGQALLSTGIASCLQCEGGVLVLDLSSAPKWKICCNKCDIIIHVFPDAQKVQVCTENNCDCVQFT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQLFEVSFSPLAATGKAMSQELKCPIDDFELLCWSMGNKGKSYILCPYCYNNPPYRDMKKGSGCNVCTHPTCGQALLSTGIASCLQCEGGVLVLDLSSAPKWKICCNKCDIIIHVFPDAQKVQVCTENNCDCVQFTSNDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000793 [CC]condensed chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0000737 [BP]DNA catabolic process, endonucleolyticprobableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0004520 [MF]endodeoxyribonuclease activityprobableGO:0016787, GO:0004536, GO:0004519, GO:0016788, GO:0003824, GO:0003674, GO:0004518

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DL6, chain A
Confidence level:probable
Coverage over the Query: 80-114
View the alignment between query and template
View the model in PyMOL