Query         psy8719
Match_columns 33
No_of_seqs    109 out of 383
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 17:29:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8719.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8719hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0349|consensus               98.1   2E-06 4.3E-11   58.2   2.6   26    1-26    505-530 (725)
  2 COG0513 SrmB Superfamily II DN  97.8 3.4E-05 7.5E-10   49.7   3.6   26    2-27    274-299 (513)
  3 PRK04837 ATP-dependent RNA hel  97.7 6.6E-05 1.4E-09   46.3   4.4   30    2-31    256-285 (423)
  4 PRK11776 ATP-dependent RNA hel  97.7   8E-05 1.7E-09   46.4   4.5   30    2-31    243-272 (460)
  5 KOG0331|consensus               97.6 7.2E-05 1.6E-09   49.7   3.1   24    2-25    342-365 (519)
  6 PRK11192 ATP-dependent RNA hel  97.6 0.00018 3.8E-09   44.4   4.4   30    2-31    246-275 (434)
  7 PRK10590 ATP-dependent RNA hel  97.6 0.00014 3.1E-09   45.6   4.1   29    2-30    246-274 (456)
  8 KOG0332|consensus               97.5 9.9E-05 2.1E-09   48.9   3.2   29    1-29    330-358 (477)
  9 TIGR00614 recQ_fam ATP-depende  97.5 0.00022 4.7E-09   45.0   4.0   29    3-31    228-256 (470)
 10 PRK04537 ATP-dependent RNA hel  97.4 0.00024 5.1E-09   46.4   4.1   30    2-31    258-287 (572)
 11 PRK11057 ATP-dependent DNA hel  97.4 0.00025 5.4E-09   46.4   4.1   30    2-31    237-266 (607)
 12 KOG0328|consensus               97.4 0.00019 4.2E-09   46.6   3.2   28    1-28    266-293 (400)
 13 PRK01297 ATP-dependent RNA hel  97.3 0.00048   1E-08   43.3   4.4   30    2-31    336-365 (475)
 14 PTZ00110 helicase; Provisional  97.3 0.00044 9.5E-09   44.8   4.3   28    2-29    378-405 (545)
 15 PRK11634 ATP-dependent RNA hel  97.3 0.00042 9.1E-09   46.0   4.2   28    2-29    246-273 (629)
 16 TIGR01587 cas3_core CRISPR-ass  97.3 0.00034 7.4E-09   41.9   3.3   26    2-27    223-248 (358)
 17 TIGR01389 recQ ATP-dependent D  97.3 0.00053 1.1E-08   44.3   4.1   30    2-31    225-254 (591)
 18 TIGR03158 cas3_cyano CRISPR-as  97.2 0.00047   1E-08   42.5   3.3   25    2-26    273-297 (357)
 19 PTZ00424 helicase 45; Provisio  97.1  0.0011 2.4E-08   40.0   4.1   30    2-31    268-297 (401)
 20 TIGR02621 cas3_GSU0051 CRISPR-  97.1 0.00065 1.4E-08   47.2   3.3   25    2-26    273-297 (844)
 21 KOG0333|consensus               97.0 0.00065 1.4E-08   46.5   3.0   25    3-27    519-543 (673)
 22 KOG0327|consensus               97.0  0.0008 1.7E-08   44.0   3.0   30    1-30    263-292 (397)
 23 COG0514 RecQ Superfamily II DN  96.9  0.0014   3E-08   44.3   3.7   31    2-32    231-261 (590)
 24 PLN03137 ATP-dependent DNA hel  96.9  0.0012 2.6E-08   47.5   3.6   30    2-31    681-710 (1195)
 25 cd00079 HELICc Helicase superf  96.9   0.003 6.6E-08   31.9   4.1   30    2-31     29-58  (131)
 26 COG1202 Superfamily II helicas  96.7  0.0017 3.6E-08   45.3   3.0   30    2-31    441-470 (830)
 27 TIGR03817 DECH_helic helicase/  96.6  0.0022 4.7E-08   43.3   2.7   23    2-24    272-294 (742)
 28 PRK05298 excinuclease ABC subu  96.5  0.0048   1E-07   41.1   4.0   29    2-30    447-475 (652)
 29 TIGR00631 uvrb excinuclease AB  96.5  0.0048   1E-07   41.5   4.0   29    2-30    443-471 (655)
 30 PRK09751 putative ATP-dependen  96.4  0.0031 6.6E-08   46.0   2.8   24    2-25    245-268 (1490)
 31 PRK13767 ATP-dependent helicas  96.3  0.0043 9.2E-08   42.5   3.1   23    2-24    285-307 (876)
 32 PRK09401 reverse gyrase; Revie  96.3  0.0058 1.3E-07   43.5   3.8   28    2-29    329-359 (1176)
 33 PRK02362 ski2-like helicase; P  96.3  0.0045 9.7E-08   41.2   3.0   23    2-24    244-266 (737)
 34 PRK12898 secA preprotein trans  96.2  0.0088 1.9E-07   40.8   4.1   28    2-29    474-501 (656)
 35 TIGR01054 rgy reverse gyrase.   96.2  0.0076 1.6E-07   42.8   3.9   28    2-29    327-357 (1171)
 36 PRK00254 ski2-like helicase; P  96.0  0.0074 1.6E-07   40.1   3.0   22    2-23    239-260 (720)
 37 PLN00206 DEAD-box ATP-dependen  96.0   0.011 2.4E-07   38.0   3.6   23    2-24    368-390 (518)
 38 PRK09200 preprotein translocas  96.0   0.013 2.7E-07   40.7   3.9   27    2-28    429-455 (790)
 39 PRK01172 ski2-like helicase; P  95.9   0.011 2.3E-07   38.9   3.1   23    2-24    237-259 (674)
 40 PRK14701 reverse gyrase; Provi  95.8   0.011 2.3E-07   43.5   3.2   30    2-31    331-363 (1638)
 41 KOG0335|consensus               95.7   0.012 2.7E-07   39.2   3.1   28    1-28    337-364 (482)
 42 PRK04914 ATP-dependent helicas  95.7   0.018 3.9E-07   40.5   4.0   28    2-29    494-522 (956)
 43 COG1201 Lhr Lhr-like helicases  95.7   0.013 2.8E-07   40.9   3.2   25    2-26    254-278 (814)
 44 PRK13766 Hef nuclease; Provisi  95.7   0.025 5.4E-07   37.5   4.3   28    2-29    366-393 (773)
 45 TIGR03714 secA2 accessory Sec   95.5   0.026 5.6E-07   39.2   4.0   28    2-29    425-452 (762)
 46 KOG0352|consensus               95.3    0.02 4.3E-07   39.2   3.0   25    4-28    258-282 (641)
 47 PRK09694 helicase Cas3; Provis  95.3   0.024 5.3E-07   39.5   3.5   24    2-25    561-584 (878)
 48 PF05939 Phage_min_tail:  Phage  95.2   0.048   1E-06   29.5   3.9   30    4-33     45-74  (109)
 49 cd00158 RHOD Rhodanese Homolog  95.2   0.063 1.4E-06   25.6   3.9   31    2-32     51-81  (89)
 50 PRK12904 preprotein translocas  95.1   0.037   8E-07   38.8   3.9   27    2-28    431-457 (830)
 51 PHA02653 RNA helicase NPH-II;   95.1   0.028   6E-07   38.2   3.2   24    2-25    396-419 (675)
 52 TIGR00963 secA preprotein tran  94.9   0.038 8.3E-07   38.4   3.4   27    2-28    406-432 (745)
 53 smart00450 RHOD Rhodanese Homo  94.8   0.094   2E-06   25.0   3.9   31    2-32     57-87  (100)
 54 PRK12906 secA preprotein trans  94.8   0.041 8.8E-07   38.4   3.5   28    2-29    441-468 (796)
 55 KOG0337|consensus               94.7   0.039 8.6E-07   37.3   3.1   31    2-32    262-292 (529)
 56 PRK12900 secA preprotein trans  94.5   0.055 1.2E-06   38.9   3.5   28    2-29    599-626 (1025)
 57 KOG0330|consensus               94.2   0.058 1.3E-06   36.2   3.0   26    2-27    301-326 (476)
 58 PRK11131 ATP-dependent RNA hel  93.9   0.073 1.6E-06   38.8   3.3   26    2-27    287-312 (1294)
 59 KOG0326|consensus               93.9   0.056 1.2E-06   35.9   2.5   27    1-27    322-348 (459)
 60 KOG0351|consensus               93.8   0.051 1.1E-06   38.4   2.3   30    2-31    486-515 (941)
 61 PRK13104 secA preprotein trans  93.7   0.095 2.1E-06   37.2   3.4   27    2-28    445-471 (896)
 62 cd01529 4RHOD_Repeats Member o  93.4    0.26 5.7E-06   24.6   4.0   30    3-32     58-87  (96)
 63 COG4718 Phage-related protein   93.1    0.19 4.1E-06   28.3   3.4   30    4-33     47-76  (111)
 64 COG1204 Superfamily II helicas  93.1    0.11 2.5E-06   35.8   3.0   22    2-23    254-275 (766)
 65 cd01527 RHOD_YgaP Member of th  93.0    0.31 6.6E-06   24.3   3.9   31    2-32     55-85  (99)
 66 PRK11664 ATP-dependent RNA hel  92.9    0.13 2.8E-06   35.6   3.0   22    2-23    213-234 (812)
 67 PRK10689 transcription-repair   92.8    0.23 4.9E-06   35.7   4.2   23    2-24    810-832 (1147)
 68 COG1111 MPH1 ERCC4-like helica  92.7    0.17 3.6E-06   34.5   3.3   27    2-28    367-393 (542)
 69 KOG0354|consensus               92.7    0.14 2.9E-06   35.9   2.9   22    2-23    414-435 (746)
 70 cd01523 RHOD_Lact_B Member of   92.6    0.32   7E-06   24.4   3.6   30    2-32     62-91  (100)
 71 cd01447 Polysulfide_ST Polysul  92.5     0.2 4.4E-06   24.8   2.8   30    3-32     63-92  (103)
 72 cd01519 RHOD_HSP67B2 Member of  92.1     0.4 8.6E-06   24.0   3.6   29    3-31     68-96  (106)
 73 TIGR01970 DEAH_box_HrpB ATP-de  92.0    0.21 4.5E-06   34.7   3.2   22    2-23    210-231 (819)
 74 cd01526 RHOD_ThiF Member of th  92.0    0.34 7.4E-06   25.4   3.4   31    2-32     73-104 (122)
 75 cd01449 TST_Repeat_2 Thiosulfa  91.6    0.52 1.1E-05   24.1   3.8   31    2-32     79-109 (118)
 76 cd01528 RHOD_2 Member of the R  91.2    0.71 1.5E-05   23.2   4.0   30    3-32     60-89  (101)
 77 KOG0340|consensus               91.2    0.31 6.8E-06   32.5   3.2   27    2-28    255-281 (442)
 78 COG4096 HsdR Type I site-speci  91.2    0.26 5.7E-06   35.2   3.0   27    1-27    426-452 (875)
 79 PRK13107 preprotein translocas  91.1    0.41 8.9E-06   34.2   3.9   27    2-28    450-476 (908)
 80 PF10740 DUF2529:  Protein of u  91.1     0.4 8.7E-06   28.5   3.3   28    2-29     83-112 (172)
 81 cd01444 GlpE_ST GlpE sulfurtra  91.0    0.75 1.6E-05   22.5   3.9   30    3-32     58-87  (96)
 82 cd01532 4RHOD_Repeat_1 Member   90.8    0.86 1.9E-05   22.8   4.1   29    3-31     52-82  (92)
 83 cd01448 TST_Repeat_1 Thiosulfa  90.7    0.67 1.4E-05   23.9   3.6   30    3-32     81-111 (122)
 84 PRK11448 hsdR type I restricti  90.6    0.36 7.8E-06   34.6   3.3   23    2-24    699-721 (1123)
 85 cd01524 RHOD_Pyr_redox Member   90.5    0.83 1.8E-05   22.6   3.8   29    2-31     52-80  (90)
 86 cd01534 4RHOD_Repeat_3 Member   90.3    0.88 1.9E-05   22.7   3.8   29    3-32     58-86  (95)
 87 TIGR01967 DEAH_box_HrpA ATP-de  90.3    0.36 7.9E-06   35.3   3.2   25    2-26    280-304 (1283)
 88 PHA02558 uvsW UvsW helicase; P  90.1    0.63 1.4E-05   30.0   3.8   27    2-28    345-371 (501)
 89 PF02617 ClpS:  ATP-dependent C  90.0    0.38 8.3E-06   24.4   2.3   24    2-25     48-71  (82)
 90 cd01518 RHOD_YceA Member of th  90.0    0.94   2E-05   22.7   3.8   29    3-31     63-91  (101)
 91 cd01525 RHOD_Kc Member of the   89.5     1.1 2.5E-05   22.3   3.9   29    3-31     67-95  (105)
 92 PF00849 PseudoU_synth_2:  RNA   89.3     1.1 2.4E-05   24.0   4.0   29    3-31     53-81  (164)
 93 KOG0347|consensus               89.3     0.5 1.1E-05   33.2   3.1   26    1-26    463-488 (731)
 94 TIGR00580 mfd transcription-re  89.3    0.53 1.1E-05   33.2   3.2   23    2-24    661-683 (926)
 95 cd02557 PseudoU_synth_ScRIB2 P  88.9     1.1 2.4E-05   26.0   4.0   29    3-31     72-100 (213)
 96 TIGR01621 RluA-like pseudourid  88.1     1.1 2.3E-05   26.2   3.6   29    3-31     56-84  (217)
 97 cd01521 RHOD_PspE2 Member of t  87.9     1.8 3.8E-05   22.2   4.0   30    2-32     65-96  (110)
 98 PF08544 GHMP_kinases_C:  GHMP   87.7     1.5 3.2E-05   21.1   3.5   23    3-25     61-83  (85)
 99 cd02869 PseudoU_synth_RluCD_li  87.7     1.3 2.8E-05   24.2   3.5   30    2-31     51-80  (185)
100 PF02863 Arg_repressor_C:  Argi  87.5     1.2 2.7E-05   22.2   3.2   22    2-23     48-69  (70)
101 PRK10158 23S rRNA/tRNA pseudou  87.4     1.6 3.4E-05   25.5   4.0   29    3-31     69-97  (219)
102 PRK11112 tRNA pseudouridine sy  87.2     1.6 3.4E-05   26.1   4.0   29    3-31     59-87  (257)
103 COG0556 UvrB Helicase subunit   86.8     1.2 2.6E-05   31.1   3.7   30    2-31    447-476 (663)
104 cd01533 4RHOD_Repeat_2 Member   86.6     1.9 4.2E-05   21.9   3.7   29    3-31     68-97  (109)
105 KOG4284|consensus               86.3    0.18 3.8E-06   36.1  -0.4   27    2-28    273-299 (980)
106 PRK10287 thiosulfate:cyanide s  85.5     2.8   6E-05   22.2   4.0   28    3-30     62-89  (104)
107 cd01522 RHOD_1 Member of the R  85.2     2.1 4.6E-05   22.4   3.5   28    3-30     66-93  (117)
108 cd02563 PseudoU_synth_TruC tRN  85.1     1.7 3.7E-05   25.3   3.3   29    3-31     58-86  (223)
109 KOG0950|consensus               84.7    0.89 1.9E-05   33.0   2.4   21    3-23    462-482 (1008)
110 cd02558 PSRA_1 PSRA_1: Pseudou  83.9     2.8   6E-05   24.9   3.9   29    3-31     95-123 (246)
111 KOG0334|consensus               83.6     1.5 3.3E-05   31.8   3.1   25    2-26    614-638 (997)
112 KOG0353|consensus               83.0     1.2 2.7E-05   30.6   2.4   27    2-28    318-344 (695)
113 PRK05752 uroporphyrinogen-III   82.7     2.3   5E-05   24.9   3.2   27    3-29      4-30  (255)
114 PRK09271 flavodoxin; Provision  82.5     3.6 7.8E-05   22.7   3.8   27    2-28      2-32  (160)
115 PRK11025 23S rRNA pseudouridyl  82.4     3.4 7.3E-05   25.4   4.0   29    3-31    149-177 (317)
116 PRK11180 rluD 23S rRNA pseudou  82.3     3.4 7.3E-05   25.4   4.0   29    3-31    144-172 (325)
117 PRK08811 uroporphyrinogen-III   82.3     2.7 5.8E-05   25.3   3.5   27    3-29     19-45  (266)
118 KOG0338|consensus               82.3     1.7 3.7E-05   30.5   2.9   24    2-25    427-450 (691)
119 TIGR00005 rluA_subfam pseudour  82.1     3.6 7.9E-05   24.6   4.0   29    3-31    132-160 (299)
120 PLN02160 thiosulfate sulfurtra  81.8     3.9 8.4E-05   22.3   3.7   29    3-31     83-111 (136)
121 COG0564 RluA Pseudouridylate s  81.7     3.5 7.5E-05   25.4   3.9   30    2-31    135-164 (289)
122 TIGR01754 flav_RNR ribonucleot  81.2     2.7 5.9E-05   22.5   3.0   27    1-27      1-31  (140)
123 TIGR00603 rad25 DNA repair hel  80.1     2.1 4.5E-05   29.9   2.7   21    2-22    497-517 (732)
124 KOG0336|consensus               80.1     1.1 2.4E-05   30.9   1.4   25    2-26    466-490 (629)
125 PRK13617 psbV cytochrome c-550  79.7     2.1 4.6E-05   25.4   2.4   23    9-31    140-170 (170)
126 COG3865 Uncharacterized protei  79.7     3.3 7.2E-05   24.4   3.2   25    3-27     80-104 (151)
127 PF00581 Rhodanese:  Rhodanese-  79.6     5.7 0.00012   19.4   4.1   29    3-31     69-102 (113)
128 cd06578 HemD Uroporphyrinogen-  79.6     3.3 7.1E-05   22.8   3.0   26    5-30      1-26  (239)
129 KOG0341|consensus               79.3     2.1 4.6E-05   29.4   2.5   25    3-27    423-447 (610)
130 KOG0952|consensus               79.3     2.1 4.5E-05   31.8   2.6   24    2-25    350-373 (1230)
131 TIGR03865 PQQ_CXXCW PQQ-depend  78.5     6.4 0.00014   22.1   4.0   31    2-32    117-148 (162)
132 PF06983 3-dmu-9_3-mt:  3-demet  78.4     5.2 0.00011   21.4   3.5   27    3-29     74-100 (116)
133 PRK05928 hemD uroporphyrinogen  78.3     5.8 0.00012   22.2   3.8   27    4-30      3-29  (249)
134 COG1061 SSL2 DNA or RNA helica  78.0     2.9 6.3E-05   26.8   2.8   25    2-26    284-308 (442)
135 PRK09189 uroporphyrinogen-III   77.6     4.7  0.0001   23.2   3.4   27    4-30      2-28  (240)
136 TIGR02981 phageshock_pspE phag  77.2     8.3 0.00018   20.2   4.0   27    3-29     60-86  (101)
137 PRK05320 rhodanese superfamily  77.1     6.5 0.00014   23.8   4.0   29    3-31    177-205 (257)
138 PRK00162 glpE thiosulfate sulf  77.1     6.1 0.00013   20.0   3.4   30    3-32     60-89  (108)
139 PF13361 UvrD_C:  UvrD-like hel  77.0     6.9 0.00015   22.4   3.9   27    2-28     78-104 (351)
140 cd02550 PseudoU_synth_Rsu_Rlu_  76.7     5.5 0.00012   21.7   3.3   27    3-31     47-73  (154)
141 KOG0346|consensus               75.8     3.6 7.8E-05   28.4   2.9   26    2-27    269-294 (569)
142 COG1110 Reverse gyrase [DNA re  75.6     5.7 0.00012   29.6   3.9   27    3-29    337-366 (1187)
143 COG5566 Uncharacterized conser  75.4     3.5 7.6E-05   24.0   2.4   25    9-33     58-82  (137)
144 cd01535 4RHOD_Repeat_4 Member   75.0     9.4  0.0002   21.0   4.0   29    3-31     51-79  (145)
145 CHL00133 psbV photosystem II c  74.9     3.2   7E-05   24.3   2.2   22   10-31    134-163 (163)
146 PF13245 AAA_19:  Part of AAA d  74.2       6 0.00013   19.8   2.9   20    2-21     43-62  (76)
147 PF02006 DUF137:  Protein of un  74.2     3.5 7.6E-05   24.8   2.3   23    6-28     38-60  (178)
148 KOG1919|consensus               73.7     5.4 0.00012   25.9   3.2   28    3-30    162-189 (371)
149 PRK01415 hypothetical protein;  73.4     7.8 0.00017   23.7   3.7   30    2-31    172-201 (247)
150 TIGR00093 pseudouridine syntha  73.2     4.6  0.0001   21.7   2.4   27    3-31     10-36  (128)
151 PRK08762 molybdopterin biosynt  72.6     8.6 0.00019   24.0   3.8   30    3-32     59-88  (376)
152 PRK07168 bifunctional uroporph  72.4     6.2 0.00013   26.0   3.3   27    2-28    251-277 (474)
153 PRK05597 molybdopterin biosynt  71.4      11 0.00023   23.7   4.0   30    2-31    315-344 (355)
154 PF13307 Helicase_C_2:  Helicas  71.1     3.9 8.6E-05   22.7   1.9   25    1-25      9-33  (167)
155 PRK15394 4-deoxy-4-formamido-L  70.9     5.5 0.00012   24.8   2.7   27    7-33     13-39  (296)
156 COG1701 Uncharacterized protei  70.5     5.3 0.00011   25.2   2.5   21    5-25    102-122 (256)
157 PRK00441 argR arginine repress  70.0     9.7 0.00021   21.6   3.4   23    2-24    125-147 (149)
158 TIGR01529 argR_whole arginine   69.8     9.8 0.00021   21.4   3.4   22    2-23    123-144 (146)
159 PRK00142 putative rhodanese-re  69.1      12 0.00026   23.3   3.9   30    2-31    172-201 (314)
160 cd01421 IMPCH Inosine monophos  68.9      11 0.00023   22.6   3.5   27    2-28      1-27  (187)
161 PRK09492 treR trehalose repres  68.8      14 0.00029   21.3   3.9   27    6-32    155-181 (315)
162 smart00115 CASc Caspase, inter  68.5      15 0.00032   21.7   4.1   27    3-29     10-47  (241)
163 PF00610 DEP:  Domain found in   68.4       5 0.00011   19.3   1.8   20    7-26     34-53  (74)
164 cd01530 Cdc25 Cdc25 phosphatas  68.1      15 0.00032   19.4   3.7   22    3-24     70-92  (121)
165 PRK07878 molybdopterin biosynt  67.8      13 0.00029   23.5   3.9   30    3-32    345-374 (392)
166 TIGR00596 rad1 DNA repair prot  67.4     7.7 0.00017   27.4   3.0   22    2-23    296-317 (814)
167 cd02555 PSSA_1 PSSA_1: Pseudou  67.4     9.8 0.00021   21.8   3.1   28    3-32     59-86  (177)
168 KOG0951|consensus               66.7     6.6 0.00014   30.1   2.7   22    2-23    547-568 (1674)
169 PF04364 DNA_pol3_chi:  DNA pol  66.3     7.1 0.00015   21.5   2.3   21    2-22     30-50  (137)
170 KOG0947|consensus               66.2     5.9 0.00013   29.6   2.4   23    3-25    569-591 (1248)
171 PRK06724 hypothetical protein;  66.0      13 0.00028   19.7   3.2   24    5-28     67-91  (128)
172 cd01520 RHOD_YbbB Member of th  65.2      17 0.00037   19.1   3.6   28    2-30     87-115 (128)
173 PHA02591 hypothetical protein;  65.1     7.7 0.00017   20.9   2.2   25    3-27     37-61  (83)
174 PRK05728 DNA polymerase III su  64.9      11 0.00023   20.9   2.9   21    2-22     30-50  (142)
175 COG1647 Esterase/lipase [Gener  64.8     6.1 0.00013   24.8   2.0   21    7-27     24-44  (243)
176 PRK13019 clpS ATP-dependent Cl  64.6      14 0.00031   19.7   3.2   25    2-26     64-88  (94)
177 PRK13761 hypothetical protein;  64.4     7.7 0.00017   24.4   2.4   23    6-28    101-123 (248)
178 COG0607 PspE Rhodanese-related  64.4      14 0.00031   18.1   3.0   27    3-29     63-89  (110)
179 COG1203 CRISPR-associated heli  64.2      15 0.00033   25.1   3.9   25    2-26    441-465 (733)
180 COG0716 FldA Flavodoxins [Ener  63.7     5.2 0.00011   21.8   1.4   21    8-28     13-33  (151)
181 PRK04280 arginine repressor; P  63.7      15 0.00033   20.8   3.4   22    2-23    125-146 (148)
182 TIGR00348 hsdR type I site-spe  63.2      11 0.00025   25.5   3.1   24    2-25    515-538 (667)
183 TIGR00715 precor6x_red precorr  63.2      17 0.00037   22.1   3.7   27    3-30      2-28  (256)
184 cd01445 TST_Repeats Thiosulfat  62.3      24 0.00051   19.2   3.9   30    2-31     96-128 (138)
185 KOG0339|consensus               62.3     8.9 0.00019   27.2   2.6   28    2-29    469-496 (731)
186 PRK11493 sseA 3-mercaptopyruva  62.1      17 0.00037   21.7   3.5   28    3-30    233-260 (281)
187 TIGR00730 conserved hypothetic  62.0      22 0.00047   20.5   3.8   28    3-30      2-37  (178)
188 PF11823 DUF3343:  Protein of u  61.9      18 0.00039   17.7   3.6   27    1-27      1-27  (73)
189 cd00860 ThrRS_anticodon ThrRS   61.8      17 0.00037   17.3   4.3   31    1-31      1-34  (91)
190 cd02556 PseudoU_synth_RluB Pse  61.6      12 0.00026   20.9   2.7   27    3-31     48-74  (167)
191 cd00032 CASc Caspase, interleu  61.2      22 0.00049   20.8   3.9   27    3-29     11-49  (243)
192 TIGR00725 conserved hypothetic  61.1      27 0.00058   19.7   4.0   29    1-29      1-35  (159)
193 PF02423 OCD_Mu_crystall:  Orni  61.0      20 0.00044   22.0   3.8   26    1-26    153-178 (313)
194 PRK11776 ATP-dependent RNA hel  60.8      11 0.00024   23.7   2.7   23    3-25     74-96  (460)
195 cd02870 PseudoU_synth_RsuA_lik  60.8      13 0.00028   20.1   2.6   27    3-31     46-72  (146)
196 PF00258 Flavodoxin_1:  Flavodo  60.6     7.4 0.00016   20.4   1.6   19    9-27      9-27  (143)
197 KOG0948|consensus               60.5      11 0.00023   27.8   2.7   24    2-25    384-407 (1041)
198 PHA00527 hypothetical protein   60.2      13 0.00029   21.2   2.7   20    3-22     20-39  (129)
199 COG0513 SrmB Superfamily II DN  59.9     9.9 0.00021   24.9   2.4   24    4-27    102-125 (513)
200 cd01544 PBP1_GalR Ligand-bindi  59.9      22 0.00048   20.0   3.6   27    6-32     92-118 (270)
201 cd00046 DEXDc DEAD-like helica  59.5      18 0.00039   17.3   2.8   25    2-26     31-55  (144)
202 cd07266 HPCD_N_class_II N-term  59.4      20 0.00043   17.7   3.0   22    8-29     68-89  (121)
203 TIGR02405 trehalos_R_Ecol treh  59.1      23  0.0005   20.6   3.6   27    6-32    152-178 (311)
204 COG1587 HemD Uroporphyrinogen-  58.6      17 0.00037   21.3   3.1   26    4-29      3-28  (248)
205 cd01225 PH_Cool_Pix Cool (clon  58.5      23  0.0005   19.8   3.4   26    1-26     85-110 (111)
206 COG0169 AroE Shikimate 5-dehyd  58.1      20 0.00044   22.3   3.4   25    2-26    151-175 (283)
207 PRK11104 hemG protoporphyrinog  58.1      15 0.00032   20.8   2.6   26    1-27      1-30  (177)
208 TIGR02786 addB_alphas double-s  57.9      15 0.00033   26.1   3.1   23    2-24     39-61  (1021)
209 COG2519 GCD14 tRNA(1-methylade  57.7      19 0.00042   22.6   3.3   25    2-26    189-213 (256)
210 cd04883 ACT_AcuB C-terminal AC  57.0      20 0.00043   16.6   3.0   19   12-30     52-70  (72)
211 PRK08105 flavodoxin; Provision  56.9      18 0.00039   20.0   2.8   27    1-27      1-32  (149)
212 cd01132 F1_ATPase_alpha F1 ATP  56.8      28  0.0006   21.8   3.9   29    1-29    125-164 (274)
213 PF00270 DEAD:  DEAD/DEAH box h  56.7      27 0.00059   18.1   3.6   25    3-27     46-70  (169)
214 PF00532 Peripla_BP_1:  Peripla  56.6      16 0.00035   21.5   2.8   27    6-32     98-125 (279)
215 cd06280 PBP1_LacI_like_4 Ligan  56.6      30 0.00064   19.3   3.7   27    6-32     95-121 (263)
216 PRK06407 ornithine cyclodeamin  56.3      27 0.00058   21.5   3.8   24    1-24    142-165 (301)
217 cd07235 MRD Mitomycin C resist  56.1      21 0.00045   17.7   2.8   21    8-28     74-94  (122)
218 PF05853 DUF849:  Prokaryotic p  55.9      19 0.00042   21.9   3.1   26    5-30    119-144 (272)
219 PRK07478 short chain dehydroge  55.8      35 0.00076   19.1   4.1   27    3-29     32-58  (254)
220 cd06290 PBP1_LacI_like_9 Ligan  55.6      32 0.00069   19.0   3.7   27    6-32     95-121 (265)
221 PRK03341 arginine repressor; P  55.5      24 0.00053   20.5   3.3   23    2-24    142-164 (168)
222 PRK05066 arginine repressor; P  55.5      26 0.00056   20.1   3.4   23    2-24    129-151 (156)
223 cd09012 Glo_EDI_BRP_like_24 Th  55.4      21 0.00045   17.9   2.7   21    8-28     76-96  (124)
224 KOG0340|consensus               55.2      16 0.00036   24.7   2.8   25    4-28     78-102 (442)
225 PF12724 Flavodoxin_5:  Flavodo  54.3      10 0.00023   20.4   1.6   19    8-26      9-27  (143)
226 PRK00033 clpS ATP-dependent Cl  54.2      33 0.00071   18.5   3.5   26    2-27     69-94  (100)
227 cd06286 PBP1_CcpB_like Ligand-  54.1      36 0.00079   18.8   3.8   28    5-32     93-120 (260)
228 PRK06646 DNA polymerase III su  54.0      40 0.00087   19.2   4.2   30    2-31    110-142 (154)
229 smart00487 DEXDc DEAD-like hel  53.9      29 0.00063   17.7   3.2   25    2-26     55-79  (201)
230 KOG0350|consensus               53.8      20 0.00042   25.2   3.1   22    1-22    429-450 (620)
231 PF07775 PaRep2b:  PaRep2b prot  53.6      18 0.00038   24.9   2.8   23    5-27    110-132 (512)
232 cd03714 RT_DIRS1 RT_DIRS1: Rev  53.3      28 0.00061   17.9   3.1   21    2-22     68-88  (119)
233 COG4635 HemG Flavodoxin [Energ  53.1      12 0.00026   22.5   1.8   20    9-28     13-32  (175)
234 cd06292 PBP1_LacI_like_10 Liga  53.1      36 0.00079   18.9   3.7   28    5-32    101-128 (273)
235 PRK07308 flavodoxin; Validated  53.1      13 0.00028   19.9   1.8   20    9-28     14-33  (146)
236 TIGR00341 conserved hypothetic  53.0      25 0.00054   22.6   3.3   26    3-28     43-68  (325)
237 PRK10339 DNA-binding transcrip  53.0      33 0.00072   20.0   3.6   27    6-32    154-180 (327)
238 PF00542 Ribosomal_L12:  Riboso  52.8      14  0.0003   18.5   1.8   23    5-27     42-64  (68)
239 PF00903 Glyoxalase:  Glyoxalas  52.5      27 0.00058   16.8   3.7   25    4-28     77-101 (128)
240 PF01488 Shikimate_DH:  Shikima  52.4      33 0.00072   18.4   3.4   20    2-21     37-56  (135)
241 smart00049 DEP Domain found in  52.3      18  0.0004   17.4   2.2   20    7-26     35-54  (77)
242 PLN02723 3-mercaptopyruvate su  52.1      34 0.00073   21.0   3.7   28    2-29    270-297 (320)
243 cd08361 PpCmtC_N N-terminal do  52.1      24 0.00053   18.0   2.7   24    5-28     63-87  (124)
244 cd00268 DEADc DEAD-box helicas  52.0      27 0.00059   19.0   3.0   24    3-26     71-94  (203)
245 PRK01231 ppnK inorganic polyph  51.9      43 0.00093   20.7   4.2   29    1-29      4-37  (295)
246 PRK14615 4-diphosphocytidyl-2-  51.8      26 0.00057   21.3   3.2   25    3-27    266-290 (296)
247 PRK06975 bifunctional uroporph  51.7      29 0.00064   23.7   3.6   28    3-30      4-31  (656)
248 PF00580 UvrD-helicase:  UvrD/R  51.7      26 0.00057   19.9   3.0   24    1-24     45-68  (315)
249 PRK06756 flavodoxin; Provision  51.3      14  0.0003   19.8   1.8   20    9-28     14-33  (148)
250 PRK07589 ornithine cyclodeamin  51.3      36 0.00079   21.6   3.8   28    1-28    154-181 (346)
251 PRK01269 tRNA s(4)U8 sulfurtra  51.1      37 0.00081   22.1   3.9   30    2-31    450-479 (482)
252 PF14487 DUF4433:  Domain of un  51.0      26 0.00057   20.0   3.0   23    6-28    173-195 (205)
253 TIGR01753 flav_short flavodoxi  50.8      15 0.00032   18.9   1.8   20    8-27     10-29  (140)
254 PF02629 CoA_binding:  CoA bind  50.8      33 0.00072   17.3   3.9   31    2-33     64-94  (96)
255 COG0213 DeoA Thymidine phospho  50.8     9.2  0.0002   25.7   1.2   23    6-28    207-229 (435)
256 PRK10917 ATP-dependent DNA hel  50.7      37 0.00079   23.1   3.9   23    2-24    472-502 (681)
257 cd02553 PseudoU_synth_RsuA Pse  50.4      20 0.00044   20.0   2.4   27    3-31     48-74  (167)
258 PF02971 FTCD:  Formiminotransf  50.2      10 0.00022   22.1   1.2   18    8-25     10-27  (145)
259 PRK10423 transcriptional repre  50.2      44 0.00096   19.2   3.8   28    5-32    153-180 (327)
260 KOG2501|consensus               50.0      22 0.00047   20.8   2.5   23    4-26     70-92  (157)
261 cd03715 RT_ZFREV_like RT_ZFREV  49.7      36 0.00079   19.2   3.4   27    2-28    161-191 (210)
262 PF13616 Rotamase_3:  PPIC-type  49.6      24 0.00052   18.5   2.5   22    5-27     20-52  (117)
263 TIGR01220 Pmev_kin_Gr_pos phos  49.6      38 0.00083   21.2   3.7   26    3-28    324-349 (358)
264 TIGR01407 dinG_rel DnaQ family  49.5      27 0.00057   24.3   3.2   22    2-23    675-696 (850)
265 cd06271 PBP1_AglR_RafR_like Li  49.5      43 0.00093   18.4   3.6   27    6-32    100-126 (268)
266 PHA02558 uvsW UvsW helicase; P  49.2      29 0.00063   22.5   3.2   23    3-25    160-182 (501)
267 PRK05569 flavodoxin; Provision  49.2      16 0.00034   19.3   1.7   19    9-27     14-32  (141)
268 cd01575 PBP1_GntR Ligand-bindi  49.1      44 0.00096   18.3   3.6   27    6-32     96-122 (268)
269 PRK13909 putative recombinatio  48.9      29 0.00063   24.4   3.3   28    2-29    472-500 (910)
270 PRK10401 DNA-binding transcrip  48.8      45 0.00098   19.6   3.8   27    6-32    156-182 (346)
271 PF00034 Cytochrom_C:  Cytochro  48.6      24 0.00051   16.2   2.2   15   10-24     76-90  (91)
272 cd07255 Glo_EDI_BRP_like_12 Th  48.4      29 0.00062   17.1   2.6   21    8-28     72-92  (125)
273 cd04885 ACT_ThrD-I Tandem C-te  48.3      29 0.00064   16.4   2.5   21    8-28     46-66  (68)
274 PRK05298 excinuclease ABC subu  48.2      47   0.001   22.6   4.2   31    2-32     58-89  (652)
275 PRK09526 lacI lac repressor; R  48.2      46 0.00099   19.4   3.7   27    6-32    161-187 (342)
276 PF03091 CutA1:  CutA1 divalent  48.1      43 0.00093   17.9   3.4   23    4-26      4-26  (102)
277 PF04273 DUF442:  Putative phos  47.7      27 0.00059   18.8   2.5   19    2-20     87-105 (110)
278 cd01648 TERT TERT: Telomerase   47.6      41 0.00088   17.7   3.2   22    3-24     61-82  (119)
279 PF13439 Glyco_transf_4:  Glyco  47.6      28 0.00061   17.5   2.5   20   12-31     16-35  (177)
280 PRK06703 flavodoxin; Provision  47.6      18 0.00039   19.4   1.8   19    9-27     14-32  (151)
281 PRK09280 F0F1 ATP synthase sub  47.2      44 0.00095   22.4   3.9   30    1-30    201-242 (463)
282 cd04438 DEP_dishevelled DEP (D  47.2      23  0.0005   18.4   2.1   19    8-26     46-64  (84)
283 COG1609 PurR Transcriptional r  46.9      44 0.00096   20.4   3.6   27    6-32    155-181 (333)
284 TIGR00147 lipid kinase, YegS/R  46.8      60  0.0013   19.1   4.5   31    1-31      1-38  (293)
285 PF07015 VirC1:  VirC1 protein;  46.6      37  0.0008   20.8   3.3   26    3-28      2-33  (231)
286 PRK07411 hypothetical protein;  46.6      37 0.00081   21.6   3.4   26    3-28    344-369 (390)
287 cd00148 PROF Profilin binds ac  46.5      21 0.00045   19.3   2.0   15   11-25    112-126 (127)
288 cd02868 PseudoU_synth_hTruB2_l  46.4      38 0.00082   20.5   3.3   28    3-32     46-73  (226)
289 cd07241 Glo_EDI_BRP_like_3 Thi  46.2      34 0.00074   16.6   2.6   20   10-29     80-99  (125)
290 PF05036 SPOR:  Sporulation rel  46.2      24 0.00052   16.2   2.0   19    9-27     13-31  (76)
291 PF01565 FAD_binding_4:  FAD bi  45.9      44 0.00095   17.3   3.8   27    3-29      2-28  (139)
292 PRK05568 flavodoxin; Provision  45.8      30 0.00065   18.1   2.5   20    9-28     14-33  (142)
293 PRK07239 bifunctional uroporph  45.8      34 0.00074   21.1   3.1   24    4-28     13-36  (381)
294 cd07265 2_3_CTD_N N-terminal d  45.6      40 0.00086   16.7   3.9   24    5-28     65-89  (122)
295 TIGR00631 uvrb excinuclease AB  45.6      55  0.0012   22.5   4.2   30    3-32     56-86  (655)
296 cd06588 PhnB_like Escherichia   45.5      41 0.00088   17.3   3.0   22    4-25     78-99  (128)
297 COG4747 ACT domain-containing   45.2      43 0.00094   19.5   3.2   26    2-28    108-133 (142)
298 smart00392 PROF Profilin. Bind  45.1      23 0.00049   19.1   2.0   17    9-25    112-128 (129)
299 PRK09281 F0F1 ATP synthase sub  45.1      45 0.00099   22.4   3.7   28    1-28    218-256 (502)
300 PF04851 ResIII:  Type III rest  45.0      46 0.00099   17.3   4.1   24    3-26     52-75  (184)
301 PF15614 WHIM3:  WSTF, HB1, Itc  45.0      17 0.00036   17.5   1.3   21    7-27      3-24  (46)
302 PRK13695 putative NTPase; Prov  44.9      52  0.0011   17.9   3.8   31    3-33    127-157 (174)
303 COG4003 Uncharacterized protei  44.7      24 0.00052   19.4   2.0   19    8-26     44-62  (98)
304 PF09868 DUF2095:  Uncharacteri  44.6      23 0.00051   20.4   2.1   18    8-25     74-91  (128)
305 PRK13618 psbV cytochrome c-550  44.6      27 0.00059   20.4   2.4   22   10-31    134-163 (163)
306 PRK02649 ppnK inorganic polyph  44.5      61  0.0013   20.3   4.0   28    1-28      1-33  (305)
307 TIGR00609 recB exodeoxyribonuc  44.5      44 0.00095   24.1   3.7   28    3-30    471-498 (1087)
308 PF09286 Pro-kuma_activ:  Pro-k  44.5      21 0.00047   19.2   1.8   23    7-29     57-79  (143)
309 PF02158 Neuregulin:  Neureguli  44.4     7.4 0.00016   26.0   0.0   25    6-30     30-54  (404)
310 TIGR02417 fruct_sucro_rep D-fr  44.3      56  0.0012   18.9   3.6   27    6-32    158-184 (327)
311 PRK04537 ATP-dependent RNA hel  44.1      35 0.00075   22.7   3.0   25    3-27     86-110 (572)
312 PRK03378 ppnK inorganic polyph  44.1      60  0.0013   20.1   3.9   28    1-28      5-37  (292)
313 KOG0235|consensus               43.8      30 0.00064   21.0   2.5   23   11-33     37-59  (214)
314 PRK04539 ppnK inorganic polyph  43.8      62  0.0013   20.1   4.0   28    1-28      5-37  (296)
315 cd04449 DEP_DEPDC5-like DEP (D  43.6      28 0.00061   17.6   2.1   19    8-26     46-64  (83)
316 KOG1715|consensus               43.5      25 0.00055   21.3   2.2   19   10-28    166-184 (187)
317 COG2344 AT-rich DNA-binding pr  43.4      53  0.0012   20.3   3.6   29    5-33    150-178 (211)
318 PRK06936 type III secretion sy  43.4      53  0.0011   21.8   3.8   29    1-29    216-255 (439)
319 PF13086 AAA_11:  AAA domain; P  43.4      47   0.001   17.8   3.1   22    2-23     54-75  (236)
320 cd06287 PBP1_LacI_like_8 Ligan  43.1      56  0.0012   18.7   3.5   27    6-32     98-124 (269)
321 PRK14987 gluconate operon tran  43.0      64  0.0014   18.8   3.8   27    6-32    160-186 (331)
322 PRK06141 ornithine cyclodeamin  43.0      48   0.001   20.3   3.4   24    2-25    151-174 (314)
323 cd00738 HGTP_anticodon HGTP an  42.8      40 0.00087   16.0   3.5   27    2-28      2-34  (94)
324 PTZ00110 helicase; Provisional  42.8      35 0.00076   22.5   2.9   24    3-26    205-228 (545)
325 PF08704 GCD14:  tRNA methyltra  42.6      52  0.0011   20.0   3.5   24    3-26    141-164 (247)
326 cd06293 PBP1_LacI_like_11 Liga  42.6      61  0.0013   18.0   3.7   27    6-32     96-122 (269)
327 cd01458 vWA_ku Ku70/Ku80 N-ter  42.4      63  0.0014   18.3   3.6   30    2-31    129-168 (218)
328 PF13377 Peripla_BP_3:  Peripla  42.0      51  0.0011   16.9   3.1   23    5-27     71-93  (160)
329 cd04441 DEP_2_DEP6 DEP (Dishev  41.7      31 0.00068   18.1   2.2   19    8-26     48-66  (85)
330 cd04443 DEP_GPR155 DEP (Dishev  41.7      32 0.00068   17.8   2.1   19    8-26     46-64  (83)
331 PLN03142 Probable chromatin-re  41.6      45 0.00098   24.4   3.5   27    2-28    488-514 (1033)
332 PRK07340 ornithine cyclodeamin  41.5      66  0.0014   19.7   3.8   26    2-27    151-176 (304)
333 PRK06823 ornithine cyclodeamin  41.5      65  0.0014   20.0   3.8   27    1-27    153-179 (315)
334 COG4581 Superfamily II RNA hel  41.5      27 0.00058   25.8   2.4   21    3-23    381-401 (1041)
335 COG0520 csdA Selenocysteine ly  41.4      36 0.00079   21.8   2.8   22    4-25    382-403 (405)
336 PF06897 DUF1269:  Protein of u  41.4      56  0.0012   17.5   3.2   26    3-28     56-82  (102)
337 cd04371 DEP DEP domain, named   41.3      34 0.00073   16.4   2.1   18    9-26     45-62  (81)
338 cd00861 ProRS_anticodon_short   41.1      45 0.00097   16.1   4.4   31    1-31      1-37  (94)
339 PF09428 DUF2011:  Fungal prote  41.0      13 0.00029   20.9   0.7   11   23-33     14-24  (131)
340 cd06275 PBP1_PurR Ligand-bindi  40.7      65  0.0014   17.8   3.6   27    6-32     97-123 (269)
341 cd06285 PBP1_LacI_like_7 Ligan  40.7      65  0.0014   17.8   3.5   25    8-32     96-120 (265)
342 cd06269 PBP1_glutamate_recepto  40.6      63  0.0014   17.6   3.9   24    3-26    197-220 (298)
343 KOG0832|consensus               40.2      36 0.00077   21.6   2.5   28    3-30    109-136 (251)
344 PRK10727 DNA-binding transcrip  40.2      65  0.0014   18.9   3.5   27    6-32    156-182 (343)
345 PRK03188 4-diphosphocytidyl-2-  39.9      79  0.0017   18.9   3.9   25    3-27    255-279 (300)
346 PF14417 MEDS:  MEDS: MEthanoge  39.9      49  0.0011   18.6   2.9   26    2-27     48-73  (191)
347 cd08362 BphC5-RrK37_N_like N-t  39.9      49  0.0011   16.1   2.8   21    8-28     66-86  (120)
348 PRK10839 16S rRNA pseudouridyl  39.8      37  0.0008   19.7   2.4   27    3-31    107-133 (232)
349 COG2423 Predicted ornithine cy  39.8      52  0.0011   21.0   3.3   26    2-27    156-181 (330)
350 cd02566 PseudoU_synth_RluE Pse  39.8      40 0.00087   18.8   2.5   27    3-31     45-71  (168)
351 cd07258 PpCmtC_C C-terminal do  39.5      63  0.0014   17.3   3.4   24    5-28     60-84  (141)
352 PRK14105 selenophosphate synth  39.3      60  0.0013   20.0   3.4   24    4-27    296-319 (345)
353 KOG0347|consensus               39.2      38 0.00082   24.3   2.7   21    4-24    266-286 (731)
354 PRK08057 cobalt-precorrin-6x r  39.1      84  0.0018   19.1   4.0   29    1-30      2-30  (248)
355 PF11262 Tho2:  Transcription f  39.0      16 0.00034   22.6   0.9   21    3-23    155-175 (298)
356 TIGR00580 mfd transcription-re  38.9      52  0.0011   23.7   3.4   24    3-26    238-261 (926)
357 PRK05600 thiamine biosynthesis  38.9      57  0.0012   20.7   3.3   26    3-28    334-359 (370)
358 PF07652 Flavi_DEAD:  Flaviviru  38.4      37  0.0008   19.7   2.3   23    3-25     35-57  (148)
359 TIGR01481 ccpA catabolite cont  38.2      81  0.0017   18.2   3.7   27    6-32    156-182 (329)
360 PF09413 DUF2007:  Domain of un  38.2      48   0.001   15.5   3.0   24    4-27      2-25  (67)
361 PRK02155 ppnK NAD(+)/NADH kina  38.2      87  0.0019   19.3   4.0   27    2-28      6-37  (291)
362 PF14527 LAGLIDADG_WhiA:  WhiA   38.2      48   0.001   17.3   2.5   24    5-28     25-48  (93)
363 cd06273 PBP1_GntR_like_1 This   38.2      72  0.0016   17.6   3.6   26    7-32     97-122 (268)
364 PRK11634 ATP-dependent RNA hel  38.2      52  0.0011   22.3   3.2   23    3-25     76-98  (629)
365 cd03030 GRX_SH3BGR Glutaredoxi  38.1      37 0.00081   17.7   2.1   21    8-28     13-33  (92)
366 TIGR02024 FtcD glutamate formi  38.1      44 0.00096   21.4   2.7   26    5-30    188-213 (298)
367 PRK04164 hypothetical protein;  38.1      58  0.0012   19.0   3.1   27    5-31     94-120 (181)
368 cd03028 GRX_PICOT_like Glutare  38.0      56  0.0012   16.3   4.0   28    3-30      9-42  (90)
369 PF00006 ATP-synt_ab:  ATP synt  37.9      47   0.001   19.7   2.7   27    2-28     70-107 (215)
370 PRK11303 DNA-binding transcrip  37.8      83  0.0018   18.2   3.7   25    8-32    161-185 (328)
371 cd04448 DEP_PIKfyve DEP (Dishe  37.7      40 0.00087   17.2   2.1   19    8-26     44-62  (81)
372 PF12579 DUF3755:  Protein of u  37.6      14  0.0003   16.7   0.4   21    6-26     11-31  (35)
373 PF13117 Cag12:  Cag pathogenic  37.4      69  0.0015   17.7   3.2   26    2-27     81-106 (113)
374 PF13344 Hydrolase_6:  Haloacid  37.1      63  0.0014   16.6   3.0   25    3-27     32-57  (101)
375 PF03033 Glyco_transf_28:  Glyc  36.8      34 0.00074   17.4   1.8   16   15-30     16-31  (139)
376 PF07090 DUF1355:  Protein of u  36.8      79  0.0017   18.4   3.5   26    3-29     69-105 (177)
377 cd07252 BphC1-RGP6_N_like N-te  36.8      59  0.0013   16.3   2.7   21    8-28     65-85  (120)
378 PRK10876 recB exonuclease V su  36.7      67  0.0014   23.6   3.7   28    3-30    553-580 (1181)
379 cd04442 DEP_1_DEP6 DEP (Dishev  36.7      43 0.00092   17.4   2.2   19    8-26     44-62  (82)
380 cd04909 ACT_PDH-BS C-terminal   36.7      49  0.0011   15.2   3.5   22    6-27     47-68  (69)
381 TIGR02643 T_phosphoryl thymidi  36.5      18 0.00039   24.1   0.9   22    6-27    208-229 (437)
382 cd01646 RT_Bac_retron_I RT_Bac  36.5      70  0.0015   17.3   3.1   20    2-21     90-109 (158)
383 cd00472 Ribosomal_L24e_L24 Rib  36.5      24 0.00051   17.3   1.1   13    2-14     26-38  (54)
384 cd06283 PBP1_RegR_EndR_KdgR_li  36.5      76  0.0016   17.4   3.5   26    6-31     96-121 (267)
385 TIGR02371 ala_DH_arch alanine   36.3      68  0.0015   19.8   3.3   26    2-27    154-179 (325)
386 CHL00067 rps2 ribosomal protei  36.3      50  0.0011   19.8   2.7   25    3-27     69-93  (230)
387 cd04450 DEP_RGS7-like DEP (Dis  36.3      44 0.00095   17.0   2.2   18    9-26     45-62  (88)
388 PF02829 3H:  3H domain;  Inter  36.3      67  0.0015   17.2   3.0   21    6-26     76-96  (98)
389 PF07545 Vg_Tdu:  Vestigial/Ton  36.2      49  0.0011   15.1   2.2   19    2-20      5-23  (33)
390 COG4004 Uncharacterized protei  36.1      33 0.00072   18.9   1.8   19   11-29     11-29  (96)
391 TIGR01955 RfaH transcriptional  36.0      60  0.0013   17.5   2.8   21    5-26      3-23  (159)
392 TIGR01809 Shik-DH-AROM shikima  35.8      78  0.0017   19.1   3.5   23    2-24    150-172 (282)
393 COG2222 AgaS Predicted phospho  35.8      75  0.0016   20.3   3.5   25    4-28    253-280 (340)
394 TIGR02621 cas3_GSU0051 CRISPR-  35.6      31 0.00067   24.8   1.9   25    3-27     63-88  (844)
395 PF06877 RraB:  Regulator of ri  35.2      64  0.0014   16.4   2.7   23    7-29     31-53  (104)
396 TIGR01364 serC_1 phosphoserine  35.2      32 0.00069   21.3   1.7   20    4-23    325-344 (349)
397 PTZ00298 mevalonate kinase; Pr  35.1      63  0.0014   19.8   3.0   22    3-24    288-309 (328)
398 cd08357 Glo_EDI_BRP_like_18 Th  35.0      60  0.0013   15.8   3.3   19   10-28     74-92  (125)
399 PRK10672 rare lipoprotein A; P  35.0      51  0.0011   21.7   2.7   23    9-31    335-357 (361)
400 PRK09004 FMN-binding protein M  35.0      36 0.00079   18.7   1.8   19    9-27     14-32  (146)
401 cd00611 PSAT_like Phosphoserin  34.7      34 0.00074   20.8   1.8   20    4-23    333-352 (355)
402 TIGR03167 tRNA_sel_U_synt tRNA  34.6      80  0.0017   19.8   3.5   25    3-27     76-101 (311)
403 PF02437 Ski_Sno:  SKI/SNO/DAC   34.5      32 0.00069   19.2   1.6   14   10-23    100-113 (114)
404 cd07242 Glo_EDI_BRP_like_6 Thi  34.5      64  0.0014   15.9   3.6   24    5-28     72-96  (128)
405 PF09419 PGP_phosphatase:  Mito  34.5      64  0.0014   18.7   2.9   21    2-22     78-106 (168)
406 PHA03169 hypothetical protein;  34.4      25 0.00055   23.6   1.3   16    4-19    369-384 (413)
407 cd08346 PcpA_N_like N-terminal  34.3      61  0.0013   15.6   2.8   21    8-28     81-101 (126)
408 cd07261 Glo_EDI_BRP_like_11 Th  34.3      62  0.0013   15.7   2.6   21    8-28     67-87  (114)
409 PRK08862 short chain dehydroge  34.3      92   0.002   17.7   4.0   27    3-29     31-57  (227)
410 PRK11784 tRNA 2-selenouridine   34.3      84  0.0018   20.0   3.5   26    2-27     89-115 (345)
411 PRK11914 diacylglycerol kinase  34.2 1.1E+02  0.0023   18.3   4.3   32    1-32      8-46  (306)
412 TIGR02467 CbiE precorrin-6y C5  34.2      67  0.0014   18.1   2.9   24    3-26    141-164 (204)
413 PRK10919 ATP-dependent DNA hel  34.2      96  0.0021   21.1   4.0   27    3-29    344-370 (672)
414 PRK02645 ppnK inorganic polyph  34.2 1.2E+02  0.0025   18.8   4.4   29    1-29      3-36  (305)
415 TIGR02519 pilus_MshL pilus (MS  33.9      70  0.0015   19.2   3.0   24    3-26      8-31  (290)
416 PF00466 Ribosomal_L10:  Riboso  33.9      68  0.0015   16.1   2.8   20    3-24     79-98  (100)
417 PF04255 DUF433:  Protein of un  33.9      45 0.00097   15.7   1.8   21    5-26     12-32  (56)
418 PRK07677 short chain dehydroge  33.8      90   0.002   17.4   4.1   25    3-27     27-51  (252)
419 PRK12436 UDP-N-acetylenolpyruv  33.6      89  0.0019   19.3   3.5   27    2-28     37-63  (305)
420 PF14719 PID_2:  Phosphotyrosin  33.4      56  0.0012   19.4   2.5   18    6-23    100-117 (182)
421 PRK12903 secA preprotein trans  33.4      71  0.0015   23.6   3.4   26    3-28    428-453 (925)
422 PRK05723 flavodoxin; Provision  33.2      40 0.00086   18.8   1.8   19    9-27     13-31  (151)
423 cd00859 HisRS_anticodon HisRS   33.1      57  0.0012   15.0   3.3   26    3-28      3-31  (91)
424 PRK14608 4-diphosphocytidyl-2-  33.0      78  0.0017   19.2   3.2   25    3-27    257-281 (290)
425 cd03031 GRX_GRX_like Glutaredo  33.0      96  0.0021   17.5   3.9   20   10-29     15-34  (147)
426 PRK07594 type III secretion sy  33.0   1E+02  0.0022   20.5   3.9   28    2-29    210-248 (433)
427 PRK07666 fabG 3-ketoacyl-(acyl  33.0      90   0.002   17.2   4.2   27    3-29     33-59  (239)
428 cd05796 Ribosomal_P0_like Ribo  32.9      70  0.0015   18.0   2.8   21    3-25     80-100 (163)
429 PRK00881 purH bifunctional pho  32.8      85  0.0018   21.5   3.6   29    1-29      4-32  (513)
430 cd07240 ED_TypeI_classII_N N-t  32.8      65  0.0014   15.5   2.7   21    8-28     65-85  (117)
431 PRK14891 50S ribosomal protein  32.8      25 0.00055   20.3   1.0   11    2-12     27-37  (131)
432 PF13579 Glyco_trans_4_4:  Glyc  32.7      68  0.0015   15.8   2.5   17   13-29      6-22  (160)
433 PRK05355 3-phosphoserine/phosp  32.7      35 0.00076   21.1   1.7   20    4-23    335-354 (360)
434 PRK12597 F0F1 ATP synthase sub  32.7      98  0.0021   20.7   3.8   29    1-29    200-240 (461)
435 COG1205 Distinct helicase fami  32.5      34 0.00074   24.3   1.7   24    2-25    307-334 (851)
436 PF00210 Ferritin:  Ferritin-li  32.5      55  0.0012   16.5   2.2   16   11-26     45-60  (142)
437 cd06298 PBP1_CcpA_like Ligand-  32.4      92   0.002   17.1   3.7   27    6-32     96-122 (268)
438 TIGR01073 pcrA ATP-dependent D  32.4      92   0.002   21.1   3.7   27    2-28    345-371 (726)
439 TIGR02645 ARCH_P_rylase putati  32.4      23 0.00051   24.0   0.9   23    6-28    286-308 (493)
440 TIGR01011 rpsB_bact ribosomal   32.3      75  0.0016   19.0   3.0   22    3-24     63-84  (225)
441 cd05795 Ribosomal_P0_L10e Ribo  32.0      73  0.0016   18.1   2.8   21    3-25     79-99  (175)
442 COG1597 LCB5 Sphingosine kinas  31.9 1.3E+02  0.0027   18.5   4.0   31    2-32      3-40  (301)
443 TIGR02992 ectoine_eutC ectoine  31.9      79  0.0017   19.4   3.1   23    2-24    155-177 (326)
444 TIGR00643 recG ATP-dependent D  31.9      71  0.0015   21.4   3.1   23    2-24    449-479 (630)
445 PRK05599 hypothetical protein;  31.8   1E+02  0.0022   17.4   4.1   25    3-27     25-49  (246)
446 cd04439 DEP_1_P-Rex DEP (Dishe  31.7      57  0.0012   16.7   2.2   20    7-26     43-62  (81)
447 PRK05867 short chain dehydroge  31.7   1E+02  0.0022   17.3   4.0   26    3-28     35-60  (253)
448 PF13104 DUF3956:  Protein of u  31.5      40 0.00086   16.2   1.4   11    1-11      1-11  (45)
449 PRK04020 rps2P 30S ribosomal p  31.5      64  0.0014   19.4   2.6   22    3-24     68-89  (204)
450 PRK06172 short chain dehydroge  31.5      99  0.0021   17.2   4.2   26    3-28     33-58  (253)
451 PRK06136 uroporphyrin-III C-me  31.5      96  0.0021   17.9   3.3   24    3-26    166-189 (249)
452 cd06291 PBP1_Qymf_like Ligand   31.4      97  0.0021   17.1   3.7   27    6-32     92-118 (265)
453 cd03411 Ferrochelatase_N Ferro  31.4      61  0.0013   17.9   2.4   19    9-27     69-87  (159)
454 PF13676 TIR_2:  TIR domain; PD  31.3      47   0.001   16.3   1.7   17   11-27     10-26  (102)
455 cd01133 F1-ATPase_beta F1 ATP   31.3 1.1E+02  0.0024   19.0   3.7   29    1-29    126-166 (274)
456 PRK08972 fliI flagellum-specif  31.2 1.1E+02  0.0024   20.5   3.8   29    1-29    216-255 (444)
457 PF00325 Crp:  Bacterial regula  31.2      57  0.0012   14.3   2.1   17   10-26     15-31  (32)
458 cd09013 BphC-JF8_N_like N-term  31.2      75  0.0016   15.7   3.1   23    5-27     66-89  (121)
459 PRK10689 transcription-repair   31.1      76  0.0016   23.4   3.3   24    3-26    384-407 (1147)
460 cd03784 GT1_Gtf_like This fami  31.1      53  0.0012   19.7   2.2   18   14-31     17-34  (401)
461 PF13734 Inhibitor_I69:  Spi pr  31.1      51  0.0011   17.6   2.0   18    7-24      5-22  (96)
462 cd01644 RT_pepA17 RT_pepA17: R  31.1      57  0.0012   19.1   2.3   21    1-21    141-161 (213)
463 PRK14612 4-diphosphocytidyl-2-  31.0 1.1E+02  0.0023   18.3   3.5   25    3-27    243-267 (276)
464 TIGR03590 PseG pseudaminic aci  30.9      70  0.0015   19.0   2.7   19   13-31     19-37  (279)
465 PRK10645 divalent-cation toler  30.8      95  0.0021   16.9   3.0   22    4-25     12-35  (112)
466 PF06470 SMC_hinge:  SMC protei  30.7      80  0.0017   15.9   3.5   24    6-29     33-56  (120)
467 PRK10014 DNA-binding transcrip  30.7 1.2E+02  0.0025   17.7   3.8   25    8-32    164-188 (342)
468 PRK14027 quinate/shikimate deh  30.7      94   0.002   19.0   3.3   22    2-23    152-173 (283)
469 PF08495 FIST:  FIST N domain;   30.5      83  0.0018   17.0   2.8   23    2-24      3-26  (198)
470 cd01545 PBP1_SalR Ligand-bindi  30.4   1E+02  0.0022   17.0   3.6   27    6-32     98-124 (270)
471 PRK06124 gluconate 5-dehydroge  30.4   1E+02  0.0023   17.1   4.2   26    3-28     37-62  (256)
472 TIGR03498 FliI_clade3 flagella  30.3 1.2E+02  0.0025   20.0   3.8   29    1-29    194-233 (418)
473 PF14698 ASL_C2:  Argininosucci  30.3      47   0.001   16.5   1.6   15   14-28      4-18  (70)
474 PRK11773 uvrD DNA-dependent he  30.1 1.2E+02  0.0026   20.7   3.9   27    2-28    348-374 (721)
475 cd06310 PBP1_ABC_sugar_binding  30.1      96  0.0021   17.2   3.0   24    4-27    185-208 (273)
476 PRK05787 cobalt-precorrin-6Y C  30.0      87  0.0019   17.5   2.9   23    3-25    144-166 (210)
477 PRK04101 fosfomycin resistance  30.0      89  0.0019   16.2   3.5   25    4-28     66-90  (139)
478 cd01227 PH_Dbs Dbs (DBL's big   29.9      26 0.00056   19.8   0.7   11    2-12     38-48  (133)
479 cd06278 PBP1_LacI_like_2 Ligan  29.9   1E+02  0.0022   16.8   3.8   26    7-32     96-121 (266)
480 cd00387 Ribosomal_L7_L12 Ribos  29.9      58  0.0013   18.3   2.1   19   10-28    107-125 (127)
481 cd00821 PH Pleckstrin homology  29.9      62  0.0013   14.4   2.9   21    3-23     74-95  (96)
482 cd06299 PBP1_LacI_like_13 Liga  29.9   1E+02  0.0022   16.9   3.6   25    7-31     97-121 (265)
483 PRK08277 D-mannonate oxidoredu  29.9 1.1E+02  0.0024   17.3   4.1   27    3-29     36-62  (278)
484 PF00318 Ribosomal_S2:  Ribosom  29.8      67  0.0015   18.8   2.5   24    3-26     57-80  (211)
485 cd01543 PBP1_XylR Ligand-bindi  29.7 1.1E+02  0.0023   17.1   3.5   27    6-32     89-115 (265)
486 PRK05820 deoA thymidine phosph  29.7      26 0.00057   23.3   0.8   21    7-27    210-230 (440)
487 PRK07454 short chain dehydroge  29.7 1.1E+02  0.0023   16.9   4.2   25    3-27     32-56  (241)
488 TIGR03327 AMP_phos AMP phospho  29.6      28 0.00061   23.7   0.9   23    6-28    287-309 (500)
489 TIGR01426 MGT glycosyltransfer  29.5      65  0.0014   19.5   2.4   18   15-32     13-30  (392)
490 cd07239 BphC5-RK37_C_like C-te  29.4      97  0.0021   16.4   3.4   25    5-29     63-88  (144)
491 cd06281 PBP1_LacI_like_5 Ligan  29.4 1.1E+02  0.0024   17.0   3.8   26    7-32     97-122 (269)
492 PRK12311 rpsB 30S ribosomal pr  29.4      68  0.0015   20.6   2.6   24    3-26     60-83  (326)
493 TIGR03211 catechol_2_3 catecho  29.4 1.2E+02  0.0026   17.8   3.5   21    8-28     68-88  (303)
494 PF07864 DUF1651:  Protein of u  29.3      59  0.0013   16.1   1.9   19   10-28     51-69  (75)
495 cd06276 PBP1_FucR_like Ligand-  29.3 1.1E+02  0.0025   17.2   3.7   27    6-32     95-123 (247)
496 TIGR01012 Sa_S2_E_A ribosomal   29.1      84  0.0018   18.8   2.8   22    3-24     62-83  (196)
497 PF10678 DUF2492:  Protein of u  29.0      53  0.0011   17.3   1.8   15   12-26     47-61  (78)
498 TIGR01319 glmL_fam conserved h  29.0 1.1E+02  0.0024   20.7   3.6   29    2-32    151-179 (463)
499 PF11829 DUF3349:  Protein of u  28.9      62  0.0013   17.5   2.1   20    9-28     73-92  (96)
500 PRK07116 flavodoxin; Provision  28.9      64  0.0014   17.6   2.2   20    4-23      6-29  (160)

No 1  
>KOG0349|consensus
Probab=98.11  E-value=2e-06  Score=58.20  Aligned_cols=26  Identities=65%  Similarity=1.137  Sum_probs=24.6

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      |++|||||+||.+||+|.++++++|+
T Consensus       505 mdkaiifcrtk~dcDnLer~~~qkgg  530 (725)
T KOG0349|consen  505 MDKAIIFCRTKQDCDNLERMMNQKGG  530 (725)
T ss_pred             cCceEEEEeccccchHHHHHHHHcCC
Confidence            68999999999999999999999887


No 2  
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=97.76  E-value=3.4e-05  Score=49.72  Aligned_cols=26  Identities=27%  Similarity=0.382  Sum_probs=23.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++|||||||+.|++|+..|++.|..
T Consensus       274 ~~~IVF~~tk~~~~~l~~~l~~~g~~  299 (513)
T COG0513         274 GRVIVFVRTKRLVEELAESLRKRGFK  299 (513)
T ss_pred             CeEEEEeCcHHHHHHHHHHHHHCCCe
Confidence            47999999999999999999999954


No 3  
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=97.74  E-value=6.6e-05  Score=46.35  Aligned_cols=30  Identities=33%  Similarity=0.490  Sum_probs=26.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||+|++.|+.|++.|.+.|....++
T Consensus       256 ~~~lVF~~t~~~~~~l~~~L~~~g~~v~~l  285 (423)
T PRK04837        256 DRAIIFANTKHRCEEIWGHLAADGHRVGLL  285 (423)
T ss_pred             CeEEEEECCHHHHHHHHHHHHhCCCcEEEe
Confidence            589999999999999999999998876554


No 4  
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=97.71  E-value=8e-05  Score=46.40  Aligned_cols=30  Identities=23%  Similarity=0.542  Sum_probs=26.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||||+.+|+.|++.|.+.|.....+
T Consensus       243 ~~~lVF~~t~~~~~~l~~~L~~~~~~v~~~  272 (460)
T PRK11776        243 ESCVVFCNTKKECQEVADALNAQGFSALAL  272 (460)
T ss_pred             CceEEEECCHHHHHHHHHHHHhCCCcEEEE
Confidence            579999999999999999999999776554


No 5  
>KOG0331|consensus
Probab=97.57  E-value=7.2e-05  Score=49.74  Aligned_cols=24  Identities=42%  Similarity=0.814  Sum_probs=22.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++||||+||..|++|+..|++.|
T Consensus       342 ~KvIIFc~tkr~~~~l~~~l~~~~  365 (519)
T KOG0331|consen  342 GKVIIFCETKRTCDELARNLRRKG  365 (519)
T ss_pred             CcEEEEecchhhHHHHHHHHHhcC
Confidence            479999999999999999999976


No 6  
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=97.55  E-value=0.00018  Score=44.43  Aligned_cols=30  Identities=23%  Similarity=0.453  Sum_probs=26.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||||++.|+.|++.|++.|....++
T Consensus       246 ~~~lVF~~s~~~~~~l~~~L~~~~~~~~~l  275 (434)
T PRK11192        246 TRSIVFVRTRERVHELAGWLRKAGINCCYL  275 (434)
T ss_pred             CeEEEEeCChHHHHHHHHHHHhCCCCEEEe
Confidence            579999999999999999999988765543


No 7  
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=97.55  E-value=0.00014  Score=45.59  Aligned_cols=29  Identities=31%  Similarity=0.377  Sum_probs=25.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .++||||||+++|+.|++.|.+.|.....
T Consensus       246 ~~~lVF~~t~~~~~~l~~~L~~~g~~~~~  274 (456)
T PRK10590        246 QQVLVFTRTKHGANHLAEQLNKDGIRSAA  274 (456)
T ss_pred             CcEEEEcCcHHHHHHHHHHHHHCCCCEEE
Confidence            57999999999999999999998876544


No 8  
>KOG0332|consensus
Probab=97.52  E-value=9.9e-05  Score=48.89  Aligned_cols=29  Identities=21%  Similarity=0.371  Sum_probs=26.9

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      +.|+||||.||..|..|+..|.+.||+.+
T Consensus       330 igqsiIFc~tk~ta~~l~~~m~~~Gh~V~  358 (477)
T KOG0332|consen  330 IGQSIIFCHTKATAMWLYEEMRAEGHQVS  358 (477)
T ss_pred             hhheEEEEeehhhHHHHHHHHHhcCceeE
Confidence            36899999999999999999999999875


No 9  
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=97.46  E-value=0.00022  Score=45.03  Aligned_cols=29  Identities=14%  Similarity=0.386  Sum_probs=25.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      ++||||+|+++|+.|++.|++.|.....|
T Consensus       228 ~~IIF~~s~~~~e~la~~L~~~g~~~~~~  256 (470)
T TIGR00614       228 SGIIYCPSRKKSEQVTASLQNLGIAAGAY  256 (470)
T ss_pred             ceEEEECcHHHHHHHHHHHHhcCCCeeEe
Confidence            56999999999999999999999876655


No 10 
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=97.44  E-value=0.00024  Score=46.43  Aligned_cols=30  Identities=23%  Similarity=0.307  Sum_probs=26.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||||++.|+.|++.|.+.|.....+
T Consensus       258 ~k~LVF~nt~~~ae~l~~~L~~~g~~v~~l  287 (572)
T PRK04537        258 ARTMVFVNTKAFVERVARTLERHGYRVGVL  287 (572)
T ss_pred             CcEEEEeCCHHHHHHHHHHHHHcCCCEEEE
Confidence            479999999999999999999998766554


No 11 
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=97.43  E-value=0.00025  Score=46.36  Aligned_cols=30  Identities=17%  Similarity=0.388  Sum_probs=26.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||+|+++|+.+++.|++.|....+|
T Consensus       237 ~~~IIFc~tr~~~e~la~~L~~~g~~v~~~  266 (607)
T PRK11057        237 KSGIIYCNSRAKVEDTAARLQSRGISAAAY  266 (607)
T ss_pred             CCEEEEECcHHHHHHHHHHHHhCCCCEEEe
Confidence            478999999999999999999999876665


No 12 
>KOG0328|consensus
Probab=97.38  E-value=0.00019  Score=46.58  Aligned_cols=28  Identities=29%  Similarity=0.494  Sum_probs=24.7

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +.|++||||||..+|=|.++|+.++.-.
T Consensus       266 ItQavIFcnTk~kVdwLtekm~~~nftV  293 (400)
T KOG0328|consen  266 ITQAVIFCNTKRKVDWLTEKMREANFTV  293 (400)
T ss_pred             hheEEEEecccchhhHHHHHHHhhCcee
Confidence            3699999999999999999999887644


No 13 
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=97.33  E-value=0.00048  Score=43.28  Aligned_cols=30  Identities=17%  Similarity=0.227  Sum_probs=26.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++|||||+++.|+.|++.|.+.|.....+
T Consensus       336 ~~~IVF~~s~~~~~~l~~~L~~~~~~~~~~  365 (475)
T PRK01297        336 ERVMVFANRKDEVRRIEERLVKDGINAAQL  365 (475)
T ss_pred             CeEEEEeCCHHHHHHHHHHHHHcCCCEEEE
Confidence            589999999999999999999988765443


No 14 
>PTZ00110 helicase; Provisional
Probab=97.32  E-value=0.00044  Score=44.83  Aligned_cols=28  Identities=32%  Similarity=0.350  Sum_probs=24.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++||||+|+..|+.|++.|+..|..-.
T Consensus       378 ~k~LIF~~t~~~a~~l~~~L~~~g~~~~  405 (545)
T PTZ00110        378 DKILIFVETKKGADFLTKELRLDGWPAL  405 (545)
T ss_pred             CeEEEEecChHHHHHHHHHHHHcCCcEE
Confidence            4899999999999999999998886543


No 15 
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=97.32  E-value=0.00042  Score=45.98  Aligned_cols=28  Identities=29%  Similarity=0.256  Sum_probs=24.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++|||||||..|++|++.|.+.|....
T Consensus       246 ~~~IVF~~tk~~a~~l~~~L~~~g~~~~  273 (629)
T PRK11634        246 DAAIIFVRTKNATLEVAEALERNGYNSA  273 (629)
T ss_pred             CCEEEEeccHHHHHHHHHHHHhCCCCEE
Confidence            5799999999999999999999986543


No 16 
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=97.30  E-value=0.00034  Score=41.85  Aligned_cols=26  Identities=12%  Similarity=0.072  Sum_probs=23.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++||||||+++|+.+++.|.+.+..
T Consensus       223 ~~~lVf~~t~~~~~~~~~~L~~~~~~  248 (358)
T TIGR01587       223 GKIAIIVNTVDRAQEFYQQLKENAPE  248 (358)
T ss_pred             CeEEEEECCHHHHHHHHHHHHhhcCC
Confidence            58999999999999999999988764


No 17 
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=97.26  E-value=0.00053  Score=44.28  Aligned_cols=30  Identities=17%  Similarity=0.358  Sum_probs=26.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||+|+.+|+.|++.|...|.....|
T Consensus       225 ~~~IIf~~sr~~~e~la~~L~~~g~~~~~~  254 (591)
T TIGR01389       225 QSGIIYASSRKKVEELAERLESQGISALAY  254 (591)
T ss_pred             CCEEEEECcHHHHHHHHHHHHhCCCCEEEE
Confidence            478999999999999999999998766554


No 18 
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=97.20  E-value=0.00047  Score=42.47  Aligned_cols=25  Identities=16%  Similarity=0.206  Sum_probs=22.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||||||+..|+++++.|++.|.
T Consensus       273 ~k~LIf~nt~~~~~~l~~~L~~~~~  297 (357)
T TIGR03158       273 ERGAIILDSLDEVNRLSDLLQQQGL  297 (357)
T ss_pred             CeEEEEECCHHHHHHHHHHHhhhCC
Confidence            4799999999999999999998764


No 19 
>PTZ00424 helicase 45; Provisional
Probab=97.10  E-value=0.0011  Score=40.04  Aligned_cols=30  Identities=23%  Similarity=0.460  Sum_probs=25.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++||||+|+..|+.+++.|.+.|....++
T Consensus       268 ~~~ivF~~t~~~~~~l~~~l~~~~~~~~~~  297 (401)
T PTZ00424        268 TQAIIYCNTRRKVDYLTKKMHERDFTVSCM  297 (401)
T ss_pred             CeEEEEecCcHHHHHHHHHHHHCCCcEEEE
Confidence            478999999999999999999987765543


No 20 
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype. This model describes a CRISPR-associated putative DEAH-box helicase, or Cas3, of a subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. This protein includes both DEAH and HD motifs.
Probab=97.07  E-value=0.00065  Score=47.21  Aligned_cols=25  Identities=24%  Similarity=0.289  Sum_probs=23.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||||||++.|++|++.|++.|.
T Consensus       273 ~~vLVF~NTv~~Aq~L~~~L~~~g~  297 (844)
T TIGR02621       273 GAILVFCRTVKHVRKVFAKLPKEKF  297 (844)
T ss_pred             CcEEEEECCHHHHHHHHHHHHhcCC
Confidence            5799999999999999999998875


No 21 
>KOG0333|consensus
Probab=97.03  E-value=0.00065  Score=46.54  Aligned_cols=25  Identities=28%  Similarity=0.430  Sum_probs=23.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .+|||+|||+.||.||+.|++.|..
T Consensus       519 piIIFvN~kk~~d~lAk~LeK~g~~  543 (673)
T KOG0333|consen  519 PIIIFVNTKKGADALAKILEKAGYK  543 (673)
T ss_pred             CEEEEEechhhHHHHHHHHhhccce
Confidence            5899999999999999999999954


No 22 
>KOG0327|consensus
Probab=96.99  E-value=0.0008  Score=43.99  Aligned_cols=30  Identities=30%  Similarity=0.460  Sum_probs=26.1

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      +.|++|||||++.++.|..+|.++|..-+.
T Consensus       263 ~~q~~if~nt~r~v~~l~~~L~~~~~~~s~  292 (397)
T KOG0327|consen  263 VTQAVIFCNTRRKVDNLTDKLRAHGFTVSA  292 (397)
T ss_pred             hhcceEEecchhhHHHHHHHHhhCCceEEE
Confidence            468999999999999999999888876543


No 23 
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]
Probab=96.92  E-value=0.0014  Score=44.28  Aligned_cols=31  Identities=19%  Similarity=0.395  Sum_probs=27.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +++||+|.||..|+++|++|++.|..-..|-
T Consensus       231 ~~GIIYc~sRk~~E~ia~~L~~~g~~a~~YH  261 (590)
T COG0514         231 KSGIIYCLTRKKVEELAEWLRKNGISAGAYH  261 (590)
T ss_pred             CCeEEEEeeHHhHHHHHHHHHHCCCceEEec
Confidence            3589999999999999999999998877763


No 24 
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional
Probab=96.91  E-value=0.0012  Score=47.51  Aligned_cols=30  Identities=20%  Similarity=0.772  Sum_probs=27.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++||||+|+.+|+.|++.|++.|....+|
T Consensus       681 esgIIYC~SRke~E~LAe~L~~~Gika~~Y  710 (1195)
T PLN03137        681 ECGIIYCLSRMDCEKVAERLQEFGHKAAFY  710 (1195)
T ss_pred             CCceeEeCchhHHHHHHHHHHHCCCCeeee
Confidence            368999999999999999999999887776


No 25 
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process
Probab=96.88  E-value=0.003  Score=31.92  Aligned_cols=30  Identities=27%  Similarity=0.419  Sum_probs=25.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++||||+++..++.+++.|.+.+.+..++
T Consensus        29 ~~~lvf~~~~~~~~~~~~~l~~~~~~~~~~   58 (131)
T cd00079          29 GKVLIFCPSKKMLDELAELLRKPGIKVAAL   58 (131)
T ss_pred             CcEEEEeCcHHHHHHHHHHHHhcCCcEEEE
Confidence            478999999999999999999876665443


No 26 
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]
Probab=96.71  E-value=0.0017  Score=45.27  Aligned_cols=30  Identities=17%  Similarity=0.389  Sum_probs=26.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .|+|||+|++..|..||+.|...|..-+-|
T Consensus       441 GQtIVFT~SRrr~h~lA~~L~~kG~~a~pY  470 (830)
T COG1202         441 GQTIVFTYSRRRCHELADALTGKGLKAAPY  470 (830)
T ss_pred             CceEEEecchhhHHHHHHHhhcCCcccccc
Confidence            589999999999999999999888776555


No 27 
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=96.56  E-value=0.0022  Score=43.30  Aligned_cols=23  Identities=17%  Similarity=0.358  Sum_probs=20.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++|||||||..|+.|++.|++.
T Consensus       272 ~~~IVF~~sr~~ae~l~~~l~~~  294 (742)
T TIGR03817       272 ARTLTFVRSRRGAELVAAIARRL  294 (742)
T ss_pred             CCEEEEcCCHHHHHHHHHHHHHH
Confidence            47999999999999999998764


No 28 
>PRK05298 excinuclease ABC subunit B; Provisional
Probab=96.50  E-value=0.0048  Score=41.09  Aligned_cols=29  Identities=28%  Similarity=0.488  Sum_probs=25.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .++||||+|+..|++|++.|...|....+
T Consensus       447 ~~viIf~~t~~~ae~L~~~L~~~gi~~~~  475 (652)
T PRK05298        447 ERVLVTTLTKRMAEDLTDYLKELGIKVRY  475 (652)
T ss_pred             CEEEEEeCCHHHHHHHHHHHhhcceeEEE
Confidence            47999999999999999999999876544


No 29 
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=96.50  E-value=0.0048  Score=41.48  Aligned_cols=29  Identities=28%  Similarity=0.489  Sum_probs=25.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .++||||+|+..+++|++.|.+.|....|
T Consensus       443 ~~vLIf~~tk~~ae~L~~~L~~~gi~~~~  471 (655)
T TIGR00631       443 ERVLVTTLTKKMAEDLTDYLKELGIKVRY  471 (655)
T ss_pred             CEEEEEECCHHHHHHHHHHHhhhccceee
Confidence            47999999999999999999999876554


No 30 
>PRK09751 putative ATP-dependent helicase Lhr; Provisional
Probab=96.41  E-value=0.0031  Score=46.03  Aligned_cols=24  Identities=17%  Similarity=0.308  Sum_probs=21.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++|||||||..|+.|+..|++.+
T Consensus       245 ~stLVFvNSR~~AE~La~~L~~~~  268 (1490)
T PRK09751        245 RSTIVFTNSRGLAEKLTARLNELY  268 (1490)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHhh
Confidence            478999999999999999998753


No 31 
>PRK13767 ATP-dependent helicase; Provisional
Probab=96.34  E-value=0.0043  Score=42.48  Aligned_cols=23  Identities=22%  Similarity=0.283  Sum_probs=21.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++||||||+..|+.+++.|.+.
T Consensus       285 ~~~LVF~nTr~~ae~la~~L~~~  307 (876)
T PRK13767        285 RTTLIFTNTRSGAERVLYNLRKR  307 (876)
T ss_pred             CCEEEEeCCHHHHHHHHHHHHHh
Confidence            47999999999999999999874


No 32 
>PRK09401 reverse gyrase; Reviewed
Probab=96.33  E-value=0.0058  Score=43.46  Aligned_cols=28  Identities=25%  Similarity=0.440  Sum_probs=24.7

Q ss_pred             ceEEEEecchhh---HHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLD---CDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~---ad~La~~L~~~G~~~~   29 (33)
                      .++||||||+.+   |++|++.|++.|....
T Consensus       329 ~~~LIFv~t~~~~~~ae~l~~~L~~~gi~v~  359 (1176)
T PRK09401        329 DGGLIFVPSDKGKEYAEELAEYLEDLGINAE  359 (1176)
T ss_pred             CCEEEEEecccChHHHHHHHHHHHHCCCcEE
Confidence            478999999888   9999999999997654


No 33 
>PRK02362 ski2-like helicase; Provisional
Probab=96.29  E-value=0.0045  Score=41.22  Aligned_cols=23  Identities=13%  Similarity=0.387  Sum_probs=21.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++||||+||.+|+.+|+.|.+.
T Consensus       244 ~~~LVF~~sr~~~~~~a~~L~~~  266 (737)
T PRK02362        244 GQCLVFVSSRRNAEGFAKRAASA  266 (737)
T ss_pred             CCeEEEEeCHHHHHHHHHHHHHH
Confidence            48999999999999999999765


No 34 
>PRK12898 secA preprotein translocase subunit SecA; Reviewed
Probab=96.22  E-value=0.0088  Score=40.76  Aligned_cols=28  Identities=14%  Similarity=0.084  Sum_probs=24.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..+||||+|+.+++.|++.|.+.|....
T Consensus       474 ~pvLIft~t~~~se~L~~~L~~~gi~~~  501 (656)
T PRK12898        474 RPVLVGTRSVAASERLSALLREAGLPHQ  501 (656)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHCCCCEE
Confidence            3689999999999999999999986543


No 35 
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=96.22  E-value=0.0076  Score=42.84  Aligned_cols=28  Identities=4%  Similarity=0.318  Sum_probs=24.8

Q ss_pred             ceEEEEecch---hhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTK---LDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK---~~ad~La~~L~~~G~~~~   29 (33)
                      .++||||+|+   +.|++|++.|++.|..-.
T Consensus       327 ~~~IVFv~t~~~~~~a~~l~~~L~~~g~~a~  357 (1171)
T TIGR01054       327 TGGIVYVSIDYGKEKAEEIAEFLENHGVKAV  357 (1171)
T ss_pred             CCEEEEEeccccHHHHHHHHHHHHhCCceEE
Confidence            4689999999   999999999999987644


No 36 
>PRK00254 ski2-like helicase; Provisional
Probab=96.03  E-value=0.0074  Score=40.09  Aligned_cols=22  Identities=23%  Similarity=0.303  Sum_probs=19.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++|||||||..|+.++..|.+
T Consensus       239 ~~vLVF~~sr~~~~~~a~~l~~  260 (720)
T PRK00254        239 KGALVFVNTRRSAEKEALELAK  260 (720)
T ss_pred             CCEEEEEcChHHHHHHHHHHHH
Confidence            4799999999999999988854


No 37 
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=96.02  E-value=0.011  Score=38.04  Aligned_cols=23  Identities=22%  Similarity=0.443  Sum_probs=20.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++||||||+..|+.|++.|...
T Consensus       368 ~~~iVFv~s~~~a~~l~~~L~~~  390 (518)
T PLN00206        368 PPAVVFVSSRLGADLLANAITVV  390 (518)
T ss_pred             CCEEEEcCCchhHHHHHHHHhhc
Confidence            36999999999999999999863


No 38 
>PRK09200 preprotein translocase subunit SecA; Reviewed
Probab=95.96  E-value=0.013  Score=40.70  Aligned_cols=27  Identities=11%  Similarity=0.081  Sum_probs=24.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .++||||+|++.++.|++.|.+.|...
T Consensus       429 ~pvLIf~~t~~~se~l~~~L~~~gi~~  455 (790)
T PRK09200        429 RPVLIGTGSIEQSETFSKLLDEAGIPH  455 (790)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHCCCCE
Confidence            479999999999999999999988654


No 39 
>PRK01172 ski2-like helicase; Provisional
Probab=95.86  E-value=0.011  Score=38.90  Aligned_cols=23  Identities=13%  Similarity=0.359  Sum_probs=20.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +++||||+|+.+|+.+++.|.+.
T Consensus       237 ~~vLVF~~sr~~~~~~a~~L~~~  259 (674)
T PRK01172        237 GQVLVFVSSRKNAEDYAEMLIQH  259 (674)
T ss_pred             CcEEEEeccHHHHHHHHHHHHHh
Confidence            57999999999999999999765


No 40 
>PRK14701 reverse gyrase; Provisional
Probab=95.80  E-value=0.011  Score=43.47  Aligned_cols=30  Identities=20%  Similarity=0.316  Sum_probs=25.1

Q ss_pred             ceEEEEecchhhH---HHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDC---DNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~a---d~La~~L~~~G~~~~~~   31 (33)
                      .++||||+|++.+   ++|++.|.++|.....+
T Consensus       331 ~~gIVF~~t~~~~e~ae~la~~L~~~Gi~a~~~  363 (1638)
T PRK14701        331 KGGLIFVPIDEGAEKAEEIEKYLLEDGFKIELV  363 (1638)
T ss_pred             CCeEEEEeccccchHHHHHHHHHHHCCCeEEEe
Confidence            4789999999874   89999999999875543


No 41 
>KOG0335|consensus
Probab=95.74  E-value=0.012  Score=39.21  Aligned_cols=28  Identities=29%  Similarity=0.456  Sum_probs=25.0

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |+..+|||.||+.|+.|+..|...|...
T Consensus       337 ~e~tlvFvEt~~~~d~l~~~l~~~~~~~  364 (482)
T KOG0335|consen  337 WEKTLVFVETKRGADELAAFLSSNGYPA  364 (482)
T ss_pred             cceEEEEeeccchhhHHHHHHhcCCCCc
Confidence            4679999999999999999999988753


No 42 
>PRK04914 ATP-dependent helicase HepA; Validated
Probab=95.72  E-value=0.018  Score=40.52  Aligned_cols=28  Identities=21%  Similarity=0.345  Sum_probs=23.5

Q ss_pred             ceEEEEecchhhHHHHHHHHH-hcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLN-SIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~-~~G~~~~   29 (33)
                      +++||||+++..++.|++.|+ +.|....
T Consensus       494 ~KvLVF~~~~~t~~~L~~~L~~~~Gi~~~  522 (956)
T PRK04914        494 EKVLVICAKAATALQLEQALREREGIRAA  522 (956)
T ss_pred             CeEEEEeCcHHHHHHHHHHHhhccCeeEE
Confidence            589999999999999999994 5565543


No 43 
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=95.72  E-value=0.013  Score=40.88  Aligned_cols=25  Identities=24%  Similarity=0.368  Sum_probs=22.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ..+|||+||+..|++|+..|++.+.
T Consensus       254 ~ttLIF~NTR~~aE~l~~~L~~~~~  278 (814)
T COG1201         254 RTTLIFTNTRSGAERLAFRLKKLGP  278 (814)
T ss_pred             CcEEEEEeChHHHHHHHHHHHHhcC
Confidence            3689999999999999999998874


No 44 
>PRK13766 Hef nuclease; Provisional
Probab=95.66  E-value=0.025  Score=37.46  Aligned_cols=28  Identities=11%  Similarity=0.291  Sum_probs=24.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++||||++++.|+.|.+.|.+.|....
T Consensus       366 ~kvlIF~~~~~t~~~L~~~L~~~~~~~~  393 (773)
T PRK13766        366 SRIIVFTQYRDTAEKIVDLLEKEGIKAV  393 (773)
T ss_pred             CeEEEEeCcHHHHHHHHHHHHhCCCceE
Confidence            5799999999999999999988876543


No 45 
>TIGR03714 secA2 accessory Sec system translocase SecA2. Members of this protein family are homologous to SecA and part of the accessory Sec system. This system, including both five core proteins for export and a variable number of proteins for glycosylation, operates in certain Gram-positive pathogens for the maturation and delivery of serine-rich glycoproteins such as the cell surface glycoprotein GspB in Streptococcus gordonii.
Probab=95.49  E-value=0.026  Score=39.19  Aligned_cols=28  Identities=7%  Similarity=-0.102  Sum_probs=24.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++||||+|++.++.|++.|.+.|....
T Consensus       425 ~pvLIft~s~~~se~ls~~L~~~gi~~~  452 (762)
T TIGR03714       425 QPVLLITGSVEMSEIYSELLLREGIPHN  452 (762)
T ss_pred             CCEEEEECcHHHHHHHHHHHHHCCCCEE
Confidence            4799999999999999999999887543


No 46 
>KOG0352|consensus
Probab=95.32  E-value=0.02  Score=39.16  Aligned_cols=25  Identities=20%  Similarity=0.595  Sum_probs=23.1

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .||+|+|+++|+++|-.|..+|.+-
T Consensus       258 GIVYCRTR~~cEq~AI~l~~~Gi~A  282 (641)
T KOG0352|consen  258 GIVYCRTRNECEQVAIMLEIAGIPA  282 (641)
T ss_pred             eEEEeccHHHHHHHHHHhhhcCcch
Confidence            6999999999999999999999763


No 47 
>PRK09694 helicase Cas3; Provisional
Probab=95.31  E-value=0.024  Score=39.55  Aligned_cols=24  Identities=17%  Similarity=0.367  Sum_probs=22.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++||||||.++|+++++.|++.+
T Consensus       561 ~~vLVf~NTV~~Aq~ly~~L~~~~  584 (878)
T PRK09694        561 AQVCLICNLVDDAQKLYQRLKELN  584 (878)
T ss_pred             CEEEEEECCHHHHHHHHHHHHhhC
Confidence            478999999999999999999875


No 48 
>PF05939 Phage_min_tail:  Phage minor tail protein;  InterPro: IPR010265 This entry is represented by Bacteriophage lambda, GpM, the minor tail protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of a series of phage minor tail proteins and related sequences from several bacterial species.
Probab=95.24  E-value=0.048  Score=29.48  Aligned_cols=30  Identities=20%  Similarity=0.364  Sum_probs=27.4

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      .|.|..++.+++.|.++|.++++-+++++|
T Consensus        45 ~ltf~~~~~~~~~I~~FL~~h~G~~sF~Wt   74 (109)
T PF05939_consen   45 SLTFTGTEAEIRAIEAFLDRHGGVKSFLWT   74 (109)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCceEEEEE
Confidence            478999999999999999999999999875


No 49 
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.
Probab=95.23  E-value=0.063  Score=25.58  Aligned_cols=31  Identities=13%  Similarity=0.374  Sum_probs=27.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +.+||+|+.-..+..++..|++.|....|++
T Consensus        51 ~~vv~~c~~~~~a~~~~~~l~~~G~~~v~~l   81 (89)
T cd00158          51 KPIVVYCRSGNRSARAAKLLRKAGGTNVYNL   81 (89)
T ss_pred             CeEEEEeCCCchHHHHHHHHHHhCcccEEEe
Confidence            3678999998999999999999998887764


No 50 
>PRK12904 preprotein translocase subunit SecA; Reviewed
Probab=95.14  E-value=0.037  Score=38.78  Aligned_cols=27  Identities=11%  Similarity=0.031  Sum_probs=24.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+||||+|+++++.|++.|.+.|...
T Consensus       431 rpVLIft~Si~~se~Ls~~L~~~gi~~  457 (830)
T PRK12904        431 QPVLVGTVSIEKSELLSKLLKKAGIPH  457 (830)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHCCCce
Confidence            469999999999999999999998654


No 51 
>PHA02653 RNA helicase NPH-II; Provisional
Probab=95.10  E-value=0.028  Score=38.22  Aligned_cols=24  Identities=17%  Similarity=0.516  Sum_probs=21.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++||||+|+.+|+++++.|++.+
T Consensus       396 g~iLVFlpg~~ei~~l~~~L~~~~  419 (675)
T PHA02653        396 SSGIVFVASVSQCEEYKKYLEKRL  419 (675)
T ss_pred             CcEEEEECcHHHHHHHHHHHHhhc
Confidence            479999999999999999999873


No 52 
>TIGR00963 secA preprotein translocase, SecA subunit. The proteins SecA-F and SecY, not all of which are necessary, comprise the standard prokaryotic protein translocation apparatus. Other, specialized translocation systems also exist but are not as broadly distributed. This model describes SecA, an essential member of the apparatus.
Probab=94.89  E-value=0.038  Score=38.36  Aligned_cols=27  Identities=11%  Similarity=0.010  Sum_probs=24.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+||||+|+++++.|++.|.+.|...
T Consensus       406 rpvLV~t~si~~se~ls~~L~~~gi~~  432 (745)
T TIGR00963       406 QPVLVGTTSVEKSELLSNLLKERGIPH  432 (745)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHcCCCe
Confidence            468999999999999999999998654


No 53 
>smart00450 RHOD Rhodanese Homology Domain. An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions.
Probab=94.85  E-value=0.094  Score=25.04  Aligned_cols=31  Identities=13%  Similarity=0.405  Sum_probs=27.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ...||+|++-..+..++..|.+.|....|++
T Consensus        57 ~~iv~~c~~g~~a~~~~~~l~~~G~~~v~~l   87 (100)
T smart00450       57 KPVVVYCRSGNRSAKAAWLLRELGFKNVYLL   87 (100)
T ss_pred             CeEEEEeCCCcHHHHHHHHHHHcCCCceEEe
Confidence            3689999999999999999999999876654


No 54 
>PRK12906 secA preprotein translocase subunit SecA; Reviewed
Probab=94.84  E-value=0.041  Score=38.44  Aligned_cols=28  Identities=11%  Similarity=0.042  Sum_probs=25.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..+||||+|++.++.|++.|.+.|....
T Consensus       441 ~pvLI~t~si~~se~ls~~L~~~gi~~~  468 (796)
T PRK12906        441 QPVLVGTVAIESSERLSHLLDEAGIPHA  468 (796)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHCCCCee
Confidence            4799999999999999999999987643


No 55 
>KOG0337|consensus
Probab=94.73  E-value=0.039  Score=37.30  Aligned_cols=31  Identities=13%  Similarity=0.241  Sum_probs=28.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +|.||||.||+.++-+.+-|+..|.+-++.+
T Consensus       262 ~~t~vf~~tk~hve~~~~ll~~~g~~~s~iy  292 (529)
T KOG0337|consen  262 KQTIVFVATKHHVEYVRGLLRDFGGEGSDIY  292 (529)
T ss_pred             cceeEEecccchHHHHHHHHHhcCCCccccc
Confidence            5899999999999999999999999877654


No 56 
>PRK12900 secA preprotein translocase subunit SecA; Reviewed
Probab=94.48  E-value=0.055  Score=38.90  Aligned_cols=28  Identities=14%  Similarity=0.030  Sum_probs=24.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..+||||+|++.++.|++.|.+.|....
T Consensus       599 rpVLIft~Sve~sE~Ls~~L~~~gI~h~  626 (1025)
T PRK12900        599 QPVLVGTASVEVSETLSRMLRAKRIAHN  626 (1025)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHcCCCce
Confidence            4799999999999999999999987643


No 57 
>KOG0330|consensus
Probab=94.22  E-value=0.058  Score=36.17  Aligned_cols=26  Identities=19%  Similarity=0.358  Sum_probs=23.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .+.||||||...++.++-.|+..|..
T Consensus       301 ~s~iVF~~t~~tt~~la~~L~~lg~~  326 (476)
T KOG0330|consen  301 NSVIVFCNTCNTTRFLALLLRNLGFQ  326 (476)
T ss_pred             CcEEEEEeccchHHHHHHHHHhcCcc
Confidence            36899999999999999999998865


No 58 
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=93.93  E-value=0.073  Score=38.85  Aligned_cols=26  Identities=23%  Similarity=0.333  Sum_probs=23.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +++|||++++.+++.+++.|++.|..
T Consensus       287 GdILVFLpg~~EIe~lae~L~~~~~~  312 (1294)
T PRK11131        287 GDILIFMSGEREIRDTADALNKLNLR  312 (1294)
T ss_pred             CCEEEEcCCHHHHHHHHHHHHhcCCC
Confidence            57899999999999999999988754


No 59 
>KOG0326|consensus
Probab=93.92  E-value=0.056  Score=35.93  Aligned_cols=27  Identities=15%  Similarity=0.493  Sum_probs=24.4

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +.|+|||||.-+.++-||+++.+.|..
T Consensus       322 INQsIIFCNS~~rVELLAkKITelGys  348 (459)
T KOG0326|consen  322 INQSIIFCNSTNRVELLAKKITELGYS  348 (459)
T ss_pred             ccceEEEeccchHhHHHHHHHHhccch
Confidence            368999999999999999999998864


No 60 
>KOG0351|consensus
Probab=93.80  E-value=0.051  Score=38.44  Aligned_cols=30  Identities=20%  Similarity=0.724  Sum_probs=27.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +..||.|.+|.+||.++..|++.|...++|
T Consensus       486 ~s~IIYC~sr~~ce~vs~~L~~~~~~a~~Y  515 (941)
T KOG0351|consen  486 QSGIIYCLSRKECEQVSAVLRSLGKSAAFY  515 (941)
T ss_pred             CCeEEEeCCcchHHHHHHHHHHhchhhHhh
Confidence            468999999999999999999999888777


No 61 
>PRK13104 secA preprotein translocase subunit SecA; Reviewed
Probab=93.66  E-value=0.095  Score=37.16  Aligned_cols=27  Identities=11%  Similarity=0.052  Sum_probs=24.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+||||+|++.++.|++.|.+.|...
T Consensus       445 ~PVLVgt~Sie~sE~ls~~L~~~gi~h  471 (896)
T PRK13104        445 QPVLVGTVSIEASEFLSQLLKKENIKH  471 (896)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHcCCCe
Confidence            358999999999999999999998754


No 62 
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. Only the second and most of the fourth repeats contain the putative catalytic Cys residue. This CD aligns the 1st , 2nd, 3rd, and 4th repeats.
Probab=93.41  E-value=0.26  Score=24.61  Aligned_cols=30  Identities=13%  Similarity=0.192  Sum_probs=25.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..||.|++-..+...+..|.+.|....|+.
T Consensus        58 ~ivv~c~~g~~s~~~~~~l~~~G~~~v~~l   87 (96)
T cd01529          58 RYVLTCDGSLLARFAAQELLALGGKPVALL   87 (96)
T ss_pred             CEEEEeCChHHHHHHHHHHHHcCCCCEEEe
Confidence            579999999999999999999999766653


No 63 
>COG4718 Phage-related protein [Function unknown]
Probab=93.11  E-value=0.19  Score=28.28  Aligned_cols=30  Identities=23%  Similarity=0.317  Sum_probs=27.8

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      .+.|.-+|++...|-++|.++|+-+++|.|
T Consensus        47 ~vt~~~~~~~~~~l~aFL~rHgg~ksFlWT   76 (111)
T COG4718          47 SVTFRVTKEEIRPLEAFLSRHGGVKAFLWT   76 (111)
T ss_pred             EEEEEeeHHHhhhHHHHHHhcCcEEEEEec
Confidence            478999999999999999999999999976


No 64 
>COG1204 Superfamily II helicase [General function prediction only]
Probab=93.09  E-value=0.11  Score=35.79  Aligned_cols=22  Identities=14%  Similarity=0.410  Sum_probs=20.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      +|+||||++|..+...|.+|..
T Consensus       254 ~qvLvFv~sR~~a~~~A~~l~~  275 (766)
T COG1204         254 GQVLVFVHSRKEAEKTAKKLRI  275 (766)
T ss_pred             CeEEEEEecCchHHHHHHHHHH
Confidence            5899999999999999999984


No 65 
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YgaP, and similar uncharacterized putative rhodanese-related sulfurtransferases.
Probab=92.98  E-value=0.31  Score=24.35  Aligned_cols=31  Identities=16%  Similarity=0.357  Sum_probs=25.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +.++++|++-..+...+..|.+.|....|++
T Consensus        55 ~~iv~~c~~g~~s~~~~~~L~~~g~~~v~~l   85 (99)
T cd01527          55 NAIIFHCRSGMRTQQNAERLAAISAGEAYVL   85 (99)
T ss_pred             CcEEEEeCCCchHHHHHHHHHHcCCccEEEe
Confidence            3678999998889999999999998766643


No 66 
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=92.88  E-value=0.13  Score=35.56  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=20.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++|||++++.+++.+++.|++
T Consensus       213 g~iLVFlpg~~ei~~l~~~L~~  234 (812)
T PRK11664        213 GSLLLFLPGVGEIQRVQEQLAS  234 (812)
T ss_pred             CCEEEEcCCHHHHHHHHHHHHH
Confidence            4789999999999999999997


No 67 
>PRK10689 transcription-repair coupling factor; Provisional
Probab=92.85  E-value=0.23  Score=35.65  Aligned_cols=23  Identities=4%  Similarity=0.078  Sum_probs=21.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .|++||||+++.++.+++.|++.
T Consensus       810 gqv~vf~n~i~~ie~la~~L~~~  832 (1147)
T PRK10689        810 GQVYYLYNDVENIQKAAERLAEL  832 (1147)
T ss_pred             CeEEEEECCHHHHHHHHHHHHHh
Confidence            48999999999999999999987


No 68 
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]
Probab=92.67  E-value=0.17  Score=34.54  Aligned_cols=27  Identities=15%  Similarity=0.413  Sum_probs=24.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +++|||++-++.|+.|+++|.+.|...
T Consensus       367 ~RvIVFT~yRdTae~i~~~L~~~~~~~  393 (542)
T COG1111         367 SRVIVFTEYRDTAEEIVNFLKKIGIKA  393 (542)
T ss_pred             ceEEEEehhHhHHHHHHHHHHhcCCcc
Confidence            589999999999999999999988754


No 69 
>KOG0354|consensus
Probab=92.65  E-value=0.14  Score=35.90  Aligned_cols=22  Identities=27%  Similarity=0.490  Sum_probs=20.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++||||+||+.|+.|-.+|.+
T Consensus       414 sR~IIFve~R~sa~~l~~~l~~  435 (746)
T KOG0354|consen  414 SRTIIFVETRESALALKKWLLQ  435 (746)
T ss_pred             ccEEEEEehHHHHHHHHHHHHh
Confidence            5899999999999999999984


No 70 
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily. This CD includes predicted proteins with rhodanese-like domains found N-terminal of the metallo-beta-lactamase domain.
Probab=92.58  E-value=0.32  Score=24.37  Aligned_cols=30  Identities=10%  Similarity=0.248  Sum_probs=25.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +..+|.|++=..+...+..|++.|.. .|+.
T Consensus        62 ~~ivv~C~~G~rs~~aa~~L~~~G~~-~~~l   91 (100)
T cd01523          62 QEVTVICAKEGSSQFVAELLAERGYD-VDYL   91 (100)
T ss_pred             CeEEEEcCCCCcHHHHHHHHHHcCce-eEEe
Confidence            35789999988999999999999998 6654


No 71 
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain. This domain is believed to serve as a polysulfide binding and transferase domain in anaerobic gram-negative bacteria, functioning in oxidative phosphorylation with polysulfide-sulfur as a terminal electron acceptor. The active site contains the same conserved cysteine that is the catalytic residue in other Rhodanese Homology Domain proteins.
Probab=92.54  E-value=0.2  Score=24.81  Aligned_cols=30  Identities=10%  Similarity=0.303  Sum_probs=25.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+|+|++-..+.+.+..|+..|...++++
T Consensus        63 ~ivv~c~~g~~s~~~~~~l~~~G~~~v~~l   92 (103)
T cd01447          63 PFVFYCASGWRSALAGKTLQDMGLKPVYNI   92 (103)
T ss_pred             eEEEEcCCCCcHHHHHHHHHHcChHHhEee
Confidence            578999988889999999999998766553


No 72 
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily. This CD includes the heat shock protein 67B2 of Drosophila melanogaster and other similar proteins, many of which are uncharacterized.
Probab=92.10  E-value=0.4  Score=24.00  Aligned_cols=29  Identities=7%  Similarity=0.235  Sum_probs=25.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .+||+|++-..+...+..|...|....|.
T Consensus        68 ~ivv~c~~g~~s~~~~~~l~~~G~~~v~~   96 (106)
T cd01519          68 ELIFYCKAGVRSKAAAELARSLGYENVGN   96 (106)
T ss_pred             eEEEECCCcHHHHHHHHHHHHcCCcccee
Confidence            68999999999999999999999876553


No 73 
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=92.00  E-value=0.21  Score=34.68  Aligned_cols=22  Identities=14%  Similarity=0.270  Sum_probs=20.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++|||++++.+++.+++.|++
T Consensus       210 g~iLVFlpg~~eI~~l~~~L~~  231 (819)
T TIGR01970       210 GSILVFLPGQAEIRRVQEQLAE  231 (819)
T ss_pred             CcEEEEECCHHHHHHHHHHHHh
Confidence            4799999999999999999987


No 74 
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily. This CD includes several putative molybdopterin synthase sulfurylases including the molybdenum cofactor biosynthetic protein (CnxF) of Aspergillus nidulans and the molybdenum cofactor synthesis protein 3 (MOCS3) of Homo sapiens. These rhodanese-like domains are found C-terminal of the ThiF and MoeZ_MoeB domains.
Probab=91.97  E-value=0.34  Score=25.43  Aligned_cols=31  Identities=19%  Similarity=0.340  Sum_probs=26.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC-ceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR-RLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~-~~~~~~   32 (33)
                      +..+|+|++-..+...+..|++.|. ...+++
T Consensus        73 ~~ivv~C~~G~rs~~aa~~L~~~G~~~~v~~l  104 (122)
T cd01526          73 SPIYVVCRRGNDSQTAVRKLKELGLERFVRDI  104 (122)
T ss_pred             CcEEEECCCCCcHHHHHHHHHHcCCccceeee
Confidence            3578999998999999999999999 555554


No 75 
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the second repeat. Only the second repeat contains the catalytically active Cys residue.
Probab=91.59  E-value=0.52  Score=24.06  Aligned_cols=31  Identities=10%  Similarity=0.274  Sum_probs=25.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +..||+|++-..+.+++..|+..|....|.+
T Consensus        79 ~~iv~yc~~g~~s~~~~~~l~~~G~~~v~~l  109 (118)
T cd01449          79 KPVIVYCGSGVTACVLLLALELLGYKNVRLY  109 (118)
T ss_pred             CCEEEECCcHHHHHHHHHHHHHcCCCCeeee
Confidence            3679999998899999999999998765543


No 76 
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2. Subgroup 2 includes uncharacterized putative rhodanese-related domains.
Probab=91.24  E-value=0.71  Score=23.19  Aligned_cols=30  Identities=10%  Similarity=0.243  Sum_probs=26.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .++|+|++-..+...+..|.+.|....|++
T Consensus        60 ~vv~~c~~g~rs~~~~~~l~~~G~~~v~~l   89 (101)
T cd01528          60 DIVVLCHHGGRSMQVAQWLLRQGFENVYNL   89 (101)
T ss_pred             eEEEEeCCCchHHHHHHHHHHcCCccEEEe
Confidence            678999999999999999999999766654


No 77 
>KOG0340|consensus
Probab=91.21  E-value=0.31  Score=32.54  Aligned_cols=27  Identities=26%  Similarity=0.519  Sum_probs=23.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .+++||+||...|+.|+.-|+..+.+.
T Consensus       255 ~simIFvnttr~cQ~l~~~l~~le~r~  281 (442)
T KOG0340|consen  255 GSIMIFVNTTRECQLLSMTLKNLEVRV  281 (442)
T ss_pred             ceEEEEeehhHHHHHHHHHHhhhceee
Confidence            479999999999999999998876553


No 78 
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=91.20  E-value=0.26  Score=35.16  Aligned_cols=27  Identities=7%  Similarity=0.262  Sum_probs=23.1

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +.++||||.+..+|+++.+.|++.--+
T Consensus       426 ~~KTIvFa~n~dHAe~i~~~~~~~ype  452 (875)
T COG4096         426 IGKTIVFAKNHDHAERIREALVNEYPE  452 (875)
T ss_pred             cCceEEEeeCcHHHHHHHHHHHHhCcc
Confidence            357999999999999999999876543


No 79 
>PRK13107 preprotein translocase subunit SecA; Reviewed
Probab=91.09  E-value=0.41  Score=34.19  Aligned_cols=27  Identities=11%  Similarity=-0.012  Sum_probs=24.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+||||+|.+.++.|++.|.+.|...
T Consensus       450 rpVLV~t~sv~~se~ls~~L~~~gi~~  476 (908)
T PRK13107        450 QPVLVGTVSIEQSELLARLMVKEKIPH  476 (908)
T ss_pred             CCEEEEeCcHHHHHHHHHHHHHCCCCe
Confidence            368999999999999999999988654


No 80 
>PF10740 DUF2529:  Protein of unknown function (DUF2529);  InterPro: IPR019676  This entry represents a protein family conserved in the Bacillales. Their function is not known. ; PDB: 3JX9_A.
Probab=91.07  E-value=0.4  Score=28.51  Aligned_cols=28  Identities=21%  Similarity=0.305  Sum_probs=20.1

Q ss_pred             ceEEEEecchh--hHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKL--DCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~--~ad~La~~L~~~G~~~~   29 (33)
                      +++++|++-..  ++.++++.|..+|..+.
T Consensus        83 DRVllfs~~~~~~e~~~~a~~L~~~gi~~v  112 (172)
T PF10740_consen   83 DRVLLFSPFSTDEEAVALAKQLIEQGIPFV  112 (172)
T ss_dssp             -EEEEEES-S--HHHHHHHHHHHHHT--EE
T ss_pred             ceEEEEeCCCCCHHHHHHHHHHHHCCCCEE
Confidence            68999998655  57889999999998764


No 81 
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily. Unlike other rhodanese sulfurtransferases, GlpE is a single domain protein but indications are that it functions as a dimer. The active site contains a catalytically active cysteine.
Probab=90.96  E-value=0.75  Score=22.52  Aligned_cols=30  Identities=10%  Similarity=0.186  Sum_probs=26.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..||.|++-..+...+..|++.|..-.|+.
T Consensus        58 ~ivv~c~~g~~s~~a~~~l~~~G~~~v~~l   87 (96)
T cd01444          58 PVVVYCYHGNSSAQLAQALREAGFTDVRSL   87 (96)
T ss_pred             CEEEEeCCCChHHHHHHHHHHcCCceEEEc
Confidence            578999999999999999999998776653


No 82 
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 1st repeat which does not contain the putative catalytic Cys residue.
Probab=90.82  E-value=0.86  Score=22.79  Aligned_cols=29  Identities=7%  Similarity=0.043  Sum_probs=23.8

Q ss_pred             eEEEEecc--hhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRT--KLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nT--K~~ad~La~~L~~~G~~~~~~   31 (33)
                      ..||+|.+  +..+...+..|.+.|....|+
T Consensus        52 ~ivl~c~~G~~~~s~~aa~~L~~~G~~~v~~   82 (92)
T cd01532          52 PIVVYGEGGGEDLAPRAARRLSELGYTDVAL   82 (92)
T ss_pred             eEEEEeCCCCchHHHHHHHHHHHcCccCEEE
Confidence            67899998  455789999999999887665


No 83 
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the 1st repeat, which does not contain the catalytically active Cys residue. The role of the 1st repeat is uncertain, but it is believed to be involved in protein interaction.
Probab=90.66  E-value=0.67  Score=23.91  Aligned_cols=30  Identities=3%  Similarity=-0.032  Sum_probs=25.6

Q ss_pred             eEEEEecc-hhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRT-KLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nT-K~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .+|++|++ -..+...+..|+..|....|++
T Consensus        81 ~vv~~c~~g~~~a~~~~~~l~~~G~~~v~~l  111 (122)
T cd01448          81 TVVVYDDGGGFFAARAWWTLRYFGHENVRVL  111 (122)
T ss_pred             EEEEECCCCCccHHHHHHHHHHcCCCCEEEe
Confidence            58999999 5899999999999998876654


No 84 
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=90.64  E-value=0.36  Score=34.65  Aligned_cols=23  Identities=30%  Similarity=0.469  Sum_probs=20.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++||||++++.|+.+++.|++.
T Consensus       699 ~KtiIF~~s~~HA~~i~~~L~~~  721 (1123)
T PRK11448        699 GKTLIFAATDAHADMVVRLLKEA  721 (1123)
T ss_pred             CcEEEEEcCHHHHHHHHHHHHHH
Confidence            47999999999999999998764


No 85 
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily. Included in this CD are the Lactococcus lactis NADH oxidase, Bacillus cereus NADH dehydrogenase, and Bacteroides thetaiotaomicron pyridine nucleotide-disulphide oxidoreductase, and similar rhodanese-like domains found C-terminal of the pyridine nucleotide-disulphide oxidoreductase (Pyr-redox) domain and the Pyr-redox dimerization domain.
Probab=90.51  E-value=0.83  Score=22.55  Aligned_cols=29  Identities=14%  Similarity=0.187  Sum_probs=24.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +..|++|++-..+...+..|++.|. ..+.
T Consensus        52 ~~vvl~c~~g~~a~~~a~~L~~~G~-~v~~   80 (90)
T cd01524          52 KEIIVYCAVGLRGYIAARILTQNGF-KVKN   80 (90)
T ss_pred             CcEEEEcCCChhHHHHHHHHHHCCC-CEEE
Confidence            3678999998889999999999998 4443


No 86 
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 3rd repeat which does not contain the putative catalytic Cys residue.
Probab=90.33  E-value=0.88  Score=22.68  Aligned_cols=29  Identities=14%  Similarity=0.298  Sum_probs=25.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..|++|.+=..+...+..|+..|.. .|++
T Consensus        58 ~iv~~c~~G~rs~~aa~~L~~~G~~-v~~l   86 (95)
T cd01534          58 RIVLADDDGVRADMTASWLAQMGWE-VYVL   86 (95)
T ss_pred             eEEEECCCCChHHHHHHHHHHcCCE-EEEe
Confidence            6899999988889999999999998 6654


No 87 
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=90.32  E-value=0.36  Score=35.35  Aligned_cols=25  Identities=16%  Similarity=0.182  Sum_probs=22.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++|||++++.+++.+++.|++.+.
T Consensus       280 GdILVFLpg~~EI~~l~~~L~~~~~  304 (1283)
T TIGR01967       280 GDILIFLPGEREIRDAAEILRKRNL  304 (1283)
T ss_pred             CCEEEeCCCHHHHHHHHHHHHhcCC
Confidence            5789999999999999999998764


No 88 
>PHA02558 uvsW UvsW helicase; Provisional
Probab=90.09  E-value=0.63  Score=29.98  Aligned_cols=27  Identities=7%  Similarity=0.183  Sum_probs=22.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .+.||||++.+.|+.|++.|++.|...
T Consensus       345 ~~~lV~~~~~~h~~~L~~~L~~~g~~v  371 (501)
T PHA02558        345 ENTFVMFKYVEHGKPLYEMLKKVYDKV  371 (501)
T ss_pred             CCEEEEEEEHHHHHHHHHHHHHcCCCE
Confidence            367888888889999999999988743


No 89 
>PF02617 ClpS:  ATP-dependent Clp protease adaptor protein ClpS;  InterPro: IPR003769 In the bacterial cytosol, ATP-dependent protein degradation is performed by several different chaperone-protease pairs, including ClpAP. ClpS directly influences the ClpAP machine by binding to the N-terminal domain of the chaperone ClpA. The degradation of ClpAP substrates, both SsrA-tagged proteins and ClpA itself, is specifically inhibited by ClpS. ClpS modifies ClpA substrate specificity, potentially redirecting degradation by ClpAP toward aggregated proteins [].  ClpS is a small alpha/beta protein that consists of three alpha-helices connected to three antiparallel beta-strands []. The protein has a globular shape, with a curved layer of three antiparallel alpha-helices over a twisted antiparallel beta-sheet. Dimerization of ClpS may occur through its N-terminal domain. This short extended N-terminal region in ClpS is followed by the central seven-residue beta-strand, which is flanked by two other beta-strands in a small beta-sheet. ; GO: 0030163 protein catabolic process; PDB: 3O2O_B 1MBU_D 3O2B_C 2WA9_D 3O1F_A 2W9R_A 1MG9_A 1MBX_C 2WA8_C 1R6O_D ....
Probab=90.00  E-value=0.38  Score=24.41  Aligned_cols=24  Identities=13%  Similarity=0.220  Sum_probs=22.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++++|++-+++.|+..++.|.+.|
T Consensus        48 G~avv~~~~~e~ae~~~~~l~~~g   71 (82)
T PF02617_consen   48 GRAVVGTGSREEAEEYAEKLQRAG   71 (82)
T ss_dssp             SEEEEEEEEHHHHHHHHHHHHHHH
T ss_pred             CCEeeeeCCHHHHHHHHHHHHHHh
Confidence            478999999999999999999887


No 90 
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins.
Probab=89.95  E-value=0.94  Score=22.75  Aligned_cols=29  Identities=21%  Similarity=0.639  Sum_probs=25.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      ..||.|++=..+...+..|.+.|....|.
T Consensus        63 ~ivvyC~~G~rs~~a~~~L~~~G~~~v~~   91 (101)
T cd01518          63 KVLMYCTGGIRCEKASAYLKERGFKNVYQ   91 (101)
T ss_pred             EEEEECCCchhHHHHHHHHHHhCCcceee
Confidence            57999999889999999999999876654


No 91 
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily. Included in this CD are the rhodanese-like domains found C-terminal of the serine/threonine protein kinases catalytic (S_TKc) domain and the Tre-2, BUB2p, Cdc16p (TBC) domain. The putative active site Cys residue is not present in this CD.
Probab=89.53  E-value=1.1  Score=22.30  Aligned_cols=29  Identities=7%  Similarity=0.062  Sum_probs=24.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++|.|++-..+...+..|...|....|.
T Consensus        67 ~vv~~c~~g~~s~~~a~~L~~~G~~~v~~   95 (105)
T cd01525          67 IIVIVSHSHKHAALFAAFLVKCGVPRVCI   95 (105)
T ss_pred             eEEEEeCCCccHHHHHHHHHHcCCCCEEE
Confidence            57889998888999999999999986664


No 92 
>PF00849 PseudoU_synth_2:  RNA pseudouridylate synthase This Prosite family is a subset of the Pfam family. This Prosite family is a subset of the Pfam family.;  InterPro: IPR006145 Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are []:   Pseudouridine synthase I, TruA. Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain. Pseudouridine synthase RsuA (ribosomal small subunit) and RluC/RluD (ribosomal large subunits), both of which contain an additional N-terminal alpha-L RNA-binding motif.  Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain.   This entry represents several different pseudouridine synthases from family 3, including: RsuA (acts on small ribosomal subunit), RluA, RluB, RluC, RluD, RluE and RluF (act on large ribosomal subunit).   RsuA from Escherichia coli catalyses formation of pseudouridine at position 516 in 16S rRNA during assembly of the 30S ribosomal subunit [, ]. RsuA consists of an N-terminal domain connected by an extended linker to the central and C-terminal domains. Uracil and UMP bind in a cleft between the central and C-terminal domains near the catalytic residue Asp 102. The N-terminal domain shows structural similarity to the ribosomal protein S4. Despite only 15% amino acid identity, the other two domains are structurally similar to those of the tRNA-specific psi-synthase TruA, including the position of the catalytic Asp. Our results suggest that all four families of pseudouridine synthases share the same fold of their catalytic domain(s) and uracil-binding site.  RluB, RluC, RluD, RluE and RluF are homologous enzymes which each convert specific uridine bases in E. coli ribosomal 23S RNA to pseudouridine:   RluB modifies uracil-2605. RluC modifies uracil-955, U-2504, and U-2580. RluD modifies uracil-1911, U-1915, and U-1917. RluE modifies uracil-3457. RluF modifies uracil-2604, and to a lesser extent U-2605.   RluD also possesses a second function related to proper assembly of the 50S ribosomal subunit that is independent of Psi-synthesis [, ]. Both RluC and RluD have an N-terminal S4 RNA binding domain. Despite the conserved topology shared by RluC and RluD, the surface shape and charge distribution are very different. ; GO: 0003723 RNA binding, 0009982 pseudouridine synthase activity, 0001522 pseudouridine synthesis, 0009451 RNA modification; PDB: 2GML_A 3DH3_B 1VIO_A 2I82_B 1XPI_B 1V9K_B 1PRZ_A 1V9F_A 2IST_A 1QYU_A ....
Probab=89.33  E-value=1.1  Score=24.03  Aligned_cols=29  Identities=17%  Similarity=0.276  Sum_probs=26.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.++.|.+.+...+.++.|.
T Consensus        53 Glll~a~~~~~~~~l~~~f~~~~~~K~Y~   81 (164)
T PF00849_consen   53 GLLLFAKDKEAAAKLSKQFPKRKVEKTYL   81 (164)
T ss_dssp             EEEEEESSHHHHHHHHHHHHTTCSEEEEE
T ss_pred             CCeeccCCcccccccccccccCCCcEEEE
Confidence            47999999999999999999999998885


No 93 
>KOG0347|consensus
Probab=89.32  E-value=0.5  Score=33.16  Aligned_cols=26  Identities=31%  Similarity=0.483  Sum_probs=23.4

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      |.++|||||.=+.+.+|+-.|+..+.
T Consensus       463 PGrTlVF~NsId~vKRLt~~L~~L~i  488 (731)
T KOG0347|consen  463 PGRTLVFCNSIDCVKRLTVLLNNLDI  488 (731)
T ss_pred             CCceEEEechHHHHHHHHHHHhhcCC
Confidence            57899999999999999999987764


No 94 
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=89.27  E-value=0.53  Score=33.21  Aligned_cols=23  Identities=9%  Similarity=0.137  Sum_probs=21.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .|++||||+++.++.+++.|++.
T Consensus       661 ~qv~if~n~i~~~e~l~~~L~~~  683 (926)
T TIGR00580       661 GQVFYVHNRIESIEKLATQLREL  683 (926)
T ss_pred             CeEEEEECCcHHHHHHHHHHHHh
Confidence            48999999999999999999985


No 95 
>cd02557 PseudoU_synth_ScRIB2 PseudoU_synth_ScRIB2_like: Pseudouridine synthase, Saccharomyces cerevisiae RIB2_like. This group is comprised of eukaryotic and bacterial proteins similar to Saccharomyces cerevisiae RIB2, S. cerevisiae Pus6p and human hRPUDSD2. S. cerevisiae RIB2 displays two distinct catalytic activities. The N-terminal domain of RIB2 is RNA:psi-synthase which makes psi32 on cytoplasmic tRNAs. Psi32 is highly phylogenetically conserved.   The C-terminal domain of RIB2 has a DRAP deaminase activity which catalyses the formation of 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione 5'-phosphate from 2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate during riboflavin biosynthesis. S. cerevisiae Pus6p makes the psi31 of cytoplasmic and mitochondrial tRNAs.
Probab=88.86  E-value=1.1  Score=25.99  Aligned_cols=29  Identities=21%  Similarity=0.368  Sum_probs=26.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|+|+++++-+.+|.+.+++...++.|.
T Consensus        72 Gllllak~~~~~~~l~~~f~~~~v~K~Y~  100 (213)
T cd02557          72 GLLLFAKTSQTASRLQQQIRSREVKKEYL  100 (213)
T ss_pred             eEEEEECCHHHHHHHHHHHHcCCccEEEE
Confidence            47999999999999999999999999885


No 96 
>TIGR01621 RluA-like pseudouridine synthase Rlu family protein, TIGR01621. This model represents a clade of sequences within the pseudouridine synthase superfamily (pfam00849). The superfamily includes E. coli proteins: RluA, RluB, RluC, RluD, and RsuA. The sequences modeled here are most closely related to RluA. Neisseria, among those species hitting this model, does not appear to have an RluA homolog. It is presumed that these sequences function as pseudouridine synthases, although perhaps with different specificity.
Probab=88.12  E-value=1.1  Score=26.21  Aligned_cols=29  Identities=10%  Similarity=0.114  Sum_probs=26.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.+..|.+.+++...++.|.
T Consensus        56 Glll~Ak~~~~~~~L~~~~~~~~v~K~Yl   84 (217)
T TIGR01621        56 GILLLALNAESASELSQGFAKRKIEKTYL   84 (217)
T ss_pred             eEEEEEcCHHHHHHHHHHHhcCCccEEEE
Confidence            47999999999999999999999998885


No 97 
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily. This CD includes the putative rhodanese-like protein, Psp2, of Yersinia pestis biovar Medievalis and other similar uncharacterized proteins.
Probab=87.86  E-value=1.8  Score=22.23  Aligned_cols=30  Identities=7%  Similarity=0.124  Sum_probs=23.7

Q ss_pred             ceEEEEecch--hhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTK--LDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK--~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+||+|++-  ..+..++..|++.|.. .|++
T Consensus        65 ~~vvvyc~~g~~~~s~~~a~~l~~~G~~-v~~l   96 (110)
T cd01521          65 KLFVVYCDGPGCNGATKAALKLAELGFP-VKEM   96 (110)
T ss_pred             CeEEEEECCCCCchHHHHHHHHHHcCCe-EEEe
Confidence            3578999876  4789999999999996 5543


No 98 
>PF08544 GHMP_kinases_C:  GHMP kinases C terminal ;  InterPro: IPR013750 This domain is found in homoserine kinases (2.7.1.39 from EC), galactokinases (2.7.1.6 from EC) and mevalonate kinases (2.7.1.36 from EC). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes []. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [].; PDB: 2R3V_C 4EMD_A 4DXL_A 4ED4_A 2GS8_A 1K47_E 3GON_A 3K17_B 1PIE_A 2AJ4_A ....
Probab=87.71  E-value=1.5  Score=21.14  Aligned_cols=23  Identities=13%  Similarity=0.323  Sum_probs=20.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++++|.++.+++++.+.|++.+
T Consensus        61 ~v~~l~~~~~~~~~v~~~l~~~~   83 (85)
T PF08544_consen   61 TVFALCKDEDDAERVAEALREHY   83 (85)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHHT
T ss_pred             eEEEEECCHHHHHHHHHHHHHhC
Confidence            47889999999999999998865


No 99 
>cd02869 PseudoU_synth_RluCD_like PseudoU_synth_RsuA/RluD: Pseudouridine synthase, RsuA/RluD family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and TruA.  Pseudouridine synthases catalyze the isomerization of specific uridines in a n RNA molecule to pseudouridines (5-ribosyluracil, psi) requiring no cofactors.  E. coli RluC for example makes psi955, 2504 and 2580 in 23S RNA.  Some psi sites such as psi1917 in 23S RNA made by RluD are universally conserved.  Other psi sites occur in a more restricted fashion, for example psi2819 in 21S mitochondrial ribosomal RNA made by S. cerevisiae Pus5p is only found in mitochondrial large subunit rRNAs from some other species and in gram negative bacteria. The E. coli counterpart of this psi residue is psi2580 in 23S rRNA.  psi2604in 23S RNA made by RluF has only been detected in E.coli.
Probab=87.69  E-value=1.3  Score=24.17  Aligned_cols=30  Identities=13%  Similarity=0.255  Sum_probs=26.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +-+|+|+++++.+..+.+.+++....+.|.
T Consensus        51 sGlll~ak~~~~~~~l~~~~~~~~~~K~Y~   80 (185)
T cd02869          51 SGLLLVAKNKKAAAKLSKQFKERKVKKTYL   80 (185)
T ss_pred             ceEEEEEcCHHHHHHHHHHHhcCceeEEEE
Confidence            357999999999999999999988888885


No 100
>PF02863 Arg_repressor_C:  Arginine repressor, C-terminal domain;  InterPro: IPR020899 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes, an example of the latter being Giardia lamblia (Giardia intestinalis) []. The three-enzyme anaerobic pathway breaks down L-arginine to form 1 mol of ATP, carbon dioxide and ammonia. In simpler bacteria, the first enzyme, arginine deiminase, can account for up to 10% of total cell protein []. Most prokaryotic arginine deiminase pathways are under the control of a repressor gene, termed ArgR []. This is a negative regulator, and will only release the arginine deiminase operon for expression in the presence of arginine []. The crystal structure of apo-ArgR from Bacillus stearothermophilus has been determined to 2.5A by means of X-ray crystallography []. The protein exists as a hexamer of identical subunits, and is shown to have six DNA-binding domains, clustered around a central oligomeric core when bound to arginine. It predominantly interacts with A.T residues in ARG boxes. This hexameric protein binds DNA at its N terminus to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbour-joining tree, some of these paralogous sequences show long branches and differ significantly from the well-conserved C-terminal region. ; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 1B4B_B 1B4A_A 3V4G_A 1F9N_F 2P5M_A 1XXA_E 1XXC_C 1XXB_F 3LAJ_D 3BUE_D ....
Probab=87.46  E-value=1.2  Score=22.16  Aligned_cols=22  Identities=36%  Similarity=0.721  Sum_probs=19.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      +.++|.|++.++++++.++|++
T Consensus        48 DTilvi~~~~~~a~~l~~~l~~   69 (70)
T PF02863_consen   48 DTILVICRSEEDAEELEEKLKE   69 (70)
T ss_dssp             SEEEEEESTTSHHHHHHHHHHT
T ss_pred             CEEEEEeCCHHHHHHHHHHHHh
Confidence            4689999999999999999975


No 101
>PRK10158 23S rRNA/tRNA pseudouridine synthase A; Provisional
Probab=87.38  E-value=1.6  Score=25.48  Aligned_cols=29  Identities=17%  Similarity=0.240  Sum_probs=26.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+.|++.+..+.+.+++....+.|.
T Consensus        69 Glll~Akt~~~~~~l~~~f~~~~v~K~Yl   97 (219)
T PRK10158         69 GVIVVALTKAAERELKRQFREREPKKQYV   97 (219)
T ss_pred             eEEEEECCHHHHHHHHHHHHhCCccEEEE
Confidence            47899999999999999999988888885


No 102
>PRK11112 tRNA pseudouridine synthase C; Provisional
Probab=87.20  E-value=1.6  Score=26.11  Aligned_cols=29  Identities=10%  Similarity=0.077  Sum_probs=26.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.+..|.+.+++....+.|.
T Consensus        59 Glll~Ak~~~~~~~L~~~f~~~~v~K~Y~   87 (257)
T PRK11112         59 GVLLMALSSEVARLLAQQFEQHQIQKTYH   87 (257)
T ss_pred             eEEEEECCHHHHHHHHHHHHhCCcceEEE
Confidence            47999999999999999999999999885


No 103
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=86.84  E-value=1.2  Score=31.14  Aligned_cols=30  Identities=27%  Similarity=0.481  Sum_probs=27.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++||=+-||.-|+.|+++|...|....|-
T Consensus       447 eRvLVTtLTKkmAEdLT~Yl~e~gikv~Yl  476 (663)
T COG0556         447 ERVLVTTLTKKMAEDLTEYLKELGIKVRYL  476 (663)
T ss_pred             CeEEEEeehHHHHHHHHHHHHhcCceEEee
Confidence            589999999999999999999999988874


No 104
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue.
Probab=86.60  E-value=1.9  Score=21.90  Aligned_cols=29  Identities=7%  Similarity=-0.070  Sum_probs=24.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce-eee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL-IYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~-~~~   31 (33)
                      ..+|+|++-..+...+..|++.|... .|+
T Consensus        68 ~ivv~C~~G~rs~~a~~~L~~~G~~~~v~~   97 (109)
T cd01533          68 PIVVNCAGRTRSIIGAQSLINAGLPNPVAA   97 (109)
T ss_pred             eEEEECCCCchHHHHHHHHHHCCCCcceeE
Confidence            57999999888888999999999864 554


No 105
>KOG4284|consensus
Probab=86.35  E-value=0.18  Score=36.11  Aligned_cols=27  Identities=22%  Similarity=0.360  Sum_probs=24.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .||||||+.--.|+.++..|...|..-
T Consensus       273 ~QAlVF~~~~sra~~~a~~L~ssG~d~  299 (980)
T KOG4284|consen  273 VQALVFCDQISRAEPIATHLKSSGLDV  299 (980)
T ss_pred             HHHHhhhhhhhhhhHHHHHhhccCCCe
Confidence            589999999999999999999998754


No 106
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional
Probab=85.54  E-value=2.8  Score=22.20  Aligned_cols=28  Identities=7%  Similarity=0.199  Sum_probs=24.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      ..|++|++-..+...+..|.+.|....+
T Consensus        62 ~IVlyC~~G~rS~~aa~~L~~~G~~~v~   89 (104)
T PRK10287         62 TVKLYCNAGRQSGQAKEILSEMGYTHAE   89 (104)
T ss_pred             eEEEEeCCChHHHHHHHHHHHcCCCeEE
Confidence            4799999999999999999999987554


No 107
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1. This CD includes the putative rhodanese-related sulfurtransferases of several uncharacterized proteins.
Probab=85.22  E-value=2.1  Score=22.36  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=24.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .+||+|++-..+...+..|++.|....+
T Consensus        66 ~ivv~C~~G~rs~~aa~~L~~~G~~~v~   93 (117)
T cd01522          66 PVLLLCRSGNRSIAAAEAAAQAGFTNVY   93 (117)
T ss_pred             eEEEEcCCCccHHHHHHHHHHCCCCeEE
Confidence            5789999989999999999999987665


No 108
>cd02563 PseudoU_synth_TruC tRNA pseudouridine isomerase C: Pseudouridine synthases catalyze the isomerization of specific uridines in an tRNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. TruC makes psi65 in tRNAs.  This psi residue is not universally conserved.
Probab=85.13  E-value=1.7  Score=25.27  Aligned_cols=29  Identities=14%  Similarity=0.162  Sum_probs=26.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.+..|.+.+++...++.|-
T Consensus        58 Glll~Ak~~~~~~~l~~~f~~~~v~K~Y~   86 (223)
T cd02563          58 GVLLFALSSEVARKLGEQFTEHRVHKTYL   86 (223)
T ss_pred             EEEEEEECHHHHHHHHHHHhcCceeEEEE
Confidence            47999999999999999999988888874


No 109
>KOG0950|consensus
Probab=84.66  E-value=0.89  Score=33.04  Aligned_cols=21  Identities=29%  Similarity=0.819  Sum_probs=18.4

Q ss_pred             eEEEEecchhhHHHHHHHHHh
Q psy8719           3 RALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~   23 (33)
                      ++||||..|..|+.+|..+..
T Consensus       462 ~~lvfc~sk~~ce~~a~~~~~  482 (1008)
T KOG0950|consen  462 SVLVFCPSKKNCENVASLIAK  482 (1008)
T ss_pred             eEEEEcCcccchHHHHHHHHH
Confidence            699999999999999976644


No 110
>cd02558 PSRA_1 PSRA_1: Pseudouridine synthase, a subgroup of the RluA family. This group is comprised of bacterial proteins assigned to the RluA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. The RluA family is comprised of proteins related to Escherichia coli RluA.
Probab=83.89  E-value=2.8  Score=24.93  Aligned_cols=29  Identities=7%  Similarity=0.114  Sum_probs=26.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.+..+...+++....+.|.
T Consensus        95 Glll~Ak~~~~~~~l~~~~~~~~v~K~Yl  123 (246)
T cd02558          95 GLVLFSKRPETRGAYQTLFARREVSKTYE  123 (246)
T ss_pred             eEEEEEcCHHHHHHHHHHHHcCCccEEEE
Confidence            47999999999999999999988888885


No 111
>KOG0334|consensus
Probab=83.59  E-value=1.5  Score=31.85  Aligned_cols=25  Identities=24%  Similarity=0.355  Sum_probs=22.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||||...+.||.+.+.|.+.|.
T Consensus       614 ~~tiiFv~~qe~~d~l~~~L~~ag~  638 (997)
T KOG0334|consen  614 GKTIIFVDKQEKADALLRDLQKAGY  638 (997)
T ss_pred             CCEEEEEcCchHHHHHHHHHHhcCc
Confidence            4789999999999999999998874


No 112
>KOG0353|consensus
Probab=83.02  E-value=1.2  Score=30.62  Aligned_cols=27  Identities=19%  Similarity=0.555  Sum_probs=24.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++.||+|-.+.+|+.|+..|+.+|..-
T Consensus       318 qsgiiyc~sq~d~ekva~alkn~gi~a  344 (695)
T KOG0353|consen  318 QSGIIYCFSQKDCEKVAKALKNHGIHA  344 (695)
T ss_pred             CcceEEEeccccHHHHHHHHHhcCccc
Confidence            468999999999999999999999653


No 113
>PRK05752 uroporphyrinogen-III synthase; Validated
Probab=82.72  E-value=2.3  Score=24.88  Aligned_cols=27  Identities=19%  Similarity=0.206  Sum_probs=24.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .-|+.+|.+.+++++++.|++.|.+-.
T Consensus         4 ~~vlvTRp~~~~~~l~~~l~~~G~~~~   30 (255)
T PRK05752          4 WRLLLTRPAEECAALAASLAEAGIFSS   30 (255)
T ss_pred             CEEEECCcHHHHHHHHHHHHHcCCCEE
Confidence            468899999999999999999998753


No 114
>PRK09271 flavodoxin; Provisional
Probab=82.49  E-value=3.6  Score=22.69  Aligned_cols=27  Identities=11%  Similarity=0.156  Sum_probs=21.6

Q ss_pred             ceEEEEe----cchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFC----RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~----nTK~~ad~La~~L~~~G~~~   28 (33)
                      +-+|||.    ||+.-|+.|++.|+..|.+.
T Consensus         2 kv~IvY~S~tGnTe~~A~~ia~~l~~~g~~v   32 (160)
T PRK09271          2 RILLAYASLSGNTREVAREIEERCEEAGHEV   32 (160)
T ss_pred             eEEEEEEcCCchHHHHHHHHHHHHHhCCCee
Confidence            3456665    88999999999999988764


No 115
>PRK11025 23S rRNA pseudouridylate synthase C; Provisional
Probab=82.39  E-value=3.4  Score=25.36  Aligned_cols=29  Identities=14%  Similarity=0.186  Sum_probs=26.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||++++..+..+.+.+++...++.|.
T Consensus       149 Glll~Ak~~~a~~~l~~~~~~~~v~K~Y~  177 (317)
T PRK11025        149 GVLLVAKKRSALRSLHEQLREKGMQKDYL  177 (317)
T ss_pred             eEEEEEcCHHHHHHHHHHHHhCCccEEEE
Confidence            47999999999999999999988999885


No 116
>PRK11180 rluD 23S rRNA pseudouridine synthase D; Provisional
Probab=82.28  E-value=3.4  Score=25.39  Aligned_cols=29  Identities=14%  Similarity=0.072  Sum_probs=26.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||++++..+..+.+.+.+...++.|.
T Consensus       144 Glll~Ak~~~~~~~l~~~~~~~~v~K~Y~  172 (325)
T PRK11180        144 GLMVVAKTVPAQTRLVEALQKREITREYE  172 (325)
T ss_pred             eeEEEECCHHHHHHHHHHHHhCCcceEEE
Confidence            47999999999999999999999999885


No 117
>PRK08811 uroporphyrinogen-III synthase; Validated
Probab=82.26  E-value=2.7  Score=25.31  Aligned_cols=27  Identities=26%  Similarity=0.249  Sum_probs=24.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      +-|+.+|.+++++.+++.|++.|.+-.
T Consensus        19 ~~IlvTRp~~q~~~l~~~L~~~G~~~~   45 (266)
T PRK08811         19 WTLISLRPSGEHAPLRRAVARHGGRLL   45 (266)
T ss_pred             CEEEEeCCHHHHHHHHHHHHHCCCcEE
Confidence            468899999999999999999998753


No 118
>KOG0338|consensus
Probab=82.25  E-value=1.7  Score=30.48  Aligned_cols=24  Identities=33%  Similarity=0.563  Sum_probs=19.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      +++|||++||.+|.++--.|--.|
T Consensus       427 ~~~ivFv~tKk~AHRl~IllGLlg  450 (691)
T KOG0338|consen  427 DRTIVFVRTKKQAHRLRILLGLLG  450 (691)
T ss_pred             cceEEEEehHHHHHHHHHHHHHhh
Confidence            579999999999999876664443


No 119
>TIGR00005 rluA_subfam pseudouridine synthase, RluA family. modifies uracil-65 in transfer RNAs to pseudouridine.
Probab=82.13  E-value=3.6  Score=24.58  Aligned_cols=29  Identities=21%  Similarity=0.270  Sum_probs=26.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -+|||+++++.+..+.+.+.+....+.|.
T Consensus       132 Glll~ak~~~~~~~l~~~~~~~~v~K~Y~  160 (299)
T TIGR00005       132 GLMVVAKTPLALRELQRQLKNRTVTKEYV  160 (299)
T ss_pred             eEEEEEcCHHHHHHHHHHHHhCCcceEEE
Confidence            47999999999999999999998998886


No 120
>PLN02160 thiosulfate sulfurtransferase
Probab=81.78  E-value=3.9  Score=22.28  Aligned_cols=29  Identities=10%  Similarity=0.075  Sum_probs=25.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      ..|++|++=..+...+..|.+.|....|.
T Consensus        83 ~IivyC~sG~RS~~Aa~~L~~~G~~~v~~  111 (136)
T PLN02160         83 DILVGCQSGARSLKATTELVAAGYKKVRN  111 (136)
T ss_pred             cEEEECCCcHHHHHHHHHHHHcCCCCeee
Confidence            57999999999999999999999876654


No 121
>COG0564 RluA Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]
Probab=81.68  E-value=3.5  Score=25.44  Aligned_cols=30  Identities=10%  Similarity=0.217  Sum_probs=27.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +-+|||+.|+.....|.+.+++....+.|+
T Consensus       135 SGlll~AK~~~a~~~l~~~f~~r~v~K~Y~  164 (289)
T COG0564         135 SGLLLVAKNREAARELSEQFKQRKVKKTYL  164 (289)
T ss_pred             ceEEEEECCHHHHHHHHHHHhcCcCcEEEE
Confidence            357999999999999999999998899887


No 122
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative. This model represents a family of proteins found immediately downstream of ribonucleotide reductase genes in Xyella fastidiosa and some Gram-positive bacteria. It appears to be a highly divergent flavodoxin of the short chain type, more like the flavodoxins of the sulfate-reducing genus Desulfovibrio than like the NifF flavodoxins associated with nitrogen fixation.
Probab=81.18  E-value=2.7  Score=22.54  Aligned_cols=27  Identities=19%  Similarity=0.167  Sum_probs=20.8

Q ss_pred             CceEEEEe----cchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFC----RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~----nTK~~ad~La~~L~~~G~~   27 (33)
                      |.-.|||.    ||+.-|+.|++.|...|..
T Consensus         1 M~i~IiY~S~tGnTe~iA~~ia~~l~~~g~~   31 (140)
T TIGR01754         1 MRILLAYLSLSGNTEEVAFMIQDYLQKDGHE   31 (140)
T ss_pred             CeEEEEEECCCChHHHHHHHHHHHHhhCCee
Confidence            34467776    7888899999999887765


No 123
>TIGR00603 rad25 DNA repair helicase rad25. All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=80.14  E-value=2.1  Score=29.95  Aligned_cols=21  Identities=14%  Similarity=0.312  Sum_probs=19.0

Q ss_pred             ceEEEEecchhhHHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~   22 (33)
                      +++||||++...++.+++.|.
T Consensus       497 ~kiLVF~~~~~~l~~~a~~L~  517 (732)
T TIGR00603       497 DKIIVFSDNVFALKEYAIKLG  517 (732)
T ss_pred             CeEEEEeCCHHHHHHHHHHcC
Confidence            589999999999999999883


No 124
>KOG0336|consensus
Probab=80.07  E-value=1.1  Score=30.90  Aligned_cols=25  Identities=24%  Similarity=0.324  Sum_probs=21.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      +++||||..|..||.|...|.-.|.
T Consensus       466 dKvIiFv~~K~~AD~LSSd~~l~gi  490 (629)
T KOG0336|consen  466 DKVIIFVSRKVMADHLSSDFCLKGI  490 (629)
T ss_pred             ceEEEEEechhhhhhccchhhhccc
Confidence            4789999999999999988865553


No 125
>PRK13617 psbV cytochrome c-550; Provisional
Probab=79.69  E-value=2.1  Score=25.35  Aligned_cols=23  Identities=17%  Similarity=0.239  Sum_probs=19.4

Q ss_pred             cchhhHHHHHHHHHhc--------CCceeee
Q psy8719           9 RTKLDCDNLERYLNSI--------DRRLIYY   31 (33)
Q Consensus         9 nTK~~ad~La~~L~~~--------G~~~~~~   31 (33)
                      -|.++.+.|+.+|..+        |++++||
T Consensus       140 LsdeeL~alAayLl~~~k~~~~~wgggk~y~  170 (170)
T PRK13617        140 LNDEDLRLMAGYILVAPKVQGTQWGGGKIYF  170 (170)
T ss_pred             CCHHHHHHHHHHHHhcccccccccCCceecC
Confidence            4678999999999776        8889987


No 126
>COG3865 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.68  E-value=3.3  Score=24.37  Aligned_cols=25  Identities=16%  Similarity=0.177  Sum_probs=22.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +-.|+|.+.++.|++.+.|...|++
T Consensus        80 S~~v~~~~q~E~Drlwnal~~~g~e  104 (151)
T COG3865          80 SFQVACDDQEEIDRLWNALSDNGGE  104 (151)
T ss_pred             EEEEEcCCHHHHHHHHHHHhccCcc
Confidence            5689999999999999999999964


No 127
>PF00581 Rhodanese:  Rhodanese-like domain This Prosite entry represents a subset of this family.;  InterPro: IPR001763 Rhodanese, a sulphurtransferase involved in cyanide detoxification (see IPR001307 from INTERPRO) shares evolutionary relationship with a large family of proteins [], including  Cdc25 phosphatase catalytic domain. non-catalytic domains of eukaryotic dual-specificity MAPK-phosphatases. non-catalytic domains of yeast PTP-type MAPK-phosphatases. non-catalytic domains of yeast Ubp4, Ubp5, Ubp7. non-catalytic domains of mammalian Ubp-Y. Drosophila heat shock protein HSP-67BB. several bacterial cold-shock and phage shock proteins. plant senescence associated proteins. catalytic and non-catalytic domains of rhodanese (see IPR001307 from INTERPRO).   Rhodanese has an internal duplication. This domain is found as a single copy in other proteins, including phosphatases and ubiquitin C-terminal hydrolases [].; PDB: 2J6P_D 2FSX_A 1UAR_A 1OKG_A 1GMX_A 1GN0_A 3NTD_B 3NTA_B 3NT6_A 1C25_A ....
Probab=79.62  E-value=5.7  Score=19.39  Aligned_cols=29  Identities=10%  Similarity=0.336  Sum_probs=21.8

Q ss_pred             eEEEEecchhhHHHHHHH-----HHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERY-----LNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~-----L~~~G~~~~~~   31 (33)
                      .+|++|++-......+..     |.+.|....+.
T Consensus        69 ~iv~yc~~~~~~~~~~~~~~~~~l~~~g~~~v~~  102 (113)
T PF00581_consen   69 DIVFYCSSGWRSGSAAAARVAWILKKLGFKNVYI  102 (113)
T ss_dssp             EEEEEESSSCHHHHHHHHHHHHHHHHTTTSSEEE
T ss_pred             cceeeeecccccchhHHHHHHHHHHHcCCCCEEE
Confidence            578889777777777776     88888866554


No 128
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease.
Probab=79.55  E-value=3.3  Score=22.81  Aligned_cols=26  Identities=15%  Similarity=0.391  Sum_probs=22.6

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      |++++.+...+.+.+.|++.|....+
T Consensus         1 iLi~r~~~~~~~l~~~L~~~G~~~~~   26 (239)
T cd06578           1 VLVTRPRPQADELAALLEALGAEVLE   26 (239)
T ss_pred             CEecCchHHhHHHHHHHHHcCCcEEE
Confidence            56788899999999999999998654


No 129
>KOG0341|consensus
Probab=79.31  E-value=2.1  Score=29.41  Aligned_cols=25  Identities=32%  Similarity=0.474  Sum_probs=22.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .+||||-.|.++|.+.++|--.|.+
T Consensus       423 pVLIFaEkK~DVD~IhEYLLlKGVE  447 (610)
T KOG0341|consen  423 PVLIFAEKKADVDDIHEYLLLKGVE  447 (610)
T ss_pred             ceEEEeccccChHHHHHHHHHccce
Confidence            5899999999999999999877654


No 130
>KOG0952|consensus
Probab=79.31  E-value=2.1  Score=31.81  Aligned_cols=24  Identities=13%  Similarity=0.248  Sum_probs=21.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .|++|||.++.++-+.|+.|.+.+
T Consensus       350 ~qVlvFvhsR~~Ti~tA~~l~~~a  373 (1230)
T KOG0952|consen  350 HQVLVFVHSRNETIRTAKKLRERA  373 (1230)
T ss_pred             CeEEEEEecChHHHHHHHHHHHHH
Confidence            489999999999999999997754


No 131
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein. Members of this protein family have a CXXXCW motif, consistent with a possible role in redox cofactor binding. This protein family shows strong relationships by phylogenetic profiling and conserved gene neighborhoods with a transport system for alcohols metabolized by PQQ-dependent enzymes.
Probab=78.46  E-value=6.4  Score=22.09  Aligned_cols=31  Identities=10%  Similarity=0.230  Sum_probs=24.9

Q ss_pred             ceEEEEecchh-hHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKL-DCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~-~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+|++|++-. .+...+..|++.|....|.+
T Consensus       117 ~~IVvYC~~G~~~S~~aa~~L~~~G~~~V~~l  148 (162)
T TIGR03865       117 RPLVFYCLADCWMSWNAAKRALAYGYSNVYWY  148 (162)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHhcCCcceEEe
Confidence            36799999864 67788999999999877654


No 132
>PF06983 3-dmu-9_3-mt:  3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A.
Probab=78.39  E-value=5.2  Score=21.42  Aligned_cols=27  Identities=15%  Similarity=0.134  Sum_probs=22.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      +..|-|.+.++++++.+.|.+.|...+
T Consensus        74 sl~i~~~~~ee~~~~f~~Ls~gG~~~~  100 (116)
T PF06983_consen   74 SLCIECDDEEEIDRIFDKLSEGGQWFS  100 (116)
T ss_dssp             EEEEEESSHHHHHHHHHHHHTTTETCC
T ss_pred             EEEEEcCCHHHHHHHHHHHHcCCCccc
Confidence            457889999999999999999986433


No 133
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed
Probab=78.32  E-value=5.8  Score=22.16  Aligned_cols=27  Identities=11%  Similarity=0.201  Sum_probs=23.4

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      -|+.++.+...+.+++.|++.|.+...
T Consensus         3 ~ilitr~~~~~~~l~~~l~~~G~~v~~   29 (249)
T PRK05928          3 KILVTRPSPKAEELVELLRELGFVALH   29 (249)
T ss_pred             EEEEeCCHHHHHHHHHHHHHcCCCEEE
Confidence            377889999999999999999987654


No 134
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]
Probab=78.00  E-value=2.9  Score=26.77  Aligned_cols=25  Identities=16%  Similarity=0.248  Sum_probs=22.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||||..+.+++.++..+...|.
T Consensus       284 ~~~lif~~~~~~a~~i~~~~~~~~~  308 (442)
T COG1061         284 DKTLIFASDVEHAYEIAKLFLAPGI  308 (442)
T ss_pred             CcEEEEeccHHHHHHHHHHhcCCCc
Confidence            4799999999999999999987765


No 135
>PRK09189 uroporphyrinogen-III synthase; Validated
Probab=77.60  E-value=4.7  Score=23.20  Aligned_cols=27  Identities=7%  Similarity=0.207  Sum_probs=23.5

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      -|+.++.+.+++.+++.|+++|.+-..
T Consensus         2 ~VLvTRp~~~~~~l~~~L~~~G~~~~~   28 (240)
T PRK09189          2 RVLVTRPEPAAERTAARLRAMGHEPVL   28 (240)
T ss_pred             eEEEECCCCchHHHHHHHHHCCCceEE
Confidence            378899999999999999999987653


No 136
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE. Members of this very narrowly defined protein family are proteins active as rhodanese (EC 2.8.1.1) and found in the extended variants of the phage shock protein (psp operon) in Escherichia coli and a few closely related species. Note that the designation phage shock protein PspE has been applied, incorrectly, in many instances where the genome lacks the phage shock regulon entirely.
Probab=77.19  E-value=8.3  Score=20.15  Aligned_cols=27  Identities=7%  Similarity=0.151  Sum_probs=23.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..++.|++=..+...+..|.+.|..-.
T Consensus        60 ~vvlyC~~G~rS~~aa~~L~~~G~~~v   86 (101)
T TIGR02981        60 TVKLYCNAGRQSGMAKDILLDMGYTHA   86 (101)
T ss_pred             eEEEEeCCCHHHHHHHHHHHHcCCCeE
Confidence            467889999999999999999997644


No 137
>PRK05320 rhodanese superfamily protein; Provisional
Probab=77.07  E-value=6.5  Score=23.83  Aligned_cols=29  Identities=14%  Similarity=0.439  Sum_probs=25.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      ..+++|..=.+|...+..|++.|..-.|+
T Consensus       177 ~IvvyC~~G~Rs~~Aa~~L~~~Gf~~V~~  205 (257)
T PRK05320        177 TVVSFCTGGIRCEKAAIHMQEVGIDNVYQ  205 (257)
T ss_pred             eEEEECCCCHHHHHHHHHHHHcCCcceEE
Confidence            57999999999999999999999876665


No 138
>PRK00162 glpE thiosulfate sulfurtransferase; Validated
Probab=77.07  E-value=6.1  Score=19.99  Aligned_cols=30  Identities=13%  Similarity=0.331  Sum_probs=24.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+|.|+.-..+...+..|++.|..-.|++
T Consensus        60 ~ivv~c~~g~~s~~a~~~L~~~G~~~v~~l   89 (108)
T PRK00162         60 PVMVMCYHGNSSQGAAQYLLQQGFDVVYSI   89 (108)
T ss_pred             CEEEEeCCCCCHHHHHHHHHHCCchheEEe
Confidence            467789988889999999999998766543


No 139
>PF13361 UvrD_C:  UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A ....
Probab=77.00  E-value=6.9  Score=22.37  Aligned_cols=27  Identities=15%  Similarity=0.191  Sum_probs=22.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +..-|-|+++.++..+++.|.+.|...
T Consensus        78 ~diAVL~R~~~~~~~i~~~L~~~gIp~  104 (351)
T PF13361_consen   78 SDIAVLVRTNSQIKEIEDALKEAGIPY  104 (351)
T ss_dssp             GGEEEEESSGGHHHHHHHHHHHTTS-E
T ss_pred             ccEEEEEECchhHHHHHHHHhhhccee
Confidence            456788999999999999999999873


No 140
>cd02550 PseudoU_synth_Rsu_Rlu_like PseudoU_synth_Rsu_Rlu: Pseudouridine synthase, Rsu/Rlu family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and TruA. Pseudouridine synthases catalyze the isomerization of specific uridines in a n RNA molecule to pseudouridines (5-ribosyluracil, psi) requiring no cofactors.  E. coli RluC for example makes psi955, 2504 and 2580 in 23S RNA.  Some psi sites such as psi1917 in 23S RNA made by RluD are universally conserved.  Other psi sites occur in a more restricted fashion, for example psi2819 in 21S mitochondrial ribosomal RNA made by S. cerevisiae Pus5p is only found in mitochondrial large subunit rRNAs from some other species and in gram negative bacteria. The E. coli counterpart of this psi residue is psi2580 in 23S rRNA.  psi2604in 23S RNA made by RluF has only been detected in E.coli.
Probab=76.69  E-value=5.5  Score=21.73  Aligned_cols=27  Identities=11%  Similarity=-0.010  Sum_probs=22.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++-+.+|.+.  +...++.|.
T Consensus        47 Glll~ak~~~~~~~l~~~--~~~v~K~Y~   73 (154)
T cd02550          47 GLLLLTNDGRLQRRLTEP--RREIEKEYL   73 (154)
T ss_pred             eEEEEEcCHHHHHHHhhh--hccCcEEEE
Confidence            478999999999999988  666777775


No 141
>KOG0346|consensus
Probab=75.76  E-value=3.6  Score=28.39  Aligned_cols=26  Identities=27%  Similarity=0.499  Sum_probs=23.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++.|||+||=+.|=+|-=+|++.|..
T Consensus       269 gKsliFVNtIdr~YrLkLfLeqFGik  294 (569)
T KOG0346|consen  269 GKSLIFVNTIDRCYRLKLFLEQFGIK  294 (569)
T ss_pred             CceEEEEechhhhHHHHHHHHHhCcH
Confidence            47899999999999999999998864


No 142
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=75.64  E-value=5.7  Score=29.60  Aligned_cols=27  Identities=26%  Similarity=0.348  Sum_probs=24.0

Q ss_pred             eEEEEecc---hhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRT---KLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nT---K~~ad~La~~L~~~G~~~~   29 (33)
                      -.|||+.+   ++-+++|+++|+.+|..-.
T Consensus       337 GgLIfV~~d~G~e~aeel~e~Lr~~Gi~a~  366 (1187)
T COG1110         337 GGLIFVPIDYGREKAEELAEYLRSHGINAE  366 (1187)
T ss_pred             CeEEEEEcHHhHHHHHHHHHHHHhcCceEE
Confidence            47999999   9999999999999997643


No 143
>COG5566 Uncharacterized conserved protein [Function unknown]
Probab=75.43  E-value=3.5  Score=23.98  Aligned_cols=25  Identities=16%  Similarity=0.010  Sum_probs=22.0

Q ss_pred             cchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           9 RTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      +-|..|..++-.|-+.++|.+|||.
T Consensus        58 ~gk~~alk~v~~l~~y~GGrsfYlP   82 (137)
T COG5566          58 NGKPLALKLVFKLMEYGGGRSFYLP   82 (137)
T ss_pred             ccCchHHHHHHHHHHHcCCeeEEee
Confidence            4477899999999999999999983


No 144
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 4th repeat which, in general, contains the putative catalytic Cys residue.
Probab=75.00  E-value=9.4  Score=20.99  Aligned_cols=29  Identities=14%  Similarity=0.261  Sum_probs=25.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .+||.|..-..+..++..|.+.|....+.
T Consensus        51 ~vVv~c~~g~~a~~aa~~L~~~G~~~v~~   79 (145)
T cd01535          51 RYVLTCGSSLLARFAAADLAALTVKPVFV   79 (145)
T ss_pred             CEEEEeCCChHHHHHHHHHHHcCCcCeEE
Confidence            58899999999999999999999876654


No 145
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=74.90  E-value=3.2  Score=24.30  Aligned_cols=22  Identities=23%  Similarity=0.173  Sum_probs=18.6

Q ss_pred             chhhHHHHHHHHHhc--------CCceeee
Q psy8719          10 TKLDCDNLERYLNSI--------DRRLIYY   31 (33)
Q Consensus        10 TK~~ad~La~~L~~~--------G~~~~~~   31 (33)
                      |-++.+.|+.++-.+        |++++||
T Consensus       134 sdeEL~aVAaYIl~q~~~~~~~wgggk~y~  163 (163)
T CHL00133        134 TDEDLYAIAGHILLQPKIVSEKWGGGKIYY  163 (163)
T ss_pred             CHHHHHHHHHHHHhcccccccccCCCcccC
Confidence            567889999998766        8899987


No 146
>PF13245 AAA_19:  Part of AAA domain
Probab=74.18  E-value=6  Score=19.80  Aligned_cols=20  Identities=30%  Similarity=0.514  Sum_probs=18.7

Q ss_pred             ceEEEEecchhhHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYL   21 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L   21 (33)
                      ++++|-+.|+..+++|.+.|
T Consensus        43 ~~vlv~a~t~~aa~~l~~rl   62 (76)
T PF13245_consen   43 KRVLVLAPTRAAADELRERL   62 (76)
T ss_pred             CeEEEECCCHHHHHHHHHHH
Confidence            57899999999999999999


No 147
>PF02006 DUF137:  Protein of unknown function DUF137;  InterPro: IPR002855 The archaeal proteins in this family have no known function.
Probab=74.16  E-value=3.5  Score=24.83  Aligned_cols=23  Identities=17%  Similarity=0.302  Sum_probs=21.0

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|-+|.+..+.+++.|+++|..-
T Consensus        38 LFyRT~eR~~~I~~~L~~~Ga~~   60 (178)
T PF02006_consen   38 LFYRTEERVEKIAELLREHGAEE   60 (178)
T ss_pred             cccCCHHHHHHHHHHHHHcCCCE
Confidence            69999999999999999999764


No 148
>KOG1919|consensus
Probab=73.72  E-value=5.4  Score=25.92  Aligned_cols=28  Identities=21%  Similarity=0.312  Sum_probs=25.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      -.+||.+|++.++.+.+.|++.-..+.|
T Consensus       162 GllvlAkt~~~~~~~~~~~r~~~~~k~Y  189 (371)
T KOG1919|consen  162 GLLVLAKTKEAADKFHEVLRKRTVKKEY  189 (371)
T ss_pred             ceEEEEechhHhHHHHHHHhcccceeEE
Confidence            4689999999999999999988777777


No 149
>PRK01415 hypothetical protein; Validated
Probab=73.41  E-value=7.8  Score=23.74  Aligned_cols=30  Identities=20%  Similarity=0.478  Sum_probs=26.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      ...+++|..=..|...+..|.++|....|.
T Consensus       172 k~Iv~yCtgGiRs~kAa~~L~~~Gf~~Vy~  201 (247)
T PRK01415        172 KKIAMVCTGGIRCEKSTSLLKSIGYDEVYH  201 (247)
T ss_pred             CeEEEECCCChHHHHHHHHHHHcCCCcEEE
Confidence            358999999999999999999999886664


No 150
>TIGR00093 pseudouridine synthase. This model identifies panels of pseudouridine synthase enzymes that RNA modifications involved in maturing the protein translation apparatus. Counts per genome vary: two in Staphylococcus aureus, three in Pseudomonas putida, four in E. coli, etc.
Probab=73.23  E-value=4.6  Score=21.66  Aligned_cols=27  Identities=11%  Similarity=0.060  Sum_probs=22.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++-+..|.+  .+.+.++.|.
T Consensus        10 Glll~akd~~~~~~L~~--~~~~i~K~Y~   36 (128)
T TIGR00093        10 GLLLLTNDGELVHRLTH--PGHHCEKTYL   36 (128)
T ss_pred             EEEEEEeCHHHHHHHhC--CCCCCCeEEE
Confidence            46899999999999987  5666778775


No 151
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=72.57  E-value=8.6  Score=24.03  Aligned_cols=30  Identities=7%  Similarity=0.163  Sum_probs=25.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+|.|++-..+...+..|++.|....|++
T Consensus        59 ~IvvyC~~G~rs~~aa~~L~~~G~~~v~~l   88 (376)
T PRK08762         59 EIVLICASGTRSAHAAATLRELGYTRVASV   88 (376)
T ss_pred             eEEEEcCCCcHHHHHHHHHHHcCCCceEee
Confidence            578999998888999999999999876653


No 152
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed
Probab=72.44  E-value=6.2  Score=25.99  Aligned_cols=27  Identities=7%  Similarity=0.242  Sum_probs=24.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .+-|..+++++++..+++.|++.|.+.
T Consensus       251 G~~IlVtR~~~q~~~l~~~L~~~GA~v  277 (474)
T PRK07168        251 GKKVLFTSATNKTSVMKQKLQEAGAEI  277 (474)
T ss_pred             CceEEeeccHHHHHHHHHHHHHcCCEE
Confidence            356889999999999999999999864


No 153
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=71.39  E-value=11  Score=23.67  Aligned_cols=30  Identities=10%  Similarity=0.218  Sum_probs=25.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +..+|+|++-..+...+..|++.|....|+
T Consensus       315 ~~IvvyC~~G~rS~~Aa~~L~~~G~~nV~~  344 (355)
T PRK05597        315 DEVVVYCAAGVRSAQAVAILERAGYTGMSS  344 (355)
T ss_pred             CeEEEEcCCCHHHHHHHHHHHHcCCCCEEE
Confidence            357999999999999999999999876554


No 154
>PF13307 Helicase_C_2:  Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A.
Probab=71.12  E-value=3.9  Score=22.68  Aligned_cols=25  Identities=12%  Similarity=0.061  Sum_probs=20.6

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++++|||+++....+.+.+.|+..+
T Consensus         9 ~g~~lv~f~Sy~~l~~~~~~~~~~~   33 (167)
T PF13307_consen    9 PGGVLVFFPSYRRLEKVYERLKERL   33 (167)
T ss_dssp             SSEEEEEESSHHHHHHHHTT-TSS-
T ss_pred             CCCEEEEeCCHHHHHHHHHHHHhhc
Confidence            3689999999999999999998765


No 155
>PRK15394 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD; Provisional
Probab=70.87  E-value=5.5  Score=24.82  Aligned_cols=27  Identities=19%  Similarity=0.304  Sum_probs=24.8

Q ss_pred             EecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      |--|++.+-+|-+-|+++|.+-++|||
T Consensus        13 ~~~~~~g~~~~~~~~~~~~~~a~f~~~   39 (296)
T PRK15394         13 FRGTREGVPRLLEILSKHGIQASFFFS   39 (296)
T ss_pred             ccccccCHHHHHHHHHHcCCCEEEEec
Confidence            456899999999999999999999996


No 156
>COG1701 Uncharacterized protein conserved in archaea [Function unknown]
Probab=70.55  E-value=5.3  Score=25.23  Aligned_cols=21  Identities=19%  Similarity=0.273  Sum_probs=19.8

Q ss_pred             EEEecchhhHHHHHHHHHhcC
Q psy8719           5 LIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G   25 (33)
                      =+|-+|.+.++.+++.|+++|
T Consensus       102 NLF~RteeRv~~I~e~L~~~G  122 (256)
T COG1701         102 NLFYRTEERVRKIAEVLKEHG  122 (256)
T ss_pred             EeeccCHHHHHHHHHHHHhcC
Confidence            379999999999999999999


No 157
>PRK00441 argR arginine repressor; Provisional
Probab=70.04  E-value=9.7  Score=21.58  Aligned_cols=23  Identities=4%  Similarity=0.312  Sum_probs=20.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +.++|.|++.++++.+.+.|.+.
T Consensus       125 DTilvi~~~~~~a~~l~~~l~~~  147 (149)
T PRK00441        125 NTIFVLVRSEEKAQEIVEKIKKL  147 (149)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHH
Confidence            46899999999999999999764


No 158
>TIGR01529 argR_whole arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs.
Probab=69.82  E-value=9.8  Score=21.36  Aligned_cols=22  Identities=27%  Similarity=0.404  Sum_probs=19.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      +.++|.|++.++++.+.+.|.+
T Consensus       123 DTilii~~~~~~a~~~~~~l~~  144 (146)
T TIGR01529       123 DTILVICRDPETAELLMERLLE  144 (146)
T ss_pred             CEEEEEECCHHHHHHHHHHHHH
Confidence            4689999999999999999875


No 159
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional
Probab=69.06  E-value=12  Score=23.32  Aligned_cols=30  Identities=10%  Similarity=0.540  Sum_probs=26.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +.++|+|.+=..|...+..|.+.|....|.
T Consensus       172 k~IvvyC~~G~Rs~~aa~~L~~~Gf~~V~~  201 (314)
T PRK00142        172 KKVVMYCTGGIRCEKASAWMKHEGFKEVYQ  201 (314)
T ss_pred             CeEEEECCCCcHHHHHHHHHHHcCCCcEEE
Confidence            368999999999999999999999876554


No 160
>cd01421 IMPCH Inosine monophosphate cyclohydrolase domain. This is the N-terminal domain in the purine biosynthesis pathway protein ATIC (purH). The bifunctional ATIC protein contains a C-terminal  ATIC formylase domain that formylates 5-aminoimidazole-4-carboxamide-ribonucleotide. The IMPCH domain then converts the formyl-5-aminoimidazole-4-carboxamide-ribonucleotide to inosine monophosphate. This is the final step in de novo purine production.
Probab=68.90  E-value=11  Score=22.59  Aligned_cols=27  Identities=22%  Similarity=0.239  Sum_probs=24.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .+++|-++.|.+...+++.|.+.|.+.
T Consensus         1 ~~vLISVsDK~~l~~lAk~L~~lGf~I   27 (187)
T cd01421           1 KRALISVSDKTGLVEFAKELVELGVEI   27 (187)
T ss_pred             CEEEEEEeCcccHHHHHHHHHHCCCEE
Confidence            368999999999999999999999876


No 161
>PRK09492 treR trehalose repressor; Provisional
Probab=68.79  E-value=14  Score=21.33  Aligned_cols=27  Identities=19%  Similarity=0.159  Sum_probs=22.6

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |..+.......++++|.++|++.+-|+
T Consensus       155 V~~D~~~~~~~a~~~L~~~G~~~I~~i  181 (315)
T PRK09492        155 VCYDDEGAIKLLMQRLYDQGHRHISYL  181 (315)
T ss_pred             EEECcHHHHHHHHHHHHHcCCCeEEEE
Confidence            566777888899999999999888765


No 162
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues. Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
Probab=68.51  E-value=15  Score=21.71  Aligned_cols=27  Identities=26%  Similarity=0.395  Sum_probs=22.3

Q ss_pred             eEEEEecc-----------hhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRT-----------KLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nT-----------K~~ad~La~~L~~~G~~~~   29 (33)
                      -|||+.|.           ..|++.|++.|++.|....
T Consensus        10 ~alII~n~~f~~~~~r~g~~~D~~~l~~~f~~lgF~V~   47 (241)
T smart00115       10 LALIINNENFHSLPRRNGTDVDAENLTELFQSLGYEVH   47 (241)
T ss_pred             EEEEEECccCCCCcCCCCcHHHHHHHHHHHHHCCCEEE
Confidence            58888886           4699999999999987654


No 163
>PF00610 DEP:  Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP);  InterPro: IPR000591 This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways. It was named after the three proteins it was initially found in:   Dishevelled (Dsh and Dvl), which play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus; it is a segment polarity protein required to establish coherent arrays of polarized cells and segments in embryos, and plays a role in wingless signalling. Egl-10, which regulates G-protein signalling in the central nervous system.  Pleckstrin, the major substrate of protein kinase C in platelets; Pleckstrin contains two PH domains flanking the DEP domain.   Mammalian regulators of G-protein signalling also contain these domains, and regulate signal transduction by increasing the GTPase activity of G-protein alpha subunits, thereby driving them into their inactive GDP-bound form. It has been proposed that the DEP domain could play a selective role in targeting DEP domain-containing proteins to specific subcellular membranous sites, perhaps even to specific G protein-coupled signaling pathways [, ]. Nuclear magnetic resonance spectroscopy has revealed that the DEP domain comprises a three-helix bundle, a beta-hairpin 'arm' composed of two beta-strands and two short beta-strands in the C-terminal region [].; GO: 0035556 intracellular signal transduction; PDB: 1UHW_A 1V3F_A 2YSR_A 2CSO_A 1W4M_A 2PBI_C 1O7F_A 2BYV_E 1FSH_A 3ML6_D ....
Probab=68.45  E-value=5  Score=19.31  Aligned_cols=20  Identities=20%  Similarity=0.182  Sum_probs=16.9

Q ss_pred             EecchhhHHHHHHHHHhcCC
Q psy8719           7 FCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~   26 (33)
                      ++.++.+|..|++.|-..|.
T Consensus        34 ~~~~r~eA~~l~q~Ll~~g~   53 (74)
T PF00610_consen   34 FVRDREEAVQLGQELLDHGF   53 (74)
T ss_dssp             STSSHHHHHHHHHHHHHCTS
T ss_pred             cccCHHHHHHHHHHHHHCCC
Confidence            36789999999999988774


No 164
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily. They activate the cell division kinases throughout the cell cycle progression. Cdc25 phosphatases dephosphorylate phosphotyrosine and phosphothreonine residues, in order to activate their Cdk/cyclin substrates. Cdc25A phosphatase functions to regulate S phase entry and Cdc25B is required for G2/M phase transition of the cell cycle. The Cdc25 domain binds oxyanions at the catalytic site and has the signature motif (H/YCxxxxxR).
Probab=68.14  E-value=15  Score=19.41  Aligned_cols=22  Identities=14%  Similarity=0.342  Sum_probs=18.6

Q ss_pred             eEEEEec-chhhHHHHHHHHHhc
Q psy8719           3 RALIFCR-TKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~n-TK~~ad~La~~L~~~   24 (33)
                      .+|+.|+ +-..+...+..|++.
T Consensus        70 ~vv~yC~~sg~rs~~aa~~L~~~   92 (121)
T cd01530          70 VLIFHCEFSSKRGPRMARHLRNL   92 (121)
T ss_pred             EEEEECCCccccHHHHHHHHHHH
Confidence            5788896 888899999999985


No 165
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated
Probab=67.76  E-value=13  Score=23.53  Aligned_cols=30  Identities=10%  Similarity=0.162  Sum_probs=25.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ..+|+|++-..+...+..|++.|..-.|+.
T Consensus       345 ~iVvyC~~G~rS~~aa~~L~~~G~~~V~~L  374 (392)
T PRK07878        345 TIVLYCKTGVRSAEALAALKKAGFSDAVHL  374 (392)
T ss_pred             cEEEEcCCChHHHHHHHHHHHcCCCcEEEe
Confidence            578999999999999999999998766653


No 166
>TIGR00596 rad1 DNA repair protein (rad1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford Universit
Probab=67.41  E-value=7.7  Score=27.42  Aligned_cols=22  Identities=32%  Similarity=0.735  Sum_probs=20.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++||||+-++.|..|.++|..
T Consensus       296 ~~iLI~~~d~~T~~qL~~~L~~  317 (814)
T TIGR00596       296 GKVLIMCSDNRTCLQLRDYLTT  317 (814)
T ss_pred             CcEEEEEcchHHHHHHHHHHHh
Confidence            4699999999999999999965


No 167
>cd02555 PSSA_1 PSSA_1: Pseudouridine synthase, a subgroup of the RsuA family. This group is comprised of bacterial proteins assigned to the RsuA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. The TruA family is comprised of proteins related to Escherichia coli RsuA.
Probab=67.35  E-value=9.8  Score=21.76  Aligned_cols=28  Identities=14%  Similarity=0.057  Sum_probs=22.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      -.|||+|++.-+..|...  +.+.++.|.-
T Consensus        59 GLLl~t~d~~~~~~L~~~--~~~i~K~Y~v   86 (177)
T cd02555          59 GLLVFSQDGRVLRKLIGD--ASRLEQEYLV   86 (177)
T ss_pred             eEEEEECCHHHHHHHhCh--hcCCCEEEEE
Confidence            479999999999999983  5677888863


No 168
>KOG0951|consensus
Probab=66.67  E-value=6.6  Score=30.14  Aligned_cols=22  Identities=14%  Similarity=0.427  Sum_probs=20.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .|+|||+..|.++.+.|++++.
T Consensus       547 ~qVLVFVHsRkET~ktA~aIRd  568 (1674)
T KOG0951|consen  547 NQVLVFVHSRKETAKTARAIRD  568 (1674)
T ss_pred             CcEEEEEEechHHHHHHHHHHH
Confidence            5899999999999999999884


No 169
>PF04364 DNA_pol3_chi:  DNA polymerase III chi subunit, HolC;  InterPro: IPR007459 The DNA polymerase III holoenzyme (2.7.7.7 from EC) is the polymerase responsible for the replication of the Escherichia coli chromosome. The holoenzyme is composed of the DNA polymerase III core, the sliding clamp, and the DnaX clamp loading complex. The DnaX complex contains either the tau or gamma product of gene dnax, complexed to delta.delta and to chi psi. Chi forms a 1:1 heterodimer with psi. The chi psi complex functions by increasing the affinity of tau and gamma for delta.delta allowing a functional clamp-loading complex to form at physiological subunit concentrations. Psi is responsible for the interaction with DnaX (gamma/tau), but psi is insoluble unless it is in a complex with chi [].; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3SXU_A 1EM8_C.
Probab=66.31  E-value=7.1  Score=21.49  Aligned_cols=21  Identities=24%  Similarity=0.558  Sum_probs=16.4

Q ss_pred             ceEEEEecchhhHHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~   22 (33)
                      .+++|.|..++.++.|.+.|=
T Consensus        30 ~rv~V~~~d~~~a~~lD~~LW   50 (137)
T PF04364_consen   30 QRVLVLCPDEEQAEALDELLW   50 (137)
T ss_dssp             --EEEE-SSHHHHHHHHHHTT
T ss_pred             CeEEEEeCCHHHHHHHHHHHH
Confidence            478999999999999998873


No 170
>KOG0947|consensus
Probab=66.17  E-value=5.9  Score=29.61  Aligned_cols=23  Identities=26%  Similarity=0.655  Sum_probs=20.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      -+||||=.|..||+-|+.|....
T Consensus       569 P~VvFvFSkkrCde~a~~L~~~n  591 (1248)
T KOG0947|consen  569 PVVVFVFSKKRCDEYADYLTNLN  591 (1248)
T ss_pred             ceEEEEEccccHHHHHHHHhccC
Confidence            37999999999999999997643


No 171
>PRK06724 hypothetical protein; Provisional
Probab=66.02  E-value=13  Score=19.74  Aligned_cols=24  Identities=13%  Similarity=0.364  Sum_probs=20.0

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |-| +.++++.|++.+.|.++|...
T Consensus        67 ~af~v~~~~dvd~~~~~l~~~G~~~   91 (128)
T PRK06724         67 ICYQAINRKVVDEVAEFLSSTKIKI   91 (128)
T ss_pred             EEEecCChHHHHHHHHHHHHCCCEE
Confidence            446 578999999999999999753


No 172
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily. This CD includes several putative ATP /GTP binding proteins including E. coli YbbB.
Probab=65.17  E-value=17  Score=19.09  Aligned_cols=28  Identities=21%  Similarity=0.438  Sum_probs=22.3

Q ss_pred             ceEEEEec-chhhHHHHHHHHHhcCCceee
Q psy8719           2 DRALIFCR-TKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         2 ~~aIVF~n-TK~~ad~La~~L~~~G~~~~~   30 (33)
                      +.+||+|+ +-..+...+..|+..|.. .|
T Consensus        87 ~~vvvyC~~~G~rs~~a~~~L~~~G~~-v~  115 (128)
T cd01520          87 PKLLIYCARGGMRSQSLAWLLESLGID-VP  115 (128)
T ss_pred             CeEEEEeCCCCccHHHHHHHHHHcCCc-ee
Confidence            36899996 567788999999999985 54


No 173
>PHA02591 hypothetical protein; Provisional
Probab=65.09  E-value=7.7  Score=20.91  Aligned_cols=25  Identities=12%  Similarity=0.046  Sum_probs=21.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++=-|...++|...||..|.++|..
T Consensus        37 ~~ryfi~~~dd~~~vA~eL~eqGlS   61 (83)
T PHA02591         37 QTRYFVESEDDLISVTHELARKGFT   61 (83)
T ss_pred             CEEEEEeccchHHHHHHHHHHcCCC
Confidence            4456899999999999999999863


No 174
>PRK05728 DNA polymerase III subunit chi; Validated
Probab=64.89  E-value=11  Score=20.92  Aligned_cols=21  Identities=24%  Similarity=0.375  Sum_probs=18.6

Q ss_pred             ceEEEEecchhhHHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~   22 (33)
                      .+++|.|...+.++.|-+.|=
T Consensus        30 ~rv~I~~~d~~~a~~lD~~LW   50 (142)
T PRK05728         30 WRVLVQCEDEEQAEALDEALW   50 (142)
T ss_pred             CEEEEEcCCHHHHHHHHHHhc
Confidence            478999999999999999884


No 175
>COG1647 Esterase/lipase [General function prediction only]
Probab=64.82  E-value=6.1  Score=24.79  Aligned_cols=21  Identities=38%  Similarity=0.420  Sum_probs=18.9

Q ss_pred             EecchhhHHHHHHHHHhcCCc
Q psy8719           7 FCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~   27 (33)
                      |+-|-++++.|+++|+++|..
T Consensus        24 FTGt~~Dvr~Lgr~L~e~GyT   44 (243)
T COG1647          24 FTGTPRDVRMLGRYLNENGYT   44 (243)
T ss_pred             cCCCcHHHHHHHHHHHHCCce
Confidence            788999999999999999753


No 176
>PRK13019 clpS ATP-dependent Clp protease adaptor; Reviewed
Probab=64.61  E-value=14  Score=19.71  Aligned_cols=25  Identities=8%  Similarity=0.114  Sum_probs=19.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++++|..-+++.|+.-++.|.+.|-
T Consensus        64 G~avv~~~~~E~AE~~~~~l~~~gl   88 (94)
T PRK13019         64 GSAVVWVGPLEQAELYHQQLTDAGL   88 (94)
T ss_pred             CcEEEEEecHHHHHHHHHHHHHccc
Confidence            4678888888888888888888773


No 177
>PRK13761 hypothetical protein; Provisional
Probab=64.40  E-value=7.7  Score=24.44  Aligned_cols=23  Identities=17%  Similarity=0.319  Sum_probs=21.0

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|-+|.+..+.+++.|+++|..-
T Consensus       101 LF~RT~eR~~~I~~~l~~~Ga~~  123 (248)
T PRK13761        101 LFYRTEERVEKIAEVLREHGAKE  123 (248)
T ss_pred             eccCCHHHHHHHHHHHHHcCCce
Confidence            69999999999999999999763


No 178
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]
Probab=64.37  E-value=14  Score=18.07  Aligned_cols=27  Identities=7%  Similarity=0.191  Sum_probs=23.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..+|.|++=......++.|.++|....
T Consensus        63 ~ivv~C~~G~rS~~aa~~L~~~G~~~~   89 (110)
T COG0607          63 PIVVYCASGVRSAAAAAALKLAGFTNV   89 (110)
T ss_pred             eEEEEeCCCCChHHHHHHHHHcCCccc
Confidence            567889999999999999999996543


No 179
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]
Probab=64.17  E-value=15  Score=25.14  Aligned_cols=25  Identities=16%  Similarity=0.102  Sum_probs=23.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .+++|=|||...|.++.+.|+..+.
T Consensus       441 ~kvlvI~NTV~~Aie~Y~~Lk~~~~  465 (733)
T COG1203         441 KKVLVIVNTVDRAIELYEKLKEKGP  465 (733)
T ss_pred             CcEEEEEecHHHHHHHHHHHHhcCC
Confidence            4789999999999999999999887


No 180
>COG0716 FldA Flavodoxins [Energy production and conversion]
Probab=63.68  E-value=5.2  Score=21.80  Aligned_cols=21  Identities=10%  Similarity=-0.018  Sum_probs=18.4

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .||+.-|+.+++.|..+|.+.
T Consensus        13 GnTe~vA~~i~~~l~~~~~~~   33 (151)
T COG0716          13 GNTEKVAEIIAEELGADGFEV   33 (151)
T ss_pred             CcHHHHHHHHHHHhccCCceE
Confidence            489999999999999998765


No 181
>PRK04280 arginine repressor; Provisional
Probab=63.68  E-value=15  Score=20.79  Aligned_cols=22  Identities=32%  Similarity=0.617  Sum_probs=19.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      +.++|.|++.+++++|.+.|.+
T Consensus       125 DTilvi~~~~~~a~~l~~~l~~  146 (148)
T PRK04280        125 DTCLIICRTEEDAEEVKDRFLN  146 (148)
T ss_pred             CEEEEEECCHHHHHHHHHHHHH
Confidence            4689999999999999999875


No 182
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=63.19  E-value=11  Score=25.47  Aligned_cols=24  Identities=13%  Similarity=0.200  Sum_probs=21.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .+++|||.++..|.++.+.|.+..
T Consensus       515 ~kamvv~~sr~~a~~~~~~l~~~~  538 (667)
T TIGR00348       515 FKAMVVAISRYACVEEKNALDEEL  538 (667)
T ss_pred             CceeEEEecHHHHHHHHHHHHhhc
Confidence            579999999999999999987764


No 183
>TIGR00715 precor6x_red precorrin-6x reductase. This enzyme was found to be a monomer by gel filtration.
Probab=63.17  E-value=17  Score=22.09  Aligned_cols=27  Identities=11%  Similarity=0.078  Sum_probs=23.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      +.+||.-|-+ ...|++.|.+.|++...
T Consensus         2 ~ILvlGGT~e-gr~la~~L~~~g~~v~~   28 (256)
T TIGR00715         2 TVLLMGGTVD-SRAIAKGLIAQGIEILV   28 (256)
T ss_pred             eEEEEechHH-HHHHHHHHHhCCCeEEE
Confidence            5799999997 99999999999987654


No 184
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain. Only the second repeat contains the catalytically active Cys residue. The role of the 1st repeat is uncertain, but believed to be involved in protein interaction. This CD aligns the 1st and 2nd repeats.
Probab=62.31  E-value=24  Score=19.19  Aligned_cols=30  Identities=0%  Similarity=-0.161  Sum_probs=22.7

Q ss_pred             ceEEEEecc---hhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRT---KLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nT---K~~ad~La~~L~~~G~~~~~~   31 (33)
                      +.+||+|++   -..+-+++=.|+..|+...+.
T Consensus        96 ~~vVvY~~~~~~g~~A~r~~~~l~~~G~~~v~i  128 (138)
T cd01445          96 KHLIATDGDDLGGFTACHIALAARLCGHPDVAI  128 (138)
T ss_pred             CeEEEECCCCCcchHHHHHHHHHHHcCCCCeEE
Confidence            368999986   456778888899999876543


No 185
>KOG0339|consensus
Probab=62.27  E-value=8.9  Score=27.17  Aligned_cols=28  Identities=21%  Similarity=0.325  Sum_probs=24.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++|||+--|.++++|+..|.-.|...+
T Consensus       469 gkvlifVTKk~~~e~i~a~Lklk~~~v~  496 (731)
T KOG0339|consen  469 GKVLIFVTKKADAEEIAANLKLKGFNVS  496 (731)
T ss_pred             CcEEEEEeccCCHHHHHHHhccccceee
Confidence            3789999999999999999988876543


No 186
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional
Probab=62.07  E-value=17  Score=21.65  Aligned_cols=28  Identities=11%  Similarity=0.139  Sum_probs=24.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .+|++|++=..+..++-.|+..|..-.+
T Consensus       233 ~ii~yC~~G~~A~~~~~~l~~~G~~~v~  260 (281)
T PRK11493        233 PIIASCGSGVTAAVVVLALATLDVPNVK  260 (281)
T ss_pred             CEEEECCcHHHHHHHHHHHHHcCCCCce
Confidence            5889999999999999999999986543


No 187
>TIGR00730 conserved hypothetical protein, DprA/Smf-related, family 2. This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions.
Probab=62.05  E-value=22  Score=20.53  Aligned_cols=28  Identities=21%  Similarity=0.453  Sum_probs=23.0

Q ss_pred             eEEEEecch--------hhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTK--------LDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK--------~~ad~La~~L~~~G~~~~~   30 (33)
                      ++-|||..+        +.|.+|.+.|.+.|....|
T Consensus         2 ~i~V~~~s~~~~~~~~~~~A~~lG~~la~~g~~lV~   37 (178)
T TIGR00730         2 TVCVYCGSSPGGNAAYKELAAELGAYLAGQGWGLVY   37 (178)
T ss_pred             EEEEECcCCCCCCcHHHHHHHHHHHHHHHCCCEEEE
Confidence            466888875        5899999999999988766


No 188
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=61.88  E-value=18  Score=17.69  Aligned_cols=27  Identities=22%  Similarity=0.145  Sum_probs=20.8

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      |+..||-.++-.++-+..+.|+++|..
T Consensus         1 m~~~~i~F~st~~a~~~ek~lk~~gi~   27 (73)
T PF11823_consen    1 MKYYLITFPSTHDAMKAEKLLKKNGIP   27 (73)
T ss_pred             CceEEEEECCHHHHHHHHHHHHHCCCc
Confidence            456777777788888888888888753


No 189
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=61.78  E-value=17  Score=17.35  Aligned_cols=31  Identities=10%  Similarity=-0.028  Sum_probs=21.8

Q ss_pred             CceEEEEecc---hhhHHHHHHHHHhcCCceeee
Q psy8719           1 MDRALIFCRT---KLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         1 ~~~aIVF~nT---K~~ad~La~~L~~~G~~~~~~   31 (33)
                      |.+++|.+-+   ...|..+++.|++.|..-...
T Consensus         1 p~~v~ii~~~~~~~~~a~~~~~~Lr~~g~~v~~d   34 (91)
T cd00860           1 PVQVVVIPVTDEHLDYAKEVAKKLSDAGIRVEVD   34 (91)
T ss_pred             CeEEEEEeeCchHHHHHHHHHHHHHHCCCEEEEE
Confidence            3465666544   458899999999998766543


No 190
>cd02556 PseudoU_synth_RluB PseudoU_synth_RluB: Pseudouridine synthase, Escherichia coli RluB like. This group is comprised of bacterial and eukaryotic proteins similar to E. coli RluB. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. E.coli RluB makes psi2605 in 23S RNA.  psi2605 has been detected in eubacteria but, not in eukarya and archea despite the presence of a precursor U at that site.
Probab=61.63  E-value=12  Score=20.89  Aligned_cols=27  Identities=19%  Similarity=0.113  Sum_probs=21.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++-+..|..  .+...++.|.
T Consensus        48 GLll~ak~~~~~~~L~~--~~~~i~K~Y~   74 (167)
T cd02556          48 GLLLFTNDGELANRLMH--PSNEIEREYA   74 (167)
T ss_pred             eEEEEECCHHHHHHHhC--CcCCCCeEEE
Confidence            46899999999999875  5566677775


No 191
>cd00032 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues; Cysteine-dependent aspartate-directed proteases that mediate programmed cell death (apoptosis). Caspases are synthesized as inactive zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologs.
Probab=61.16  E-value=22  Score=20.83  Aligned_cols=27  Identities=26%  Similarity=0.420  Sum_probs=21.4

Q ss_pred             eEEEEecc------------hhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRT------------KLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nT------------K~~ad~La~~L~~~G~~~~   29 (33)
                      -|||+.|.            ..|++.|++.|++.|....
T Consensus        11 ~aLII~n~~f~~~~~~r~g~~~D~~~l~~~f~~lgF~V~   49 (243)
T cd00032          11 LALIINNENFDKGLKDRDGTDVDAENLTKLFESLGYEVE   49 (243)
T ss_pred             EEEEEechhcCCCCCCCCChHHHHHHHHHHHHHCCCEEE
Confidence            47787773            5789999999999987643


No 192
>TIGR00725 conserved hypothetical protein, DprA/Smf-related, family 1. This model represents one branch of a subfamily of uncharacterized proteins. Both PSI-BLAST and weak hits by this model show a low level of similarity and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting the branches may have distinct functions. This family is one of several families within the scope of PFAM model pfam03641, several members of which are annotated as lysine decarboxylases. That larger family, and the branch described by this model, have a well-conserved motif PGGXGTXXE.
Probab=61.07  E-value=27  Score=19.69  Aligned_cols=29  Identities=17%  Similarity=0.021  Sum_probs=22.2

Q ss_pred             CceEEEEecc------hhhHHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRT------KLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nT------K~~ad~La~~L~~~G~~~~   29 (33)
                      |.++=|||..      ++.|.+|++.|.++|....
T Consensus         1 ~~~I~V~gss~~~~~~~~~A~~lg~~La~~g~~lv   35 (159)
T TIGR00725         1 MVQIGVIGSSNKSEELYEIAYRLGKELAKKGHILI   35 (159)
T ss_pred             CeEEEEEeCCCCChHHHHHHHHHHHHHHHCCCEEE
Confidence            4567788877      4568999999999987543


No 193
>PF02423 OCD_Mu_crystall:  Ornithine cyclodeaminase/mu-crystallin family;  InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline []. The family also includes mu-crystallin, a mammalian homologue of bacterial ornithine cyclodeaminase [], which is the major component of the eye lens in several Australian marsupials. mRNA for mu-crystallin has also been found in human retina [].; PDB: 1U7H_B 1X7D_B 2I99_B 3HDJ_A 1VLL_B 1OMO_A.
Probab=61.04  E-value=20  Score=21.96  Aligned_cols=26  Identities=8%  Similarity=0.262  Sum_probs=21.1

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++++.|+.++.+.++++++.+++.|.
T Consensus       153 i~~v~v~~r~~~~~~~~~~~~~~~~~  178 (313)
T PF02423_consen  153 IKEVRVYSRSPERAEAFAARLRDLGV  178 (313)
T ss_dssp             -SEEEEE-SSHHHHHHHHHHHHCCCT
T ss_pred             ceEEEEEccChhHHHHHHHhhccccc
Confidence            36889999999999999999998543


No 194
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=60.84  E-value=11  Score=23.65  Aligned_cols=23  Identities=22%  Similarity=0.509  Sum_probs=20.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++||.|+|++-|+++++.++..+
T Consensus        74 ~~lil~PtreLa~Q~~~~~~~~~   96 (460)
T PRK11776         74 QALVLCPTRELADQVAKEIRRLA   96 (460)
T ss_pred             eEEEEeCCHHHHHHHHHHHHHHH
Confidence            68999999999999999888754


No 195
>cd02870 PseudoU_synth_RsuA_like Pseudouridine synthases  are responsible for the synthesis of pseudouridine from uracil in ribosomal RNA. The RsuA subfamily includes Pseudouridine Synthase similar to Ribosomal small subunit pseudouridine 516 synthase. Most of the proteins in this family are bacterial proteins.
Probab=60.79  E-value=13  Score=20.13  Aligned_cols=27  Identities=11%  Similarity=0.098  Sum_probs=19.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++-+..|.+  .+...++.|.
T Consensus        46 Glll~ak~~~~~~~l~~--~~~~i~K~Y~   72 (146)
T cd02870          46 GLLLLTNDGELANRLTH--PRYGVEKTYL   72 (146)
T ss_pred             eEEEEeCCHHHHHHhhC--ccCCCCeEEE
Confidence            47899999988888765  3445667775


No 196
>PF00258 Flavodoxin_1:  Flavodoxin;  InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase. Flavodoxins are electron-transfer proteins that function in various electron transport systems. They bind one FMN molecule, which serves as a redox-active prosthetic group [] and are functionally interchangeable with ferredoxins. They have been isolated from prokaryotes, cyanobacteria, and some eukaryotic algae. Nitric oxide synthase (1.14.13.39 from EC) produces nitric oxide from L-arginie and NADPH. Nitric oxide acts as a messenger molecule in the body.; GO: 0010181 FMN binding, 0016491 oxidoreductase activity; PDB: 2WC1_A 2FVX_A 2FOX_A 6NUL_A 1FVX_A 2FAX_A 1FLN_A 1FLA_A 4NLL_A 2FDX_A ....
Probab=60.65  E-value=7.4  Score=20.39  Aligned_cols=19  Identities=11%  Similarity=0.031  Sum_probs=16.8

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ||+.-|+.|++.|++.|..
T Consensus         9 ~te~~A~~ia~~l~~~g~~   27 (143)
T PF00258_consen    9 NTEKMAEAIAEGLRERGVE   27 (143)
T ss_dssp             HHHHHHHHHHHHHHHTTSE
T ss_pred             hHHHHHHHHHHHHHHcCCc
Confidence            7889999999999998865


No 197
>KOG0948|consensus
Probab=60.47  E-value=11  Score=27.83  Aligned_cols=24  Identities=17%  Similarity=0.440  Sum_probs=20.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ..+|||+-.|.+|+.+|-.|.+..
T Consensus       384 ~PVIvFSFSkkeCE~~Alqm~kld  407 (1041)
T KOG0948|consen  384 LPVIVFSFSKKECEAYALQMSKLD  407 (1041)
T ss_pred             CceEEEEecHhHHHHHHHhhccCc
Confidence            468999999999999999887643


No 198
>PHA00527 hypothetical protein
Probab=60.22  E-value=13  Score=21.22  Aligned_cols=20  Identities=20%  Similarity=0.321  Sum_probs=17.6

Q ss_pred             eEEEEecchhhHHHHHHHHH
Q psy8719           3 RALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~   22 (33)
                      -.|+||+.+.+=+++...|-
T Consensus        20 ~~v~~CR~~~EWQ~~~~~LG   39 (129)
T PHA00527         20 ANVYLCRSKEEWQQACIHLG   39 (129)
T ss_pred             ceEEEEcChHHHHHHHHHhC
Confidence            46899999999999998883


No 199
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=59.94  E-value=9.9  Score=24.90  Aligned_cols=24  Identities=21%  Similarity=0.272  Sum_probs=21.9

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCc
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +||.+.||+-|..+++.++..+..
T Consensus       102 aLil~PTRELA~Qi~~~~~~~~~~  125 (513)
T COG0513         102 ALILAPTRELAVQIAEELRKLGKN  125 (513)
T ss_pred             eEEECCCHHHHHHHHHHHHHHHhh
Confidence            899999999999999999887764


No 200
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalR is a dimeric protein like GalS and is exclusively involved in the regulation of galactose permease, the low-affinity galactose transporter. GalS is involved in regulating expression of the high-affinity galactose transporter encoded by the mgl operon. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type I periplasmic binding protein-like fold.  Hence, they are structurally homologous to the periplasmic sugar bindi
Probab=59.92  E-value=22  Score=19.97  Aligned_cols=27  Identities=11%  Similarity=0.154  Sum_probs=21.3

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |.++-...+..++++|.+.|++.+.|+
T Consensus        92 v~~D~~~a~~~~~~~l~~~g~~~i~~i  118 (270)
T cd01544          92 VVPDFEQAVEKALDYLLELGHTRIGFI  118 (270)
T ss_pred             EEECHHHHHHHHHHHHHHcCCCcEEEE
Confidence            555667778889999998999888765


No 201
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=59.55  E-value=18  Score=17.35  Aligned_cols=25  Identities=12%  Similarity=0.200  Sum_probs=21.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||.|.++.-++.+.+.+.....
T Consensus        31 ~~~lv~~p~~~l~~~~~~~~~~~~~   55 (144)
T cd00046          31 GQVLVLAPTRELANQVAERLKELFG   55 (144)
T ss_pred             CCEEEEcCcHHHHHHHHHHHHHHhh
Confidence            5789999999999999988887663


No 202
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=59.39  E-value=20  Score=17.72  Aligned_cols=22  Identities=18%  Similarity=0.288  Sum_probs=18.7

Q ss_pred             ecchhhHHHHHHHHHhcCCcee
Q psy8719           8 CRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      +.+..+.+.+.+.|+++|.+..
T Consensus        68 v~~~~dv~~~~~~l~~~g~~~~   89 (121)
T cd07266          68 VRSEEDLDKAEAFFQELGLPTE   89 (121)
T ss_pred             CCCHHHHHHHHHHHHHcCCCcc
Confidence            6678999999999999997653


No 203
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial. This family consists of repressors of the LacI family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gammaproteobacteria and does not include the GntR family TreR of Bacillus subtilis
Probab=59.07  E-value=23  Score=20.55  Aligned_cols=27  Identities=15%  Similarity=0.087  Sum_probs=22.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-.+....+..++++|-++|++.+-|+
T Consensus       152 V~~D~~~~~~~a~~~L~~~Ghr~I~~i  178 (311)
T TIGR02405       152 VCYDDYGAIELLMANLYQQGHRHISFL  178 (311)
T ss_pred             EEeCcHHHHHHHHHHHHHcCCCcEEEE
Confidence            556777888899999999999988775


No 204
>COG1587 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism]
Probab=58.63  E-value=17  Score=21.27  Aligned_cols=26  Identities=12%  Similarity=0.267  Sum_probs=22.4

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      -|+-++.+..++++++.|+++|..-.
T Consensus         3 ~vlvtR~~~~~~~~~~~l~~~G~~~~   28 (248)
T COG1587           3 RVLVTRPREQAEELAALLRKAGAEPL   28 (248)
T ss_pred             EEEEeCchhhhHHHHHHHHhCCCcce
Confidence            46778999999999999999998644


No 205
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain. Cool/Pix contains an N-terminal SH3 domain followed by a RhoGEF (DH) and PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=58.46  E-value=23  Score=19.81  Aligned_cols=26  Identities=19%  Similarity=0.468  Sum_probs=22.3

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      +++.+|-|+..++.+++.+.|+++-+
T Consensus        85 i~~i~v~C~~~~e~~~Wl~hL~~~~~  110 (111)
T cd01225          85 IERIVVVCNNPQDAQEWVELLNANNP  110 (111)
T ss_pred             cCcEEEEeCCHHHHHHHHHHHHhhcC
Confidence            36788999999999999999998643


No 206
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=58.10  E-value=20  Score=22.28  Aligned_cols=25  Identities=16%  Similarity=0.322  Sum_probs=22.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .+..|+-||.+.+++|++.+.+.+.
T Consensus       151 ~~i~V~NRt~~ra~~La~~~~~~~~  175 (283)
T COG0169         151 KRITVVNRTRERAEELADLFGELGA  175 (283)
T ss_pred             CEEEEEeCCHHHHHHHHHHhhhccc
Confidence            4678999999999999999998774


No 207
>PRK11104 hemG protoporphyrinogen oxidase; Provisional
Probab=58.05  E-value=15  Score=20.82  Aligned_cols=26  Identities=12%  Similarity=0.241  Sum_probs=17.9

Q ss_pred             CceEEEEe----cchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFC----RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~----nTK~~ad~La~~L~~~G~~   27 (33)
                      |.-.||+.    ||+.-|+.|++.|.. |..
T Consensus         1 MkilIvY~S~~G~T~~iA~~Ia~~l~~-g~~   30 (177)
T PRK11104          1 MKTLILYSSRDGQTRKIASYIASELKE-GIQ   30 (177)
T ss_pred             CcEEEEEECCCChHHHHHHHHHHHhCC-CCe
Confidence            33456665    677778888888876 654


No 208
>TIGR02786 addB_alphas double-strand break repair protein AddB, alphaproteobacterial type. AddAB is a system well described in the Firmicutes as a replacement for RecBCD in many prokaryotes for the repair of double stranded break DNA damage. More recently, a distantly related gene pair conserved in many alphaproteobacteria was shown also to function in double-stranded break repair in Rhizobium etli. This family consists of AddB proteins of the alphaproteobacteial type.
Probab=57.90  E-value=15  Score=26.11  Aligned_cols=23  Identities=17%  Similarity=0.252  Sum_probs=21.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++.|+++|+..+..|.+.+.+.
T Consensus        39 a~~~i~~ptrr~~r~l~~~f~~~   61 (1021)
T TIGR02786        39 ADATIYVPTRRAARALREAFVDV   61 (1021)
T ss_pred             cCeEEEeCChHHHHHHHHHHHHh
Confidence            46899999999999999999885


No 209
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]
Probab=57.74  E-value=19  Score=22.59  Aligned_cols=25  Identities=8%  Similarity=0.053  Sum_probs=22.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ..+++|+.|=++++++.+.|++.|.
T Consensus       189 g~~~~y~P~veQv~kt~~~l~~~g~  213 (256)
T COG2519         189 GVVVVYSPTVEQVEKTVEALRERGF  213 (256)
T ss_pred             cEEEEEcCCHHHHHHHHHHHHhcCc
Confidence            3678999999999999999999864


No 210
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. This CD includes the C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. AcuB is putatively involved in the anaerobic catabolism of acetoin, and related proteins. Studies report the induction of AcuB by nitrate respiration and also by fermentation. Since acetoin can be secreted and later serve as a source of carbon, it has been proposed that, during anaerobic growth when other carbon sources are exhausted, the induction of the AcuB protein  results in acetoin catabolism. AcuB-like proteins have two N-terminal tandem CBS domains and a single C-terminal ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=57.01  E-value=20  Score=16.58  Aligned_cols=19  Identities=5%  Similarity=0.161  Sum_probs=15.4

Q ss_pred             hhHHHHHHHHHhcCCceee
Q psy8719          12 LDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus        12 ~~ad~La~~L~~~G~~~~~   30 (33)
                      .+.+++.+.|++.|....|
T Consensus        52 ~~~~~~~~~L~~~G~~v~~   70 (72)
T cd04883          52 MNPRPIIEDLRRAGYEVLW   70 (72)
T ss_pred             CCHHHHHHHHHHCCCeeeC
Confidence            5667999999999987654


No 211
>PRK08105 flavodoxin; Provisional
Probab=56.90  E-value=18  Score=19.97  Aligned_cols=27  Identities=22%  Similarity=0.289  Sum_probs=18.4

Q ss_pred             CceEEEEe-----cchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFC-----RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~-----nTK~~ad~La~~L~~~G~~   27 (33)
                      |.+++||-     ||+.-|++|++.|++.|..
T Consensus         1 m~~i~I~YgS~tGnte~~A~~l~~~l~~~g~~   32 (149)
T PRK08105          1 MAKVGIFVGTVYGNALLVAEEAEAILTAQGHE   32 (149)
T ss_pred             CCeEEEEEEcCchHHHHHHHHHHHHHHhCCCc
Confidence            34555653     5677788888888877754


No 212
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The alpha subunit of the F1 ATP synthase can bind nucleotides, but is non-catalytic.
Probab=56.83  E-value=28  Score=21.75  Aligned_cols=29  Identities=14%  Similarity=0.273  Sum_probs=22.1

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~G~~~~   29 (33)
                      +++++|+++|-++           +-.+|++++.+|+.-.
T Consensus       125 ~~~tvvv~~t~d~~~~~r~~a~~~a~aiAE~fr~~G~~Vl  164 (274)
T cd01132         125 MEYTIVVAATASDPAPLQYLAPYTGCAMGEYFMDNGKHAL  164 (274)
T ss_pred             cceeEEEEeCCCCchhHHHHHHHHHHHHHHHHHHCCCCEE
Confidence            3578888888776           5678899988887643


No 213
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=56.75  E-value=27  Score=18.12  Aligned_cols=25  Identities=20%  Similarity=0.147  Sum_probs=22.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++||.+.++.-++++.+.+++.+..
T Consensus        46 ~~lii~P~~~l~~q~~~~~~~~~~~   70 (169)
T PF00270_consen   46 RVLIIVPTRALAEQQFERLRKFFSN   70 (169)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHHTTT
T ss_pred             eEEEEeecccccccccccccccccc
Confidence            7899999999999999999888764


No 214
>PF00532 Peripla_BP_1:  Periplasmic binding proteins and sugar binding domain of LacI family;  InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators. The periplasmic binding proteins are the primary receptors for chemotaxis and transport of many sugar based solutes. The LacI family of proteins consist of transcriptional regulators related to the lac repressor. In this case, generally the sugar binding domain binds a sugar which changes the DNA binding activity of the repressor domain (lacI) [, ].; PDB: 1BAP_A 7ABP_A 6ABP_A 1ABF_A 5ABP_A 2WRZ_B 9ABP_A 1APB_A 1ABE_A 8ABP_A ....
Probab=56.62  E-value=16  Score=21.53  Aligned_cols=27  Identities=15%  Similarity=0.192  Sum_probs=22.1

Q ss_pred             EEecchhhHHHHHHHHHhcCCce-eeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL-IYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~-~~~~   32 (33)
                      |.+...+....++++|-+.|++. +.++
T Consensus        98 V~~D~~~a~~~a~~~Li~~Gh~~~I~~i  125 (279)
T PF00532_consen   98 VYIDNYEAGYEATEYLIKKGHRRPIAFI  125 (279)
T ss_dssp             EEEEHHHHHHHHHHHHHHTTCCSTEEEE
T ss_pred             EEEcchHHHHHHHHHHHhcccCCeEEEE
Confidence            55667778889999999999998 7664


No 215
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=56.61  E-value=30  Score=19.26  Aligned_cols=27  Identities=15%  Similarity=0.050  Sum_probs=22.0

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-.+-.+.+..+++.|.+.|++.+-|+
T Consensus        95 v~~d~~~~g~~a~~~L~~~g~~~i~~~  121 (263)
T cd06280          95 VVLDNRAAARTLVEHLVAQGYRRIGGL  121 (263)
T ss_pred             EEECcHHHHHHHHHHHHHCCCceEEEE
Confidence            557778888899999999998877665


No 216
>PRK06407 ornithine cyclodeaminase; Provisional
Probab=56.29  E-value=27  Score=21.45  Aligned_cols=24  Identities=8%  Similarity=0.102  Sum_probs=21.4

Q ss_pred             CceEEEEecchhhHHHHHHHHHhc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .+++.||-+|++.++++++.+++.
T Consensus       142 i~~v~v~~r~~~~a~~f~~~~~~~  165 (301)
T PRK06407        142 PKRIRVYSRNFDHARAFAERFSKE  165 (301)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHh
Confidence            367899999999999999999875


No 217
>cd07235 MRD Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.
Probab=56.05  E-value=21  Score=17.66  Aligned_cols=21  Identities=24%  Similarity=0.194  Sum_probs=18.3

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |.+.++.+++.+.|++.|...
T Consensus        74 ~~~~~dvd~~~~~l~~~G~~~   94 (122)
T cd07235          74 CETPAEVDALYAELVGAGYPG   94 (122)
T ss_pred             cCCHHHHHHHHHHHHHCCCCc
Confidence            678899999999999999753


No 218
>PF05853 DUF849:  Prokaryotic protein of unknown function (DUF849);  InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function.; PDB: 3C6C_A 2Y7G_B 2Y7F_B 2Y7D_D 2Y7E_B 3LOT_A 3FA5_B 3NO5_C 3E02_A 3E49_B ....
Probab=55.93  E-value=19  Score=21.92  Aligned_cols=26  Identities=15%  Similarity=0.184  Sum_probs=19.1

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .+|.|+-..++++++.++++|....+
T Consensus       119 ~~~~n~~~~~~~~~~~~~e~Gi~pe~  144 (272)
T PF05853_consen  119 RVYINTPADARELARRMRERGIKPEI  144 (272)
T ss_dssp             SEE---HHHHHHHHHHHHHTT-EEEE
T ss_pred             ceecCCHHHHHHHHHHHHHcCCeEEE
Confidence            47999999999999999999987543


No 219
>PRK07478 short chain dehydrogenase; Provisional
Probab=55.82  E-value=35  Score=19.10  Aligned_cols=27  Identities=11%  Similarity=0.201  Sum_probs=20.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ++++.+++....+.+.+.|++.|.+..
T Consensus        32 ~v~~~~r~~~~~~~~~~~~~~~~~~~~   58 (254)
T PRK07478         32 KVVVGARRQAELDQLVAEIRAEGGEAV   58 (254)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhcCCcEE
Confidence            567778888888888888887765543


No 220
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=55.64  E-value=32  Score=19.04  Aligned_cols=27  Identities=15%  Similarity=-0.052  Sum_probs=21.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-.+..+....++++|.++|++.+.++
T Consensus        95 V~~d~~~a~~~~~~~l~~~g~~~i~~i  121 (265)
T cd06290          95 IAVDNFQGGYLATQHLIDLGHRRIAHI  121 (265)
T ss_pred             EEECcHHHHHHHHHHHHHCCCCeEEEE
Confidence            556777788888999999998877665


No 221
>PRK03341 arginine repressor; Provisional
Probab=55.54  E-value=24  Score=20.50  Aligned_cols=23  Identities=22%  Similarity=0.348  Sum_probs=20.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +.++|.|++.++++.+.+.|.+.
T Consensus       142 DTIlvi~~~~~~a~~l~~~i~~~  164 (168)
T PRK03341        142 DTVLVIARDPMTGAELAARLLRL  164 (168)
T ss_pred             CEEEEEeCCHHHHHHHHHHHHhh
Confidence            46899999999999999999876


No 222
>PRK05066 arginine repressor; Provisional
Probab=55.46  E-value=26  Score=20.10  Aligned_cols=23  Identities=13%  Similarity=0.128  Sum_probs=20.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +-++|-|+..++++++.+.|.+.
T Consensus       129 DTilVi~~~~~~a~~l~~~l~~~  151 (156)
T PRK05066        129 DTIFITPASGFTIKELLEAILEL  151 (156)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHH
Confidence            45899999999999999998764


No 223
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=55.35  E-value=21  Score=17.91  Aligned_cols=21  Identities=10%  Similarity=0.088  Sum_probs=17.9

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |.++++++.+.+.|.++|...
T Consensus        76 v~~~~~vd~~~~~l~~~G~~i   96 (124)
T cd09012          76 ADSREEVDELVEKALAAGGKE   96 (124)
T ss_pred             CCCHHHHHHHHHHHHHCCCcc
Confidence            667889999999999998753


No 224
>KOG0340|consensus
Probab=55.19  E-value=16  Score=24.65  Aligned_cols=25  Identities=16%  Similarity=0.200  Sum_probs=22.7

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++||+.|++-+=++++.+...|.-+
T Consensus        78 alvlTPTrELA~QiaEQF~alGk~l  102 (442)
T KOG0340|consen   78 ALVLTPTRELALQIAEQFIALGKLL  102 (442)
T ss_pred             EEEecchHHHHHHHHHHHHHhcccc
Confidence            7999999999999999999988754


No 225
>PF12724 Flavodoxin_5:  Flavodoxin domain
Probab=54.31  E-value=10  Score=20.36  Aligned_cols=19  Identities=16%  Similarity=0.024  Sum_probs=15.7

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      -|||.-|+.|++.|.+.+.
T Consensus         9 G~Tk~~A~~ia~~l~~~~~   27 (143)
T PF12724_consen    9 GNTKKIAEWIAEKLGEEGE   27 (143)
T ss_pred             chHHHHHHHHHHHHhhhcc
Confidence            3789999999999987754


No 226
>PRK00033 clpS ATP-dependent Clp protease adaptor protein ClpS; Reviewed
Probab=54.21  E-value=33  Score=18.52  Aligned_cols=26  Identities=8%  Similarity=-0.032  Sum_probs=21.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++|..-+++.|+..++.|+..|-.
T Consensus        69 G~avv~~~~~e~AE~~~~~l~~~~L~   94 (100)
T PRK00033         69 GKAVVGVCTREVAETKVEQVHQHGLL   94 (100)
T ss_pred             CcEEEEEEcHHHHHHHHHHHHcCCCe
Confidence            47888888999999999999666654


No 227
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species. This group includes the ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species. CcpB is 30% identical in sequence to CcpA which functions as the major transcriptional regulator of carbon catabolite repression/regulation (CCR), a process in which enzymes necessary for the metabolism of alternative sugars are inhibited in the presence of glucose. Like CcpA, the DNA-binding protein CcpB exerts its catabolite-repressing effect by a mechanism dependent on the presence of HPr(Ser-P), the small phosphocarrier proteins of the phosphoenolpyruvate-sugar phosphotransferase system, but with a less significant degree.
Probab=54.08  E-value=36  Score=18.75  Aligned_cols=28  Identities=18%  Similarity=0.145  Sum_probs=22.3

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .|-++..+.+..++++|.+.|++.+-++
T Consensus        93 ~v~~d~~~~~~~~~~~l~~~g~~~i~~i  120 (260)
T cd06286          93 SVYIDHYEAFYEALKYLIQKGYRKIAYC  120 (260)
T ss_pred             EEEECChHHHHHHHHHHHHCCCceEEEE
Confidence            4667778888888999999998887664


No 228
>PRK06646 DNA polymerase III subunit chi; Provisional
Probab=54.04  E-value=40  Score=19.23  Aligned_cols=30  Identities=7%  Similarity=0.114  Sum_probs=22.8

Q ss_pred             ceEEEEecch---hhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTK---LDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK---~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++|++.+.-   ..|+.-.+.++.+|...+|+
T Consensus       110 ~RVi~vv~d~e~~~~ar~~w~~~k~~~~~~~yw  142 (154)
T PRK06646        110 KRIIIITDLPEDLKELTVKINKFTGQENKIDCF  142 (154)
T ss_pred             CEEEEEeCChHHHHHHHHHHHHHHhCCCcceEe
Confidence            5777777643   34667778899999999986


No 229
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=53.92  E-value=29  Score=17.73  Aligned_cols=25  Identities=16%  Similarity=0.264  Sum_probs=21.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++||.+.|+..+.++.+.+.+.+.
T Consensus        55 ~~~l~~~p~~~~~~~~~~~~~~~~~   79 (201)
T smart00487       55 KRVLVLVPTRELAEQWAEELKKLGP   79 (201)
T ss_pred             CcEEEEeCCHHHHHHHHHHHHHHhc
Confidence            3689999999999999999988774


No 230
>KOG0350|consensus
Probab=53.82  E-value=20  Score=25.23  Aligned_cols=22  Identities=23%  Similarity=0.456  Sum_probs=20.3

Q ss_pred             CceEEEEecchhhHHHHHHHHH
Q psy8719           1 MDRALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~   22 (33)
                      +.+.|+|+|.-..+.+|+.-|+
T Consensus       429 ~~r~lcf~~S~~sa~Rl~~~L~  450 (620)
T KOG0350|consen  429 LNRTLCFVNSVSSANRLAHVLK  450 (620)
T ss_pred             cceEEEEecchHHHHHHHHHHH
Confidence            4689999999999999999987


No 231
>PF07775 PaRep2b:  PaRep2b protein;  InterPro: IPR011689 This is a group of proteins, expressed in the crenarchaeon Pyrobaculum aerophilum, whose members are variable in length and level of conservation. The presence of numerous frameshifts and internal stop codons in multiple alignments are thought to indicate that most family members are no longer functional [].
Probab=53.62  E-value=18  Score=24.94  Aligned_cols=23  Identities=13%  Similarity=0.255  Sum_probs=21.0

Q ss_pred             EEEecchhhHHHHHHHHHhcCCc
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ..|.-+|+.|++||.-|++.|..
T Consensus       110 a~F~gsRE~AErlAsILrAlG~~  132 (512)
T PF07775_consen  110 AQFGGSREKAERLASILRALGAE  132 (512)
T ss_pred             EEecccHHHHHHHHHHHHhcCCe
Confidence            57999999999999999999975


No 232
>cd03714 RT_DIRS1 RT_DIRS1: Reverse transcriptases (RTs) occurring in the DIRS1 group of retransposons. Members of the subfamily include the Dictyostelium DIRS-1, Volvox carteri kangaroo, and Panagrellus redivivus PAT elements. These elements differ from LTR and conventional non-LTR retrotransposons. They contain split direct repeat (SDR) termini, and have been proposed to integrate via double-stranded closed-circle DNA intermediates assisted by an encoded recombinase which is similar to gamma-site-specific integrase.
Probab=53.31  E-value=28  Score=17.94  Aligned_cols=21  Identities=24%  Similarity=0.289  Sum_probs=16.5

Q ss_pred             ceEEEEecchhhHHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYLN   22 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~   22 (33)
                      +-.+|+++|++.++++...|.
T Consensus        68 DDili~~~~~~~~~~~~~~l~   88 (119)
T cd03714          68 DDLLIIASSIKTSEAVLRHLR   88 (119)
T ss_pred             cCeEEEeCcHHHHHHHHHHHH
Confidence            446899999888888877765


No 233
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism]
Probab=53.11  E-value=12  Score=22.52  Aligned_cols=20  Identities=10%  Similarity=0.114  Sum_probs=16.9

Q ss_pred             cchhhHHHHHHHHHhcCCce
Q psy8719           9 RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~   28 (33)
                      +|++-|+.+|..|++.|++-
T Consensus        13 qT~kIA~~iA~~L~e~g~qv   32 (175)
T COG4635          13 QTRKIAEYIASHLRESGIQV   32 (175)
T ss_pred             cHHHHHHHHHHHhhhcCCee
Confidence            57888999999999988763


No 234
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=53.06  E-value=36  Score=18.90  Aligned_cols=28  Identities=18%  Similarity=0.095  Sum_probs=22.2

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .|-.+-...+..+++.|.++|++.+.++
T Consensus       101 ~V~~d~~~~~~~~~~~l~~~g~~~i~~i  128 (273)
T cd06292         101 HVSTDDALAMRLAVRHLVALGHRRIGFA  128 (273)
T ss_pred             EEEECcHHHHHHHHHHHHHCCCceEEEE
Confidence            3556667778889999999999887765


No 235
>PRK07308 flavodoxin; Validated
Probab=53.06  E-value=13  Score=19.87  Aligned_cols=20  Identities=15%  Similarity=0.147  Sum_probs=16.3

Q ss_pred             cchhhHHHHHHHHHhcCCce
Q psy8719           9 RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~   28 (33)
                      ||+.-|+.|++.|.+.|...
T Consensus        14 nTe~iA~~ia~~l~~~g~~~   33 (146)
T PRK07308         14 NTEEIADIVADKLRELGHDV   33 (146)
T ss_pred             hHHHHHHHHHHHHHhCCCce
Confidence            68888999999998887653


No 236
>TIGR00341 conserved hypothetical protein TIGR00341. This conserved hypothetical protein is found so far only in three archaeal genomes and in Streptomyces coelicolor. It shares a hydrophobic uncharacterized domain (see model TIGR00271) of about 180 residues with several eubacterial proteins, including the much longer protein sll1151 of Synechocystis PCC6803.
Probab=52.99  E-value=25  Score=22.58  Aligned_cols=26  Identities=8%  Similarity=-0.001  Sum_probs=23.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+.|+..++++|++-+.|++.|-+.
T Consensus        43 ~~i~~~v~~~~~e~vld~L~~lgl~~   68 (325)
T TIGR00341        43 DRIELYVQDSDTEKIVSRLKDKLLGY   68 (325)
T ss_pred             eEEEEEcChhhHHHHHHHHHHcCCCC
Confidence            67899999999999999999997654


No 237
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional
Probab=52.95  E-value=33  Score=19.99  Aligned_cols=27  Identities=4%  Similarity=-0.066  Sum_probs=21.6

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++-...+..++++|.++|++.+.|+
T Consensus       154 V~~D~~~~~~~a~~~l~~~G~~~i~~i  180 (327)
T PRK10339        154 VDIDLARISKEIIDFYINQGVNRIGFI  180 (327)
T ss_pred             EEECHHHHHHHHHHHHHHCCCCeEEEe
Confidence            556667778889999999999887765


No 238
>PF00542 Ribosomal_L12:  Ribosomal protein L7/L12 C-terminal domain;  InterPro: IPR013823 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents the C-terminal domain of the large subunit ribosomal proteins, known as the L7/L12 family. L7/L12 is present in each 50S subunit in four copies organised as two dimers. The L8 protein complex consisting of two dimers of L7/L12 and L10 in Escherichia coli ribosomes is assembled on the conserved region of 23 S rRNA termed the GTPase-associated domain []. The L7/L12 dimer probably interacts with EF-Tu. L7 and L12 only differ in a single post translational modification of the addition of an acetyl group to the N terminus of L7.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1DD4_B 1DD3_A 1RQU_B 2GYA_5 2GYC_5 1RQS_A 1RQV_A 1CTF_A 2XUX_L.
Probab=52.83  E-value=14  Score=18.55  Aligned_cols=23  Identities=9%  Similarity=0.198  Sum_probs=17.3

Q ss_pred             EEEecchhhHHHHHHHHHhcCCc
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      |.=.-+|++|+.+.+.|...|..
T Consensus        42 ik~~v~keeAe~ik~~Le~aGa~   64 (68)
T PF00542_consen   42 IKEGVSKEEAEEIKKKLEAAGAK   64 (68)
T ss_dssp             EEEEE-HHHHHHHHHHHHCCT-E
T ss_pred             HHcCCCHHHHHHHHHHHHHcCCE
Confidence            33356799999999999999975


No 239
>PF00903 Glyoxalase:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein.;  InterPro: IPR004360 Glyoxalase I (4.4.1.5 from EC) (lactoylglutathione lyase) catalyzes the first step of the glyoxal pathway. S-lactoylglutathione is then converted by glyoxalase II to lactic acid []. Glyoxalase I is an ubiquitous enzyme which binds one mole of zinc per subunit. The bacterial and yeast enzymes are monomeric while the mammalian one is homodimeric. The sequence of glyoxalase I is well conserved. The domain represented by this entry is found in glyoxalase I and in other related proteins, including fosfomycin resistance proteins FosB [], FosA [], FosX [] and dioxygenases (eg. 4-hydroxyphenylpyruvate dioxygenase).; PDB: 1CJX_A 1NPB_E 3OJT_C 3OJN_A 2IG9_B 3OJJ_B 3OJK_D 1Q0C_D 1F1X_C 3BZA_B ....
Probab=52.46  E-value=27  Score=16.79  Aligned_cols=25  Identities=12%  Similarity=0.005  Sum_probs=20.8

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .-.++.+-++.+++.+.|++.|.+.
T Consensus        77 i~~~~~~~~dl~~~~~~l~~~g~~~  101 (128)
T PF00903_consen   77 IAFLAFDVDDLDAAYERLKAQGVEI  101 (128)
T ss_dssp             EEEEESSHHHHHHHHHHHHHTTGEE
T ss_pred             EEEEeccHHHHHHHHHHHhhcCccE
Confidence            3467889999999999999999653


No 240
>PF01488 Shikimate_DH:  Shikimate / quinate 5-dehydrogenase;  InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases. Shikimate 5-dehydrogenase (1.1.1.25 from EC) catalyses the conversion of shikimate to 5-dehydroshikimate [, ]. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids []. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites, 3-dehydroquinate and dehydroshikimate. Glutamyl-tRNA reductase (1.2.1.70 from EC) catalyzes the first step of tetrapyrrole biosynthesis in plants, archaea and most bacteria. The dimeric enzyme has an unusual V-shaped architecture where each monomer consists of three domains linked by a long 'spinal' alpha-helix. The central catalytic domain specifically recognises the glutamate moiety of the substrate []. ; PDB: 2EV9_B 2CY0_B 1WXD_A 2D5C_A 1NVT_B 2EGG_A 3PWZ_A 3DOO_A 3DON_A 3FBT_C ....
Probab=52.45  E-value=33  Score=18.35  Aligned_cols=20  Identities=20%  Similarity=0.189  Sum_probs=18.0

Q ss_pred             ceEEEEecchhhHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYL   21 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L   21 (33)
                      ++..|+-||.+.+++|++.+
T Consensus        37 ~~i~i~nRt~~ra~~l~~~~   56 (135)
T PF01488_consen   37 KEITIVNRTPERAEALAEEF   56 (135)
T ss_dssp             SEEEEEESSHHHHHHHHHHH
T ss_pred             CEEEEEECCHHHHHHHHHHc
Confidence            46789999999999999999


No 241
>smart00049 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin. Domain of unknown function present in signalling proteins that contain PH, rasGEF, rhoGEF, rhoGAP, RGS, PDZ domains. DEP domain in Drosophila dishevelled is essential to rescue planar polarity defects and induce JNK signalling (Cell 94, 109-118).
Probab=52.29  E-value=18  Score=17.39  Aligned_cols=20  Identities=10%  Similarity=-0.074  Sum_probs=17.0

Q ss_pred             EecchhhHHHHHHHHHhcCC
Q psy8719           7 FCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~   26 (33)
                      .+.++.+|.++++.|-+.|.
T Consensus        35 ~~~~r~eA~~l~~~ll~~g~   54 (77)
T smart00049       35 EIIDREEAVHLGQLLLDEGL   54 (77)
T ss_pred             CcCCHHHHHHHHHHHHHCCC
Confidence            46789999999999988774


No 242
>PLN02723 3-mercaptopyruvate sulfurtransferase
Probab=52.10  E-value=34  Score=21.04  Aligned_cols=28  Identities=14%  Similarity=0.151  Sum_probs=23.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      +.+|++|++=..+-.++-.|+..|....
T Consensus       270 ~~iv~yC~sG~~A~~~~~~L~~~G~~~v  297 (320)
T PLN02723        270 SPIVASCGTGVTACILALGLHRLGKTDV  297 (320)
T ss_pred             CCEEEECCcHHHHHHHHHHHHHcCCCCe
Confidence            3689999999999999999999998644


No 243
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=52.05  E-value=24  Score=17.99  Aligned_cols=24  Identities=13%  Similarity=0.073  Sum_probs=19.5

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |-| +.++.+.+++.+.|+++|.+.
T Consensus        63 iaf~v~~~~dv~~~~~~l~~~G~~~   87 (124)
T cd08361          63 SGFELRDDDALESAATELEQYGHEV   87 (124)
T ss_pred             EEEEECCHHHHHHHHHHHHHcCCce
Confidence            344 678889999999999999763


No 244
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=51.99  E-value=27  Score=18.96  Aligned_cols=24  Identities=17%  Similarity=0.224  Sum_probs=20.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++||.|+|++-+.+.++.+++.+.
T Consensus        71 ~viii~p~~~L~~q~~~~~~~~~~   94 (203)
T cd00268          71 QALILAPTRELALQIAEVARKLGK   94 (203)
T ss_pred             eEEEEcCCHHHHHHHHHHHHHHhc
Confidence            689999999999999888876643


No 245
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=51.88  E-value=43  Score=20.72  Aligned_cols=29  Identities=14%  Similarity=0.118  Sum_probs=19.2

Q ss_pred             CceEEEEecchh-----hHHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKL-----DCDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~-----~ad~La~~L~~~G~~~~   29 (33)
                      |.++.||.|+..     .++++.++|+++|.+..
T Consensus         4 ~~~v~iv~~~~k~~a~e~~~~i~~~L~~~giev~   37 (295)
T PRK01231          4 FRNIGLIGRLGSSSVVETLRRLKDFLLDRGLEVI   37 (295)
T ss_pred             CCEEEEEecCCCHHHHHHHHHHHHHHHHCCCEEE
Confidence            346788888533     45567777877876644


No 246
>PRK14615 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=51.80  E-value=26  Score=21.33  Aligned_cols=25  Identities=12%  Similarity=0.149  Sum_probs=21.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++.++++++.++++++.|++.|..
T Consensus       266 tvfaL~~~~~~a~~i~~~l~~~g~~  290 (296)
T PRK14615        266 SVFGLFRRRAQAEAAFEMLKGHNIR  290 (296)
T ss_pred             ceEEEeCCHHHHHHHHHHHhhhccc
Confidence            4677889999999999999998654


No 247
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed
Probab=51.67  E-value=29  Score=23.67  Aligned_cols=28  Identities=11%  Similarity=0.101  Sum_probs=24.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      ..|+.++.+.+++++++.|++.|..-..
T Consensus         4 ~~VLVTRp~~qa~~la~~L~~~G~~vi~   31 (656)
T PRK06975          4 FTVVVTRPDGQSAALAAQLAAAGLDVLD   31 (656)
T ss_pred             CEEEEeCcHhHHHHHHHHHHHcCCCEEE
Confidence            3588899999999999999999987654


No 248
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=51.66  E-value=26  Score=19.90  Aligned_cols=24  Identities=13%  Similarity=0.301  Sum_probs=20.3

Q ss_pred             CceEEEEecchhhHHHHHHHHHhc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +++.|+.+-|+..|+++-+.|...
T Consensus        45 ~~~Il~lTft~~aa~e~~~ri~~~   68 (315)
T PF00580_consen   45 PERILVLTFTNAAAQEMRERIREL   68 (315)
T ss_dssp             GGGEEEEESSHHHHHHHHHHHHHH
T ss_pred             hHHheecccCHHHHHHHHHHHHHh
Confidence            467899999999999998888764


No 249
>PRK06756 flavodoxin; Provisional
Probab=51.35  E-value=14  Score=19.78  Aligned_cols=20  Identities=10%  Similarity=0.238  Sum_probs=16.4

Q ss_pred             cchhhHHHHHHHHHhcCCce
Q psy8719           9 RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~   28 (33)
                      ||+.-|+.+++.|++.|...
T Consensus        14 nTe~vA~~ia~~l~~~g~~v   33 (148)
T PRK06756         14 NTEEMADHIAGVIRETENEI   33 (148)
T ss_pred             hHHHHHHHHHHHHhhcCCeE
Confidence            78888999999998877653


No 250
>PRK07589 ornithine cyclodeaminase; Validated
Probab=51.31  E-value=36  Score=21.58  Aligned_cols=28  Identities=14%  Similarity=0.204  Sum_probs=23.2

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++++.||-++.+.++.+++.+++.|.+.
T Consensus       154 i~~V~v~~r~~~~a~~~~~~~~~~~~~v  181 (346)
T PRK07589        154 IEEIRLYDIDPAATAKLARNLAGPGLRI  181 (346)
T ss_pred             ceEEEEEeCCHHHHHHHHHHHHhcCCcE
Confidence            3688999999999999999998765443


No 251
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional
Probab=51.12  E-value=37  Score=22.15  Aligned_cols=30  Identities=13%  Similarity=0.176  Sum_probs=25.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +..|++|++=..+...+..|++.|....+-
T Consensus       450 ~~iivyC~~G~rS~~aa~~L~~~G~~nv~~  479 (482)
T PRK01269        450 KTYLLYCDRGVMSRLQALYLREQGFSNVKV  479 (482)
T ss_pred             CeEEEECCCCHHHHHHHHHHHHcCCccEEe
Confidence            358999999999999999999999876553


No 252
>PF14487 DUF4433:  Domain of unknown function (DUF4433)
Probab=51.00  E-value=26  Score=19.97  Aligned_cols=23  Identities=17%  Similarity=0.157  Sum_probs=20.9

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |+|.+++..++|...|...|.+.
T Consensus       173 I~v~s~~~~~~v~~~l~~~~~~~  195 (205)
T PF14487_consen  173 IGVYSDEVKDQVESLLRAAGHQI  195 (205)
T ss_pred             EEECCHHHHHHHHHHHHhcCCCC
Confidence            78999999999999999999664


No 253
>TIGR01753 flav_short flavodoxin, short chain. Flavodoxins are small redox-active proteins with a flavin mononucleotide (FMN) prosthetic group. They can act in nitrogen fixation by nitrogenase, in sulfite reduction, and light-dependent NADP+ reduction in during photosynthesis, among other roles. This model describes the short chain type. Many of these are involved in sulfite reduction.
Probab=50.85  E-value=15  Score=18.92  Aligned_cols=20  Identities=10%  Similarity=-0.007  Sum_probs=16.4

Q ss_pred             ecchhhHHHHHHHHHhcCCc
Q psy8719           8 CRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~   27 (33)
                      -||+.-|+.+++.|...|..
T Consensus        10 GnT~~~A~~i~~~~~~~g~~   29 (140)
T TIGR01753        10 GNTEEMANIIAEGLKEAGAE   29 (140)
T ss_pred             cHHHHHHHHHHHHHHhcCCe
Confidence            37888999999999887765


No 254
>PF02629 CoA_binding:  CoA binding domain;  InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.; GO: 0005488 binding; PDB: 3IL2_B 3IKT_A 3IKV_B 2SCU_D 1JKJ_D 2NU7_A 1CQI_A 1JLL_A 2NU8_D 1SCU_D ....
Probab=50.79  E-value=33  Score=17.34  Aligned_cols=31  Identities=23%  Similarity=0.165  Sum_probs=21.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      +-+|+++.. ..+.+.++.|-+.|..-+.=||
T Consensus        64 ~iaii~VP~-~~a~~~~~~~~~~gIk~i~nft   94 (96)
T PF02629_consen   64 DIAIITVPA-EAAQEVADELVEAGIKGIVNFT   94 (96)
T ss_dssp             SEEEEES-H-HHHHHHHHHHHHTT-SEEEEES
T ss_pred             CEEEEEcCH-HHHHHHHHHHHHcCCCEEEEeC
Confidence            446777754 5588888888889988776654


No 255
>COG0213 DeoA Thymidine phosphorylase [Nucleotide transport and metabolism]
Probab=50.76  E-value=9.2  Score=25.74  Aligned_cols=23  Identities=26%  Similarity=0.391  Sum_probs=19.5

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .||.|.+++++||+.+.+-|.++
T Consensus       207 Afmkt~~~a~~LA~~mv~ig~~~  229 (435)
T COG0213         207 AFMKTVEDARELAKAMVEIGKGL  229 (435)
T ss_pred             CccCCHHHHHHHHHHHHHHHHhc
Confidence            39999999999999998776543


No 256
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=50.70  E-value=37  Score=23.08  Aligned_cols=23  Identities=13%  Similarity=0.216  Sum_probs=18.0

Q ss_pred             ceEEEEecc--------hhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRT--------KLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nT--------K~~ad~La~~L~~~   24 (33)
                      .|++|||++        ...++.+++.|.+.
T Consensus       472 ~q~~v~~~~ie~s~~l~~~~~~~~~~~L~~~  502 (681)
T PRK10917        472 RQAYVVCPLIEESEKLDLQSAEETYEELQEA  502 (681)
T ss_pred             CcEEEEEcccccccchhHHHHHHHHHHHHHH
Confidence            489999995        45677888888876


No 257
>cd02553 PseudoU_synth_RsuA PseudoU_synth_RsuA: Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.
Probab=50.37  E-value=20  Score=19.99  Aligned_cols=27  Identities=11%  Similarity=0.022  Sum_probs=19.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++.+..+.+  .+...++.|.
T Consensus        48 Glll~ak~~~~~~~l~~--~~~~i~K~Y~   74 (167)
T cd02553          48 GLLLLTNDGQLAHRLTS--PKKHVPKTYE   74 (167)
T ss_pred             EEEEEEeCHHHHHHhhC--CcCCCceEEE
Confidence            46899999988777765  3555667665


No 258
>PF02971 FTCD:  Formiminotransferase domain;  InterPro: IPR013802 The formiminotransferase (FT) domain of formiminotransferase-cyclodeaminase (FTCD) forms a homodimer, with each protomer being comprised of two subdomains. The formiminotransferase domain has an N-terminal subdomain that is made up of a six-stranded mixed beta-pleated sheet and five alpha helices, which are arranged on the external surface of the beta sheet. This, in turn, faces the beta-sheet of the C-terminal subdomain to form a double beta-sheet layer. The two subdomains are separated by a short linker sequence, which is not thought to be any more flexible than the remainder of the molecule. The substrate is predicted to form a number of contacts with residues found in both the N-terminal and C-terminal subdomains []. In humans, deficiency of this enzyme results in a disease phenotype [].  This entry represents the C-terminal subdomain of the formiminotransferase domain.; GO: 0005542 folic acid binding, 0016740 transferase activity, 0008152 metabolic process; PDB: 1QD1_B 2PFD_C.
Probab=50.22  E-value=10  Score=22.07  Aligned_cols=18  Identities=11%  Similarity=0.078  Sum_probs=15.6

Q ss_pred             ecchhhHHHHHHHHHhcC
Q psy8719           8 CRTKLDCDNLERYLNSID   25 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G   25 (33)
                      -.|++.|.++|..++..|
T Consensus        10 l~T~~iA~~IA~~iR~sg   27 (145)
T PF02971_consen   10 LTTKEIAKKIAKAIRESG   27 (145)
T ss_dssp             SS-HHHHHHHHHHHCTTT
T ss_pred             CCcHHHHHHHHHHHHhcC
Confidence            368899999999999999


No 259
>PRK10423 transcriptional repressor RbsR; Provisional
Probab=50.19  E-value=44  Score=19.24  Aligned_cols=28  Identities=25%  Similarity=0.139  Sum_probs=22.0

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .|-.+-......++++|.+.|++.+.|+
T Consensus       153 ~v~~d~~~~~~~a~~~L~~~G~~~I~~i  180 (327)
T PRK10423        153 LIQDNSLLGGDLATQYLIDKGYTRIACI  180 (327)
T ss_pred             EEEEChHHHHHHHHHHHHHcCCCeEEEE
Confidence            3556666778889999999999988765


No 260
>KOG2501|consensus
Probab=49.98  E-value=22  Score=20.84  Aligned_cols=23  Identities=17%  Similarity=0.420  Sum_probs=20.3

Q ss_pred             EEEEecchhhHHHHHHHHHhcCC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      -|||+.+-.+.+.+.+++..+++
T Consensus        70 EVvfVS~D~~~~~~~~y~~~~~~   92 (157)
T KOG2501|consen   70 EVVFVSSDRDEESLDEYMLEHHG   92 (157)
T ss_pred             EEEEEecCCCHHHHHHHHHhcCC
Confidence            48999999999999999997554


No 261
>cd03715 RT_ZFREV_like RT_ZFREV_like: A subfamily of reverse transcriptases (RTs) found in sequences similar to the intact endogenous retrovirus ZFERV from zebrafish and to Moloney murine leukemia virus RT.  An RT gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. RTs occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. These elements can be divided into two major groups. One group contains retroviruses and DNA viruses whose propagation involves an RNA intermediate. They are grouped together with transposable elements containing long terminal repeats (LTRs). The other group, also called poly(A)-type retrotransposons, contain fungal mitochondrial introns and transposable elements that lack LTRs. Phylogenetic analysis suggests that  ZFERV belongs to a distinct group of retroviruses.
Probab=49.69  E-value=36  Score=19.22  Aligned_cols=27  Identities=22%  Similarity=0.356  Sum_probs=20.1

Q ss_pred             ceEEEEecchhhHH----HHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCD----NLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad----~La~~L~~~G~~~   28 (33)
                      +-.||+.+|.+++.    .|-+.|++.|...
T Consensus       161 DDili~s~~~~e~~~~l~~v~~~l~~~gl~l  191 (210)
T cd03715         161 DDLLLAADSEEDCLKGTDALLTHLGELGYKV  191 (210)
T ss_pred             CcEEEecCCHHHHHHHHHHHHHHHHHCCCCc
Confidence            45789999988877    6667777777643


No 262
>PF13616 Rotamase_3:  PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A.
Probab=49.65  E-value=24  Score=18.50  Aligned_cols=22  Identities=18%  Similarity=0.199  Sum_probs=16.9

Q ss_pred             EEEecc-----------hhhHHHHHHHHHhcCCc
Q psy8719           5 LIFCRT-----------KLDCDNLERYLNSIDRR   27 (33)
Q Consensus         5 IVF~nT-----------K~~ad~La~~L~~~G~~   27 (33)
                      -||+++           |..++.|.+.|+ .|-.
T Consensus        20 ~I~i~~~~~~~~~~~~ak~~a~~i~~~l~-~G~d   52 (117)
T PF13616_consen   20 HILIPVPDASSRSKEEAKKKADSILKQLK-SGAD   52 (117)
T ss_dssp             EEEESS-----------HHHHHHHHHHHH-CTCC
T ss_pred             EEEEeccccccchhHHHHHHHHHHHHHHH-CCCC
Confidence            577777           888999998888 5544


No 263
>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase, ERG8-type, Gram-positive branch. This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the animal type and this ERG8 type. This model represents the low GC Gram-positive organism forms of the ERG8 type of phosphomevalonate kinase.
Probab=49.63  E-value=38  Score=21.17  Aligned_cols=26  Identities=4%  Similarity=0.014  Sum_probs=22.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      -+|.+++...++++|.+.|+++|..-
T Consensus       324 ~~ial~~~~~~~~~~~~~~~~~G~~~  349 (358)
T TIGR01220       324 CGIAILDAEADITHVRQRWETAGILP  349 (358)
T ss_pred             EEEEEeCCchhHHHHHHHHHHCCCeE
Confidence            35778988999999999999999654


No 264
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative. This model represents a family of proteins in Gram-positive bacteria. The N-terminal region of about 200 amino acids resembles the epsilon subunit of E. coli DNA polymerase III and the homologous region of the Gram-positive type DNA polymerase III alpha subunit. The epsilon subunit contains an exonuclease domain. The remainder of this protein family resembles a predicted ATP-dependent helicase, the DNA damage-inducible protein DinG of E. coli.
Probab=49.53  E-value=27  Score=24.26  Aligned_cols=22  Identities=14%  Similarity=0.096  Sum_probs=20.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++|||+++....+.+++.|..
T Consensus       675 g~~LVlftS~~~l~~v~~~L~~  696 (850)
T TIGR01407       675 PKILVLFTSYEMLHMVYDMLNE  696 (850)
T ss_pred             CCEEEEeCCHHHHHHHHHHHhh
Confidence            5799999999999999999976


No 265
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the represso
Probab=49.52  E-value=43  Score=18.37  Aligned_cols=27  Identities=15%  Similarity=0.101  Sum_probs=19.1

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |.++........+++|.+.|++.+-++
T Consensus       100 V~~d~~~~~~~a~~~l~~~g~~~i~~i  126 (268)
T cd06271         100 VDFDNEAAAYQAVRRLIALGHRRIALL  126 (268)
T ss_pred             EeeCcHHHHHHHHHHHHHcCCCcEEEe
Confidence            556666777777888887787776654


No 266
>PHA02558 uvsW UvsW helicase; Provisional
Probab=49.18  E-value=29  Score=22.47  Aligned_cols=23  Identities=13%  Similarity=0.066  Sum_probs=21.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++||.|+|++-++++.+.|++.+
T Consensus       160 ~vLilvpt~eL~~Q~~~~l~~~~  182 (501)
T PHA02558        160 KVLIIVPTTSLVTQMIDDFVDYR  182 (501)
T ss_pred             eEEEEECcHHHHHHHHHHHHHhc
Confidence            79999999999999999998765


No 267
>PRK05569 flavodoxin; Provisional
Probab=49.17  E-value=16  Score=19.25  Aligned_cols=19  Identities=0%  Similarity=0.001  Sum_probs=16.0

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ||+.-|+.+++.|.+.|..
T Consensus        14 nT~~iA~~i~~~~~~~g~~   32 (141)
T PRK05569         14 NVEVLANTIADGAKEAGAE   32 (141)
T ss_pred             HHHHHHHHHHHHHHhCCCe
Confidence            7889999999999887754


No 268
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. This group represents the ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of GntR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding, 
Probab=49.09  E-value=44  Score=18.32  Aligned_cols=27  Identities=15%  Similarity=0.044  Sum_probs=19.8

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |..+-...+..++++|.+.|++.+.++
T Consensus        96 v~~d~~~~~~~~~~~l~~~g~~~i~~i  122 (268)
T cd01575          96 VGFSHAEAGRAMARHLLARGYRRIGFL  122 (268)
T ss_pred             EEeCcHHHHHHHHHHHHHCCCCcEEEe
Confidence            555667777788888888888776654


No 269
>PRK13909 putative recombination protein RecB; Provisional
Probab=48.90  E-value=29  Score=24.36  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=23.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc-CCcee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI-DRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~-G~~~~   29 (33)
                      +...|-|+|+.++..+++.|.+. |....
T Consensus       472 ~dIaILvR~~~~~~~l~~~L~~~~gIP~~  500 (910)
T PRK13909        472 DDIAILCWTNDDALEIKEFLQEQFGIKAV  500 (910)
T ss_pred             CCEEEEEecCccHHHHHHHHHhcCCCCEE
Confidence            45678899999999999999999 87653


No 270
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional
Probab=48.76  E-value=45  Score=19.60  Aligned_cols=27  Identities=15%  Similarity=0.094  Sum_probs=21.3

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++........+++|.+.|++.+.|+
T Consensus       156 V~~D~~~~~~~a~~~L~~~G~~~I~~i  182 (346)
T PRK10401        156 VCLDNVSGARMATRMLLNNGHQRIGYL  182 (346)
T ss_pred             EEECcHHHHHHHHHHHHHCCCCeEEEE
Confidence            455667778888899999999888765


No 271
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=48.57  E-value=24  Score=16.17  Aligned_cols=15  Identities=27%  Similarity=0.516  Sum_probs=12.6

Q ss_pred             chhhHHHHHHHHHhc
Q psy8719          10 TKLDCDNLERYLNSI   24 (33)
Q Consensus        10 TK~~ad~La~~L~~~   24 (33)
                      |.++.+.|+.+|+..
T Consensus        76 s~~e~~~l~ayl~sl   90 (91)
T PF00034_consen   76 SDEEIADLAAYLRSL   90 (91)
T ss_dssp             SHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHh
Confidence            678899999999864


No 272
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=48.37  E-value=29  Score=17.11  Aligned_cols=21  Identities=19%  Similarity=0.115  Sum_probs=17.6

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +.+.++.+++.+.|.++|...
T Consensus        72 v~~~~~v~~~~~~l~~~g~~~   92 (125)
T cd07255          72 LPSRADLAAALRRLIELGIPL   92 (125)
T ss_pred             CCCHHHHHHHHHHHHHcCCce
Confidence            467789999999999999753


No 273
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase). This CD includes each of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) which catalyzes the committed step in branched chain amino acid biosynthesis in plants and microorganisms, the pyridoxal 5'-phosphate (PLP)-dependent dehydration/deamination of L-threonine (or L-serine) to 2-ketobutyrate (or pyruvate). ThrD-I is a cooperative, feedback-regulated (isoleucine and valine) allosteric enzyme that forms a tetramer and contains four pyridoxal phosphate moieties. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=48.31  E-value=29  Score=16.40  Aligned_cols=21  Identities=14%  Similarity=0.205  Sum_probs=17.2

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++.+++.+++-+.|++.|...
T Consensus        46 ~~~~~~~~~i~~~L~~~G~~~   66 (68)
T cd04885          46 VPDREDLAELKERLEALGYPY   66 (68)
T ss_pred             eCCHHHHHHHHHHHHHcCCCc
Confidence            456779999999999999753


No 274
>PRK05298 excinuclease ABC subunit B; Provisional
Probab=48.20  E-value=47  Score=22.59  Aligned_cols=31  Identities=16%  Similarity=0.274  Sum_probs=24.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc-CCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI-DRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~-G~~~~~~~   32 (33)
                      .++||-+.++..|+.+++.|... +....+||
T Consensus        58 r~vLIVt~~~~~A~~l~~dL~~~~~~~~v~~f   89 (652)
T PRK05298         58 RPTLVLAHNKTLAAQLYSEFKEFFPENAVEYF   89 (652)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHhcCCCeEEEe
Confidence            36799999999999999999777 55545555


No 275
>PRK09526 lacI lac repressor; Reviewed
Probab=48.16  E-value=46  Score=19.37  Aligned_cols=27  Identities=7%  Similarity=-0.080  Sum_probs=20.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-.+.......++++|.++|++.+.++
T Consensus       161 V~~d~~~~~~~a~~~L~~~G~~~I~~l  187 (342)
T PRK09526        161 VSFDPEDGTRLGVEHLVELGHQRIALL  187 (342)
T ss_pred             EEECcHHHHHHHHHHHHHCCCCeEEEE
Confidence            344556677888899999998887765


No 276
>PF03091 CutA1:  CutA1 divalent ion tolerance protein;  InterPro: IPR004323  The CutA family of proteins which exhibit ion tolerance are found in a large variety of species []. In E.Coli, two operons on the cutA locus contain genes that encode three proteins, CutA1, CutA2 and CutA3. CutA1 proteins are found in the cytoplasm while CutA2 (50kDa) and CutA3 (24kDa) are located in the inner membrane. Although the role of E. Coli CutA1 is not clear, studies on E. coli cutA locus describe some mutations that lead to an increase in copper sensitivity, thus suggesting a role in ion tolerance []. To date, the structure of CutA proteins from several species have been solved [, ]. The crystal structures of the E.Coli and rat CutA1 proteins show both these proteins to be trimeric in the crystal as well as in solution[].Trimerisation seems to supported by the formation of beta sheets between the subunit. This trimeric structure suggests the protein may be involved in signal transduction due to architectural similarities with PII signal transducer proteins []. Recent studies propose that mammalian CutA1 in the neuronal cell membrane acts as an anchor for acetylcholinesterase (AChE)1 [].; GO: 0010038 response to metal ion; PDB: 1O5J_A 1KR4_A 1VHF_A 3GSD_H 1OSC_A 3OPK_A 4E98_C 1V9B_F 1UKU_A 2E66_C ....
Probab=48.11  E-value=43  Score=17.86  Aligned_cols=23  Identities=13%  Similarity=0.235  Sum_probs=18.8

Q ss_pred             EEEEecchhhHHHHHHHHHhcCC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      +++=|.+++.|+++++.|-+.+-
T Consensus         4 v~tT~p~~e~A~~ia~~lve~rL   26 (102)
T PF03091_consen    4 VYTTCPDREEAERIARALVEERL   26 (102)
T ss_dssp             EEEEESSHHHHHHHHHHHHHTTS
T ss_pred             EEEEcCCHHHHHHHHHHHHhCCe
Confidence            44557899999999999988764


No 277
>PF04273 DUF442:  Putative phosphatase (DUF442);  InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function.; GO: 0016787 hydrolase activity; PDB: 2F46_A 3GXH_B 3GXG_B.
Probab=47.68  E-value=27  Score=18.77  Aligned_cols=19  Identities=21%  Similarity=0.310  Sum_probs=14.8

Q ss_pred             ceEEEEecchhhHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERY   20 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~   20 (33)
                      ..+++||+|-.++-.|+..
T Consensus        87 ~Pvl~hC~sG~Ra~~l~~l  105 (110)
T PF04273_consen   87 KPVLAHCRSGTRASALWAL  105 (110)
T ss_dssp             TSEEEE-SCSHHHHHHHHH
T ss_pred             CCEEEECCCChhHHHHHHH
Confidence            4689999999999888754


No 278
>cd01648 TERT TERT: Telomerase reverse transcriptase (TERT). Telomerase is a ribonucleoprotein (RNP) that synthesizes telomeric DNA repeats. The telomerase RNA subunit provides the template for synthesis of these repeats. The catalytic subunit of RNP is known as telomerase reverse transcriptase (TERT). The reverse transcriptase (RT) domain is located in the C-terminal region of the TERT polypeptide. Single amino acid substitutions in this region lead to telomere shortening and senescence. Telomerase is an enzyme that, in certain cells, maintains the physical ends of chromosomes (telomeres) during replication. In somatic cells, replication of the lagging strand requires the continual presence of an RNA primer approximately 200 nucleotides upstream, which is complementary to the template strand. Since there is a region of DNA less than 200 base pairs from the end of the chromosome where this is not possible, the chromosome is continually shortened. However, a surplus of repetitive DNA at 
Probab=47.64  E-value=41  Score=17.66  Aligned_cols=22  Identities=9%  Similarity=-0.093  Sum_probs=17.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      -.++|++++.+++++-+.|.+.
T Consensus        61 D~li~~~~~~~~~~~~~~l~~~   82 (119)
T cd01648          61 DFLLITTSLDKAIKFLNLLLRG   82 (119)
T ss_pred             cEEEEeCCHHHHHHHHHHHHHh
Confidence            3689999999999888887653


No 279
>PF13439 Glyco_transf_4:  Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A.
Probab=47.58  E-value=28  Score=17.52  Aligned_cols=20  Identities=20%  Similarity=0.047  Sum_probs=15.5

Q ss_pred             hhHHHHHHHHHhcCCceeee
Q psy8719          12 LDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus        12 ~~ad~La~~L~~~G~~~~~~   31 (33)
                      .-+.+|++.|.+.|++...+
T Consensus        16 ~~~~~l~~~l~~~G~~v~v~   35 (177)
T PF13439_consen   16 RVVLNLARALAKRGHEVTVV   35 (177)
T ss_dssp             HHHHHHHHHHHHTT-EEEEE
T ss_pred             HHHHHHHHHHHHCCCEEEEE
Confidence            45778999999999987665


No 280
>PRK06703 flavodoxin; Provisional
Probab=47.56  E-value=18  Score=19.39  Aligned_cols=19  Identities=21%  Similarity=0.221  Sum_probs=15.2

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ||+.-|+.|++.|...|..
T Consensus        14 nT~~iA~~ia~~l~~~g~~   32 (151)
T PRK06703         14 NTEDIADLIKVSLDAFDHE   32 (151)
T ss_pred             hHHHHHHHHHHHHHhcCCc
Confidence            6788888888888887765


No 281
>PRK09280 F0F1 ATP synthase subunit beta; Validated
Probab=47.22  E-value=44  Score=22.40  Aligned_cols=30  Identities=7%  Similarity=0.230  Sum_probs=23.8

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHh-cCCceee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNS-IDRRLIY   30 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~-~G~~~~~   30 (33)
                      +++++|+++|-++           +-.+|++++. +|+....
T Consensus       201 l~rsvvV~atsd~p~~~r~~a~~~a~tiAEyfrd~~G~~VLl  242 (463)
T PRK09280        201 LDKTALVFGQMNEPPGARLRVALTGLTMAEYFRDVEGQDVLL  242 (463)
T ss_pred             cceeEEEEECCCCCHHHHHHHHHHHHHHHHHHHHhcCCceEE
Confidence            4688999999877           6779999999 8876543


No 282
>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins.  Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain.
Probab=47.17  E-value=23  Score=18.36  Aligned_cols=19  Identities=5%  Similarity=0.048  Sum_probs=16.4

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.++++|..+++.|-+.|.
T Consensus        46 ~~~R~eAv~~g~~Ll~~G~   64 (84)
T cd04438          46 LTDRREARKYASSLLKLGY   64 (84)
T ss_pred             CCCHHHHHHHHHHHHHCCc
Confidence            4688999999999998874


No 283
>COG1609 PurR Transcriptional regulators [Transcription]
Probab=46.89  E-value=44  Score=20.40  Aligned_cols=27  Identities=11%  Similarity=-0.004  Sum_probs=22.5

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |....+..+...+++|-+.|++.+-+.
T Consensus       155 V~~Dn~~~~~~a~~~L~~~G~~~i~~i  181 (333)
T COG1609         155 VGIDNFAGAYLATEHLIELGHRRIAFI  181 (333)
T ss_pred             EEEChHHHHHHHHHHHHHCCCceEEEE
Confidence            667778889999999999999877654


No 284
>TIGR00147 lipid kinase, YegS/Rv2252/BmrU family. The E. coli member of this family, YegS has been purified and shown to have phosphatidylglycerol kinase activity. The member from M. tuberculosis, Rv2252, has diacylglycerol kinase activity. BmrU from B. subtilis is in an operon with multidrug efflux transporter Bmr, but is uncharacterized.
Probab=46.80  E-value=60  Score=19.13  Aligned_cols=31  Identities=10%  Similarity=-0.044  Sum_probs=21.2

Q ss_pred             CceEEEEecch-------hhHHHHHHHHHhcCCceeee
Q psy8719           1 MDRALIFCRTK-------LDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         1 ~~~aIVF~nTK-------~~ad~La~~L~~~G~~~~~~   31 (33)
                      |.+.+|+.|-.       +..+++.+.|.+.|.....+
T Consensus         1 ~~~~~ii~Np~sg~~~~~~~~~~i~~~l~~~~~~~~~~   38 (293)
T TIGR00147         1 MAEAPAILNPTAGKSNDNKPLREVIMLLREEGMEIHVR   38 (293)
T ss_pred             CceEEEEECCCccchhhHHHHHHHHHHHHHCCCEEEEE
Confidence            56778888872       33456777888888776544


No 285
>PF07015 VirC1:  VirC1 protein;  InterPro: IPR009744 This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon, which enhances T-DNA processing probably, does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA [].
Probab=46.64  E-value=37  Score=20.84  Aligned_cols=26  Identities=19%  Similarity=0.204  Sum_probs=20.9

Q ss_pred             eEEEEecchhh------HHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLD------CDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~------ad~La~~L~~~G~~~   28 (33)
                      ++|.||++|=+      +--||..|.++|...
T Consensus         2 ~vItf~s~KGGaGKTT~~~~LAs~la~~G~~V   33 (231)
T PF07015_consen    2 PVITFASSKGGAGKTTAAMALASELAARGARV   33 (231)
T ss_pred             CeEEEecCCCCCcHHHHHHHHHHHHHHCCCeE
Confidence            57999999976      466889998888754


No 286
>PRK07411 hypothetical protein; Validated
Probab=46.63  E-value=37  Score=21.58  Aligned_cols=26  Identities=12%  Similarity=0.079  Sum_probs=23.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..+|+|.+-..+...+..|++.|...
T Consensus       344 ~IVvyC~~G~RS~~aa~~L~~~G~~~  369 (390)
T PRK07411        344 RLIAHCKMGGRSAKALGILKEAGIEG  369 (390)
T ss_pred             eEEEECCCCHHHHHHHHHHHHcCCCe
Confidence            57999999999999999999999863


No 287
>cd00148 PROF Profilin binds actin monomers, membrane polyphosphoinositides such as PI(4,5)P2, and poly-L-proline. Profilin can inhibit actin polymerization into F-actin by binding to monomeric actin (G-actin) and terminal F-actin subunits, but - as a regulator of the cytoskeleton - it may also promote actin polymerization. It plays a role in the assembly of branched actin filament networks, by activating WASP via binding to WASP's proline rich domain. Profilin may link the cytoskeleton with major signalling pathways by interacting with components of the phosphatidylinositol cycle and Ras pathway.
Probab=46.49  E-value=21  Score=19.32  Aligned_cols=15  Identities=27%  Similarity=0.346  Sum_probs=12.5

Q ss_pred             hhhHHHHHHHHHhcC
Q psy8719          11 KLDCDNLERYLNSID   25 (33)
Q Consensus        11 K~~ad~La~~L~~~G   25 (33)
                      ...+++|+++|.++|
T Consensus       112 ~~~v~~ladYL~~~g  126 (127)
T cd00148         112 NKVVEKLADYLRSQG  126 (127)
T ss_pred             HHHHHHHHHHHHHcC
Confidence            456889999999887


No 288
>cd02868 PseudoU_synth_hTruB2_like PseudoU_synth_ hTRUB2_Like: Pseudouridine synthase, humanTRUB2_like. This group consists of eukaryotic pseudouridine synthases similar to human TruB pseudouridine synthase homolog 2 (TRUB2). Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).
Probab=46.43  E-value=38  Score=20.47  Aligned_cols=28  Identities=18%  Similarity=0.142  Sum_probs=22.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      -+|+|+.++..  ++.++|.+.+..+.|..
T Consensus        46 Gvl~~a~~~~t--kl~~~~~~~~~~K~Y~~   73 (226)
T cd02868          46 GVLVLGVNHGN--KLLSHLYSNHPTRVYTI   73 (226)
T ss_pred             eEEEEEeChhH--hHHHHHHhcCCCeEEEE
Confidence            36788888764  79999998888888864


No 289
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=46.25  E-value=34  Score=16.59  Aligned_cols=20  Identities=25%  Similarity=0.238  Sum_probs=16.4

Q ss_pred             chhhHHHHHHHHHhcCCcee
Q psy8719          10 TKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~~   29 (33)
                      +.++.+++.+.|+++|.+..
T Consensus        80 ~~~~v~~~~~~l~~~g~~~~   99 (125)
T cd07241          80 SKEAVDELTERLRADGYLII   99 (125)
T ss_pred             CHHHHHHHHHHHHHCCCEEE
Confidence            45789999999999997653


No 290
>PF05036 SPOR:  Sporulation related domain;  InterPro: IPR007730 This 70 residue domain is composed of two 35 residue repeats that are found in bacterial proteins involved in sporulation and cell division, such as FtsN, CwlM and RlpA. This repeat might be involved in binding peptidoglycan. FtsN is an essential cell division protein with a simple bitopic topology: a short N-terminal cytoplasmic segment fused to a large carboxy periplasmic domain through a single transmembrane domain. The repeats lie at the periplasmic C terminus, which has an RNP-like fold []. FtsN localises to the septum ring complex. The CwlM protein is a cell wall hydrolase, where the C-terminal region, including the repeats, determines substrate specificity []. RlpA is a rare lipoprotein A protein that may be important for cell division. Its N-terminal cysteine may be attached to thioglyceride and N-fatty acyl residues [].; PDB: 1X60_A 1UTA_A.
Probab=46.22  E-value=24  Score=16.21  Aligned_cols=19  Identities=11%  Similarity=0.101  Sum_probs=12.9

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++.++++.+.|++.|..
T Consensus        13 ~~~~~A~~~~~~l~~~g~~   31 (76)
T PF05036_consen   13 SSEENAERLLAKLKKKGPD   31 (76)
T ss_dssp             S-HHHHHHHHHHHHHHT--
T ss_pred             CCHHHHHHHHHHHHhcCCC
Confidence            5778888888888888654


No 291
>PF01565 FAD_binding_4:  FAD binding domain  This is only a subset of the Pfam family;  InterPro: IPR006094  Various enzymes use FAD as a co-factor, most of these enzymes are oxygen-dependent oxidoreductases, containing a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage. One of the enzymes Vanillyl-alcohol oxidase (VAO, 1.1.3.38 from EC) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110 []. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyses the oxidation of a wide variety of substrates, ranging from aromatic amines to 4-alkylphenols.  ; GO: 0008762 UDP-N-acetylmuramate dehydrogenase activity, 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0055114 oxidation-reduction process; PDB: 1ZR6_A 3HSU_A 2AXR_A 3D2J_A 3D2H_A 3FW9_A 3FW8_A 3FW7_A 3GSY_A 3FWA_A ....
Probab=45.90  E-value=44  Score=17.34  Aligned_cols=27  Identities=7%  Similarity=0.110  Sum_probs=23.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      .++|+.++.++...+.++.++.|..+.
T Consensus         2 ~~vv~P~s~~ev~~~v~~a~~~~~~v~   28 (139)
T PF01565_consen    2 AAVVRPKSVEEVQAIVKFANENGVPVR   28 (139)
T ss_dssp             SEEEEESSHHHHHHHHHHHHHTTSEEE
T ss_pred             cEEEEeCCHHHHHHHHHHHHHcCCcEE
Confidence            579999999999999999998876653


No 292
>PRK05568 flavodoxin; Provisional
Probab=45.83  E-value=30  Score=18.11  Aligned_cols=20  Identities=5%  Similarity=-0.041  Sum_probs=16.1

Q ss_pred             cchhhHHHHHHHHHhcCCce
Q psy8719           9 RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~   28 (33)
                      ||+.-|+.+++.|.+.|...
T Consensus        14 nT~~~a~~i~~~~~~~g~~v   33 (142)
T PRK05568         14 NTEAMANLIAEGAKENGAEV   33 (142)
T ss_pred             hHHHHHHHHHHHHHHCCCeE
Confidence            78888888999888877653


No 293
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated
Probab=45.77  E-value=34  Score=21.13  Aligned_cols=24  Identities=13%  Similarity=0.220  Sum_probs=19.6

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      -|+-++++ +++.+++.|++.|.+-
T Consensus        13 rIlvtr~~-~a~~la~~L~~~G~~~   36 (381)
T PRK07239         13 TVGVTAAR-RAEELAALLERRGARV   36 (381)
T ss_pred             EEEEeccC-CHHHHHHHHHHcCCeE
Confidence            45566777 8999999999999874


No 294
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the N-terminal, non-catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase  (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the N-terminal do
Probab=45.62  E-value=40  Score=16.74  Aligned_cols=24  Identities=21%  Similarity=0.261  Sum_probs=19.4

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |-| +.++++.+.+.+.|+++|...
T Consensus        65 iaf~v~~~~dv~~~~~~l~~~G~~~   89 (122)
T cd07265          65 MGFKVLDDADLEKLEARLQAYGVAV   89 (122)
T ss_pred             EEEEeCCHHHHHHHHHHHHHCCCcE
Confidence            444 567889999999999999764


No 295
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=45.57  E-value=55  Score=22.50  Aligned_cols=30  Identities=17%  Similarity=0.280  Sum_probs=23.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhc-CCceeeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI-DRRLIYYF   32 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~-G~~~~~~~   32 (33)
                      .+||-+.+|..|+.|++.|+.. +....+||
T Consensus        56 p~Lvi~~n~~~A~ql~~el~~f~p~~~V~~f   86 (655)
T TIGR00631        56 PTLVIAHNKTLAAQLYNEFKEFFPENAVEYF   86 (655)
T ss_pred             CEEEEECCHHHHHHHHHHHHHhCCCCeEEEE
Confidence            5799999999999999999876 44434444


No 296
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to 
Probab=45.54  E-value=41  Score=17.33  Aligned_cols=22  Identities=18%  Similarity=0.217  Sum_probs=18.1

Q ss_pred             EEEEecchhhHHHHHHHHHhcC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ..+.|.+.++++++.+.|.+.|
T Consensus        78 l~i~~~~~e~v~~~~~~l~~~g   99 (128)
T cd06588          78 LSVECDSEEEADRLFEALSEGG   99 (128)
T ss_pred             EEEECCCHHHHHHHHHHHhcCC
Confidence            4566888899999999997766


No 297
>COG4747 ACT domain-containing protein [General function prediction only]
Probab=45.24  E-value=43  Score=19.54  Aligned_cols=26  Identities=27%  Similarity=0.385  Sum_probs=21.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +++|+|.+| ++.|+.-+.|+.+|..+
T Consensus       108 ~KAlli~r~-ed~d~~~~aLed~gi~~  133 (142)
T COG4747         108 QKALLIVRV-EDIDRAIKALEDAGIKL  133 (142)
T ss_pred             ceEEEEEEh-hHHHHHHHHHHHcCCee
Confidence            468888887 56788999999998765


No 298
>smart00392 PROF Profilin. Binds actin monomers, membrane polyphosphoinositides and poly-L-proline.
Probab=45.15  E-value=23  Score=19.14  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=13.4

Q ss_pred             cchhhHHHHHHHHHhcC
Q psy8719           9 RTKLDCDNLERYLNSID   25 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G   25 (33)
                      +-...++.|+++|.+.|
T Consensus       112 ~~~~~v~~ladYL~~~G  128 (129)
T smart00392      112 QANKTVEKLADYLRSSG  128 (129)
T ss_pred             HHHHHHHHHHHHHHHcC
Confidence            34567889999999887


No 299
>PRK09281 F0F1 ATP synthase subunit alpha; Validated
Probab=45.11  E-value=45  Score=22.41  Aligned_cols=28  Identities=14%  Similarity=0.239  Sum_probs=23.0

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~G~~~   28 (33)
                      +++++|+++|-++           +-.+|++++.+|...
T Consensus       218 l~~tvvv~atsd~p~~~r~~a~~~a~tiAEyfrd~G~~V  256 (502)
T PRK09281        218 MEYTIVVAATASDPAPLQYLAPYAGCAMGEYFMDNGKDA  256 (502)
T ss_pred             ccceEEEEeCCCCCHHHHHHHHHHHHHHHHHHHHcCCCE
Confidence            4678999999887           788999999887754


No 300
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=45.00  E-value=46  Score=17.27  Aligned_cols=24  Identities=8%  Similarity=0.057  Sum_probs=19.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++|++|+++.-++.+.+.+...+.
T Consensus        52 ~~l~~~p~~~l~~Q~~~~~~~~~~   75 (184)
T PF04851_consen   52 KVLIVAPNISLLEQWYDEFDDFGS   75 (184)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHHST
T ss_pred             ceeEecCHHHHHHHHHHHHHHhhh
Confidence            689999999999999988854444


No 301
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=44.97  E-value=17  Score=17.52  Aligned_cols=21  Identities=24%  Similarity=0.362  Sum_probs=16.4

Q ss_pred             EecchhhHHHHHHHH-HhcCCc
Q psy8719           7 FCRTKLDCDNLERYL-NSIDRR   27 (33)
Q Consensus         7 F~nTK~~ad~La~~L-~~~G~~   27 (33)
                      +..+.+++|+|.+.| .-.|.+
T Consensus         3 ~~~~~e~ld~L~~aL~~prG~R   24 (46)
T PF15614_consen    3 YYDDPEELDELLKALENPRGKR   24 (46)
T ss_pred             cccCHHHHHHHHHHHcCcccHh
Confidence            456788999999999 776654


No 302
>PRK13695 putative NTPase; Provisional
Probab=44.89  E-value=52  Score=17.88  Aligned_cols=31  Identities=13%  Similarity=0.154  Sum_probs=24.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      ..+|.+-.+.....+++.+...-++.++.+|
T Consensus       127 ~~~i~v~h~~~~~~~~~~i~~~~~~~i~~~~  157 (174)
T PRK13695        127 KPVIATLHRRSVHPFVQEIKSRPGGRVYELT  157 (174)
T ss_pred             CeEEEEECchhhHHHHHHHhccCCcEEEEEc
Confidence            5677777788888888889888888888764


No 303
>COG4003 Uncharacterized protein conserved in archaea [Function unknown]
Probab=44.65  E-value=24  Score=19.44  Aligned_cols=19  Identities=21%  Similarity=0.413  Sum_probs=16.4

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      |.|-++|-++-++|.++|-
T Consensus        44 CdT~EEAlEii~yleKrGE   62 (98)
T COG4003          44 CDTEEEALEIINYLEKRGE   62 (98)
T ss_pred             hCcHHHHHHHHHHHHHhCC
Confidence            7888999999999998873


No 304
>PF09868 DUF2095:  Uncharacterized protein conserved in archaea (DUF2095);  InterPro: IPR018662  This domain, found in various hypothetical prokaryotic proteins, has no known function. 
Probab=44.65  E-value=23  Score=20.38  Aligned_cols=18  Identities=22%  Similarity=0.453  Sum_probs=14.2

Q ss_pred             ecchhhHHHHHHHHHhcC
Q psy8719           8 CRTKLDCDNLERYLNSID   25 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G   25 (33)
                      |.|-++|-+|-++|.++|
T Consensus        74 C~T~EEALEVInylek~G   91 (128)
T PF09868_consen   74 CKTDEEALEVINYLEKRG   91 (128)
T ss_pred             hCcHHHHHHHHHHHHHhC
Confidence            677788888888887776


No 305
>PRK13618 psbV cytochrome c-550; Provisional
Probab=44.65  E-value=27  Score=20.41  Aligned_cols=22  Identities=23%  Similarity=0.285  Sum_probs=16.9

Q ss_pred             chhhHHHHHHHHHh--------cCCceeee
Q psy8719          10 TKLDCDNLERYLNS--------IDRRLIYY   31 (33)
Q Consensus        10 TK~~ad~La~~L~~--------~G~~~~~~   31 (33)
                      |.++.+.|+.+|-.        =|++++||
T Consensus       134 sd~eL~ava~yll~~~~~~~~~wgggk~y~  163 (163)
T PRK13618        134 TDKDLEAIAGHILVQPKILGDKWGGGKIYY  163 (163)
T ss_pred             CHHHHHHHHHHHHhccCCcccccCCceecC
Confidence            56788999999854        37788886


No 306
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=44.54  E-value=61  Score=20.28  Aligned_cols=28  Identities=18%  Similarity=0.183  Sum_probs=18.7

Q ss_pred             CceEEEEecchh-h----HHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKL-D----CDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~-~----ad~La~~L~~~G~~~   28 (33)
                      |.+..|+.|... +    +.+|.++|.++|.+.
T Consensus         1 m~~igiv~n~~~~~~~~~~~~l~~~L~~~g~~v   33 (305)
T PRK02649          1 MPKAGIIYNDGKPLAVRTAEELQDKLEAAGWEV   33 (305)
T ss_pred             CCEEEEEEcCCCHHHHHHHHHHHHHHHHCCCEE
Confidence            567788888544 3    456667777777654


No 307
>TIGR00609 recB exodeoxyribonuclease V, beta subunit. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.48  E-value=44  Score=24.07  Aligned_cols=28  Identities=11%  Similarity=0.326  Sum_probs=24.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      ..-|-|+++.+++.+.+.|.+.|....+
T Consensus       471 DIAVLvRs~~~a~~i~~aL~~~GIP~~~  498 (1087)
T TIGR00609       471 DIAVLVRGRKEANQIRKALKKAQIPSVY  498 (1087)
T ss_pred             cEEEEEeCCchHHHHHHHHHHCCCCEEE
Confidence            4568899999999999999999987654


No 308
>PF09286 Pro-kuma_activ:  Pro-kumamolisin, activation domain ;  InterPro: IPR015366 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase []. ; GO: 0008236 serine-type peptidase activity; PDB: 1T1E_A 3EDY_A 3EE6_A.
Probab=44.45  E-value=21  Score=19.17  Aligned_cols=23  Identities=17%  Similarity=0.336  Sum_probs=16.6

Q ss_pred             EecchhhHHHHHHHHHhcCCcee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      |..+.++.+.|.++|+++|....
T Consensus        57 ~~p~~~~v~~V~~wL~~~G~~~~   79 (143)
T PF09286_consen   57 FAPSPEDVAAVKSWLKSHGLTVV   79 (143)
T ss_dssp             HS--HHHHHHHHHHHHHCT-EEE
T ss_pred             HCCCHHHHHHHHHHHHHcCCcee
Confidence            45677889999999999997654


No 309
>PF02158 Neuregulin:  Neuregulin family;  InterPro: IPR002154 Neuregulins are a sub-family of EGF-like molecules that have been shown to play multiple essential roles in vertebrate embryogenesis including: cardiac development, Schwann cell and oligodendrocyte differentiation, some aspects of neuronal development, as well as the formation of neuromuscular synapses [, ]. Included in the family are heregulin; neu differentiation factor; acetylcholine receptor synthesis stimulator; glial growth factor; and sensory and motor-neuron derived factor []. Multiple family members are generated by alternate splicing or by use of several cell type-specific transcription initiation sites. In general, they bind to and activate the erbB family of receptor tyrosine kinases (erbB2 (HER2), erbB3 (HER3), and erbB4 (HER4)), functioning both as heterodimers and homodimers.  The transmembrane forms of neuregulin 1 (NRG1) are present within synaptic vesicles, including those containing glutamate []. After exocytosis, NRG1 is in the presynaptic membrane, where the ectodomain of NRG1 may be cleaved off. The ectodomain then migrates across the synaptic cleft and binds to and activates a member of the EGF-receptor family on the postsynaptic membrane. This has been shown to increase the expression of certain glutamate-receptor subunits. NRG1 appears to signal for glutamate-receptor subunit expression, localisation, and /or phosphorylation facilitating subsequent glutamate transmission.   The NRG1 gene has been identified as a potential gene determining susceptibility to schizophrenia by a combination of genetic linkage and association approaches []. ; GO: 0005102 receptor binding, 0009790 embryo development; PDB: 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=44.43  E-value=7.4  Score=25.99  Aligned_cols=25  Identities=28%  Similarity=0.483  Sum_probs=0.0

Q ss_pred             EEecchhhHHHHHHHHHhcCCceee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .+|+||++...+-+.|++.-.+..|
T Consensus        30 aYCKTKKQRkklh~hLkqs~~~~~~   54 (404)
T PF02158_consen   30 AYCKTKKQRKKLHEHLKQSQRSKNY   54 (404)
T ss_dssp             -------------------------
T ss_pred             HHHHhHHHHHHHHHHHhhhcccchh
Confidence            5999999999999999886555444


No 310
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor. Members of this family belong the lacI helix-turn-helix family (pfam00356) of DNA-binding transcriptional regulators. All members are from the proteobacteria. Characterized members act as positive and negative transcriptional regulators of fructose and sucrose transport and metabolism. Sucrose is a disaccharide composed of fructose and glucose; D-fructose-1-phosphate rather than an intact sucrose moiety has been shown to act as the inducer.
Probab=44.32  E-value=56  Score=18.95  Aligned_cols=27  Identities=15%  Similarity=0.148  Sum_probs=20.1

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++....+..++++|-+.|++.+-|+
T Consensus       158 V~~dn~~~~~~~~~~L~~~G~~~I~~i  184 (327)
T TIGR02417       158 VISDDVDAAAELIERLLSQHADEFWYL  184 (327)
T ss_pred             EEeCcHHHHHHHHHHHHHCCCCeEEEE
Confidence            445666777888888888888877664


No 311
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=44.10  E-value=35  Score=22.73  Aligned_cols=25  Identities=20%  Similarity=0.169  Sum_probs=21.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++||.+.|++-|..+.+.+++.+..
T Consensus        86 raLIl~PTreLa~Qi~~~~~~l~~~  110 (572)
T PRK04537         86 RALILAPTRELAIQIHKDAVKFGAD  110 (572)
T ss_pred             eEEEEeCcHHHHHHHHHHHHHHhcc
Confidence            7999999999999999988876643


No 312
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=44.07  E-value=60  Score=20.10  Aligned_cols=28  Identities=14%  Similarity=0.105  Sum_probs=18.4

Q ss_pred             CceEEEEecchh-h----HHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKL-D----CDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~-~----ad~La~~L~~~G~~~   28 (33)
                      +.++.|+.|... +    +.+++++|.++|.+.
T Consensus         5 ~~~i~iv~~~~~~~~~~~~~~i~~~l~~~g~~v   37 (292)
T PRK03378          5 FKCIGIVGHPRHPTALTTHEMLYHWLTSKGYEV   37 (292)
T ss_pred             CCEEEEEEeCCCHHHHHHHHHHHHHHHHCCCEE
Confidence            346788888544 3    456777787777653


No 313
>KOG0235|consensus
Probab=43.85  E-value=30  Score=21.00  Aligned_cols=23  Identities=9%  Similarity=0.161  Sum_probs=20.2

Q ss_pred             hhhHHHHHHHHHhcCCceeeeeC
Q psy8719          11 KLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus        11 K~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      ..+|..+++.|+..+..+.++||
T Consensus        37 ~~qA~~~~~~l~~~~~~~~~~~t   59 (214)
T KOG0235|consen   37 EEQAKAAAQRLKDLNIEFDVCYT   59 (214)
T ss_pred             HHHHHHHHHHHHhcCCcccEEec
Confidence            35789999999999999999886


No 314
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=43.77  E-value=62  Score=20.11  Aligned_cols=28  Identities=18%  Similarity=0.223  Sum_probs=18.4

Q ss_pred             CceEEEEecchh-h----HHHHHHHHHhcCCce
Q psy8719           1 MDRALIFCRTKL-D----CDNLERYLNSIDRRL   28 (33)
Q Consensus         1 ~~~aIVF~nTK~-~----ad~La~~L~~~G~~~   28 (33)
                      +.++.||.|... +    ++++.++|.++|.+.
T Consensus         5 ~~~i~ii~~~~~~~~~~~~~~l~~~L~~~g~~v   37 (296)
T PRK04539          5 FHNIGIVTRPNTPDIQDTAHTLITFLKQHGFTV   37 (296)
T ss_pred             CCEEEEEecCCCHHHHHHHHHHHHHHHHCCCEE
Confidence            356788888544 3    556777777777654


No 315
>cd04449 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins. DEPDC5, in human also known as KIAA0645, is a DEP domain containing protein of unknown function.
Probab=43.62  E-value=28  Score=17.65  Aligned_cols=19  Identities=16%  Similarity=0.059  Sum_probs=16.1

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.|+.+|-.+++.|-+.|.
T Consensus        46 ~~~r~eAv~lgq~Ll~~g~   64 (83)
T cd04449          46 VDTREEAVELGQELMNEGL   64 (83)
T ss_pred             CCCHHHHHHHHHHHHHCCC
Confidence            5789999999999988764


No 316
>KOG1715|consensus
Probab=43.54  E-value=25  Score=21.29  Aligned_cols=19  Identities=16%  Similarity=0.373  Sum_probs=16.9

Q ss_pred             chhhHHHHHHHHHhcCCce
Q psy8719          10 TKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~   28 (33)
                      ||++|+++-+.|++.|.-.
T Consensus       166 tKeEAEkik~kLea~GakV  184 (187)
T KOG1715|consen  166 TKEEAEEIKEKLEAAGAKV  184 (187)
T ss_pred             CHHHHHHHHHHHHHcCCeE
Confidence            7999999999999999753


No 317
>COG2344 AT-rich DNA-binding protein [General function prediction only]
Probab=43.41  E-value=53  Score=20.33  Aligned_cols=29  Identities=17%  Similarity=0.131  Sum_probs=24.3

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceeeeeC
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIYYFT   33 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~~~~   33 (33)
                      -|-|=-++.|+++|+.|.++|..-+.-||
T Consensus       150 aiLtVPa~~AQ~vad~Lv~aGVkGIlNFt  178 (211)
T COG2344         150 AILTVPAEHAQEVADRLVKAGVKGILNFT  178 (211)
T ss_pred             EEEEccHHHHHHHHHHHHHcCCceEEecc
Confidence            45566788999999999999998887775


No 318
>PRK06936 type III secretion system ATPase; Provisional
Probab=43.40  E-value=53  Score=21.84  Aligned_cols=29  Identities=14%  Similarity=0.408  Sum_probs=22.7

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~G~~~~   29 (33)
                      +++++|+++|-++           +-.+|++++.+|+...
T Consensus       216 l~rtvvv~atsd~p~~~R~~a~~~a~tiAEyfrd~G~~Vl  255 (439)
T PRK06936        216 LRKAVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVL  255 (439)
T ss_pred             cceeEEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCCEE
Confidence            4678888888776           5668999998887654


No 319
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=43.39  E-value=47  Score=17.83  Aligned_cols=22  Identities=18%  Similarity=0.329  Sum_probs=19.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .+.||-+.|...+|++.+.|.+
T Consensus        54 ~~il~~~~sN~avd~~~~~l~~   75 (236)
T PF13086_consen   54 KKILVVSPSNAAVDNILERLKK   75 (236)
T ss_dssp             S-EEEEESSHHHHHHHHHHHHC
T ss_pred             ccceeecCCchhHHHHHHHHHh
Confidence            4678889999999999999988


No 320
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=43.10  E-value=56  Score=18.71  Aligned_cols=27  Identities=15%  Similarity=0.062  Sum_probs=20.8

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++-...+..++++|.+.|++.+-|+
T Consensus        98 V~~d~~~~~~~a~~~L~~~G~~~I~~i  124 (269)
T cd06287          98 VDLQSAATARMLLEHLRAQGARQIALI  124 (269)
T ss_pred             EeeCcHHHHHHHHHHHHHcCCCcEEEE
Confidence            556677788888888888888877654


No 321
>PRK14987 gluconate operon transcriptional regulator; Provisional
Probab=42.99  E-value=64  Score=18.77  Aligned_cols=27  Identities=11%  Similarity=0.075  Sum_probs=20.1

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++..+....++++|.+.|++.+-++
T Consensus       160 V~~Dn~~~~~~a~~~L~~~Gh~~I~~i  186 (331)
T PRK14987        160 VGFDNFEAARQMTTAIIARGHRHIAYL  186 (331)
T ss_pred             EEeCcHHHHHHHHHHHHHCCCceEEEE
Confidence            445666777888888888888877664


No 322
>PRK06141 ornithine cyclodeaminase; Validated
Probab=42.97  E-value=48  Score=20.27  Aligned_cols=24  Identities=13%  Similarity=0.213  Sum_probs=21.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++.|+-++.+.++++++.+.+.|
T Consensus       151 ~~V~V~~Rs~~~a~~~a~~~~~~g  174 (314)
T PRK06141        151 KQVRVWGRDPAKAEALAAELRAQG  174 (314)
T ss_pred             CEEEEEcCCHHHHHHHHHHHHhcC
Confidence            468899999999999999998765


No 323
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. This domain is also found in the accessory subunit of mitochondrial polymerase gamma (Pol gamma b).
Probab=42.85  E-value=40  Score=16.02  Aligned_cols=27  Identities=19%  Similarity=-0.020  Sum_probs=18.6

Q ss_pred             ceEEEEecc------hhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRT------KLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nT------K~~ad~La~~L~~~G~~~   28 (33)
                      .+++|.+-+      ...+..+++.|++.|...
T Consensus         2 ~~v~ii~~~~~~~~~~~~a~~~~~~Lr~~g~~v   34 (94)
T cd00738           2 IDVAIVPLTDPRVEAREYAQKLLNALLANGIRV   34 (94)
T ss_pred             eEEEEEECCCCcHHHHHHHHHHHHHHHHCCCEE
Confidence            455666533      357788999999988654


No 324
>PTZ00110 helicase; Provisional
Probab=42.78  E-value=35  Score=22.50  Aligned_cols=24  Identities=13%  Similarity=0.189  Sum_probs=21.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++||.+.|++-|..+.+.+++.+.
T Consensus       205 ~~LIL~PTreLa~Qi~~~~~~~~~  228 (545)
T PTZ00110        205 IVLVLAPTRELAEQIREQCNKFGA  228 (545)
T ss_pred             EEEEECChHHHHHHHHHHHHHHhc
Confidence            589999999999999999988664


No 325
>PF08704 GCD14:  tRNA methyltransferase complex GCD14 subunit;  InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []. ; GO: 0016429 tRNA (adenine-N1-)-methyltransferase activity, 0030488 tRNA methylation; PDB: 2YVL_C 1YB2_A 2B25_B 1O54_A 2PWY_B 1I9G_A 3LGA_B 3LHD_C 3MB5_A.
Probab=42.58  E-value=52  Score=20.05  Aligned_cols=24  Identities=13%  Similarity=-0.013  Sum_probs=21.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ...+|+.+=+++.++.+.|++.|.
T Consensus       141 ~i~~fsP~ieQv~~~~~~L~~~gf  164 (247)
T PF08704_consen  141 RICCFSPCIEQVQKTVEALREHGF  164 (247)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHTTE
T ss_pred             eEEEECCCHHHHHHHHHHHHHCCC
Confidence            467999999999999999999874


No 326
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=42.55  E-value=61  Score=18.00  Aligned_cols=27  Identities=22%  Similarity=0.375  Sum_probs=20.3

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++-.+....+++.|.++|++.+-++
T Consensus        96 V~~d~~~~~~~~~~~L~~~G~~~i~~i  122 (269)
T cd06293          96 VFCDNEQGGRLATRHLARAGHRRIAFV  122 (269)
T ss_pred             EEECCHHHHHHHHHHHHHCCCceEEEE
Confidence            556777777888888888888876554


No 327
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heterodimer (composed of Ku70 and Ku80) contributes to genomic integrity through its ability to bind DNA double-strand breaks (DSB) in a preferred orientation. DSB's are repaired by either homologues recombination or non-homologues end joining and facilitate repair by the non-homologous end-joining pathway (NHEJ). The Ku heterodimer is required for accurate process that tends to preserve the sequence at the junction. Ku78 is found in all three kingdoms of life. However, only the eukaryotic proteins have a vWA domain fused to them at their N-termini. The vWA domain is not involved in DNA binding but may very likey mediate Ku78's interactions with other proteins. Members of this subgroup lack the conserved MIDAS motif.
Probab=42.38  E-value=63  Score=18.33  Aligned_cols=30  Identities=13%  Similarity=0.191  Sum_probs=21.3

Q ss_pred             ceEEEEecc----------hhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRT----------KLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nT----------K~~ad~La~~L~~~G~~~~~~   31 (33)
                      .+.++|++-          +.++..+++.|++.|..+.-+
T Consensus       129 k~IvL~TDg~~p~~~~~~~~~~~~~~a~~l~~~gI~i~~i  168 (218)
T cd01458         129 KRIFLFTNNDDPHGGDSIKDSQAAVKAEDLKDKGIELELF  168 (218)
T ss_pred             cEEEEECCCCCCCCCCHHHHHHHHHHHHHHHhCCcEEEEE
Confidence            357788872          356778899999888776543


No 328
>PF13377 Peripla_BP_3:  Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A ....
Probab=41.95  E-value=51  Score=16.92  Aligned_cols=23  Identities=22%  Similarity=0.263  Sum_probs=20.4

Q ss_pred             EEEecchhhHHHHHHHHHhcCCc
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      -|||.+-..+..+...|++.|.+
T Consensus        71 aii~~~~~~a~~~~~~l~~~g~~   93 (160)
T PF13377_consen   71 AIICSNDRLALGVLRALRELGIR   93 (160)
T ss_dssp             EEEESSHHHHHHHHHHHHHTTSC
T ss_pred             EEEEcCHHHHHHHHHHHHHcCCc
Confidence            58899999999999999999874


No 329
>cd04441 DEP_2_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in DEP6-like proteins. DEP6 proteins contain two DEP and a PDZ domain. Their function is unknown.
Probab=41.71  E-value=31  Score=18.09  Aligned_cols=19  Identities=16%  Similarity=0.081  Sum_probs=16.7

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.++++|-.+++.|-+.|.
T Consensus        48 ~~sR~eAv~lgq~Ll~~gi   66 (85)
T cd04441          48 AESRREAVQLCRRLLEHGI   66 (85)
T ss_pred             CCCHHHHHHHHHHHHHCCC
Confidence            6899999999999988774


No 330
>cd04443 DEP_GPR155 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in GPR155-like proteins. GRP155-like proteins, also known as PGR22, contain an N-terminal permease domain, a central transmembrane region and a C-terminal DEP domain. They are orphan receptors of the class B G protein-coupled receptors. Their function is unknown.
Probab=41.67  E-value=32  Score=17.83  Aligned_cols=19  Identities=11%  Similarity=-0.094  Sum_probs=16.5

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.|+.+|-.+++.|-+.|.
T Consensus        46 ~~sR~eAv~lg~~Ll~~G~   64 (83)
T cd04443          46 AQDRGEAVLYGRRLLQGGV   64 (83)
T ss_pred             CCCHHHHHHHHHHHHHCCC
Confidence            6789999999999988774


No 331
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional
Probab=41.64  E-value=45  Score=24.44  Aligned_cols=27  Identities=33%  Similarity=0.347  Sum_probs=23.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +++||||.-..-.+-|.++|...|.+.
T Consensus       488 ~KVLIFSQft~~LdiLed~L~~~g~~y  514 (1033)
T PLN03142        488 SRVLIFSQMTRLLDILEDYLMYRGYQY  514 (1033)
T ss_pred             CeEEeehhHHHHHHHHHHHHHHcCCcE
Confidence            489999999999999999999887654


No 332
>PRK07340 ornithine cyclodeaminase; Validated
Probab=41.53  E-value=66  Score=19.66  Aligned_cols=26  Identities=12%  Similarity=0.078  Sum_probs=21.8

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +++.|+-++.+.++++++.+++.|..
T Consensus       151 ~~v~v~~r~~~~a~~~a~~~~~~~~~  176 (304)
T PRK07340        151 RRVWVRGRTAASAAAFCAHARALGPT  176 (304)
T ss_pred             CEEEEEcCCHHHHHHHHHHHHhcCCe
Confidence            57889999999999999999866533


No 333
>PRK06823 ornithine cyclodeaminase; Validated
Probab=41.53  E-value=65  Score=19.99  Aligned_cols=27  Identities=7%  Similarity=0.254  Sum_probs=22.6

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++.||-++.+.++.+++.+++.|..
T Consensus       153 i~~v~v~~r~~~~a~~~~~~~~~~~~~  179 (315)
T PRK06823        153 CRQLWVWGRSETALEEYRQYAQALGFA  179 (315)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHhcCCc
Confidence            367899999999999999999876543


No 334
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]
Probab=41.50  E-value=27  Score=25.81  Aligned_cols=21  Identities=19%  Similarity=0.548  Sum_probs=18.8

Q ss_pred             eEEEEecchhhHHHHHHHHHh
Q psy8719           3 RALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~   23 (33)
                      -+|+|+-+|.+|+..+..|..
T Consensus       381 P~I~F~FSr~~Ce~~a~~~~~  401 (1041)
T COG4581         381 PAIVFSFSRRGCEEAAQILST  401 (1041)
T ss_pred             ceEEEEEchhhHHHHHHHhcc
Confidence            479999999999999998864


No 335
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]
Probab=41.43  E-value=36  Score=21.82  Aligned_cols=22  Identities=27%  Similarity=0.226  Sum_probs=18.8

Q ss_pred             EEEEecchhhHHHHHHHHHhcC
Q psy8719           4 ALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++-|-||++++|++.+.|++..
T Consensus       382 S~~~YNt~edid~l~~aL~~~~  403 (405)
T COG0520         382 SLHLYNTEEDVDRLLEALKKAL  403 (405)
T ss_pred             EEeecCCHHHHHHHHHHHHHHh
Confidence            4668899999999999998753


No 336
>PF06897 DUF1269:  Protein of unknown function (DUF1269);  InterPro: IPR009200 There are currently no experimental data for members of this group or their homologues. However, these proteins are predicted to contain two or more transmembrane segments.
Probab=41.39  E-value=56  Score=17.49  Aligned_cols=26  Identities=12%  Similarity=0.216  Sum_probs=18.7

Q ss_pred             eEEEEecchh-hHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKL-DCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~-~ad~La~~L~~~G~~~   28 (33)
                      ++.||.-+++ ..|++.+.|++.|...
T Consensus        56 ssAl~~lv~~~~~d~v~~~l~~~gg~v   82 (102)
T PF06897_consen   56 SSALFLLVDEATEDKVDAALRKFGGKV   82 (102)
T ss_pred             ceEEEEEeccCCHHHHHHHHHhcCCEE
Confidence            4555555554 7888999999998654


No 337
>cd04371 DEP DEP domain, named after Dishevelled, Egl-10, and Pleckstrin, where this domain was first discovered. The function of this domain is still not clear, but it is believed to be important for the membrane association of the signaling proteins in which it is present. New studies show that the DEP domain of Sst2, a yeast RGS protein is necessary and sufficient for receptor interaction.
Probab=41.33  E-value=34  Score=16.39  Aligned_cols=18  Identities=17%  Similarity=0.012  Sum_probs=15.3

Q ss_pred             cchhhHHHHHHHHHhcCC
Q psy8719           9 RTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~   26 (33)
                      .++.+|.++++.|-+.|.
T Consensus        45 ~~r~ea~~~~~~ll~~g~   62 (81)
T cd04371          45 ITREEAVELGQALLKHGL   62 (81)
T ss_pred             CCHHHHHHHHHHHHHCCC
Confidence            688999999999987763


No 338
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=41.10  E-value=45  Score=16.07  Aligned_cols=31  Identities=10%  Similarity=-0.033  Sum_probs=21.2

Q ss_pred             CceEEEEecc------hhhHHHHHHHHHhcCCceeee
Q psy8719           1 MDRALIFCRT------KLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         1 ~~~aIVF~nT------K~~ad~La~~L~~~G~~~~~~   31 (33)
                      |-|++|..-+      ...|..+++.|+++|.....+
T Consensus         1 P~qv~i~p~~~~~~~~~~~a~~la~~Lr~~g~~v~~d   37 (94)
T cd00861           1 PFDVVIIPMNMKDEVQQELAEKLYAELQAAGVDVLLD   37 (94)
T ss_pred             CeEEEEEEcCCCcHHHHHHHHHHHHHHHHCCCEEEEE
Confidence            3466666533      346889999999998776543


No 339
>PF09428 DUF2011:  Fungal protein of unknown function (DUF2011);  InterPro: IPR018555  This is a family of fungal proteins whose function is unknown. 
Probab=40.99  E-value=13  Score=20.91  Aligned_cols=11  Identities=45%  Similarity=0.851  Sum_probs=8.7

Q ss_pred             hcCCceeeeeC
Q psy8719          23 SIDRRLIYYFT   33 (33)
Q Consensus        23 ~~G~~~~~~~~   33 (33)
                      ......+|||+
T Consensus        14 ~~~RP~sYYfa   24 (131)
T PF09428_consen   14 VNERPLSYYFA   24 (131)
T ss_pred             cCCCCCcceeC
Confidence            45678999996


No 340
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. This dimeric PurR belongs to the LacI-GalR family of transcription regulators and is activated to bind to DNA operator sites by initially binding either of high affinity corepressors, hypoxanthine or guanine. PurR is composed of two functional domains: aan N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the purine transcription repressor undergoes a 
Probab=40.69  E-value=65  Score=17.78  Aligned_cols=27  Identities=19%  Similarity=0.000  Sum_probs=19.2

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++....+..++++|.++|++.+-++
T Consensus        97 V~~d~~~~~~~~~~~l~~~G~~~i~~i  123 (269)
T cd06275          97 IQDNSEEGGYLATRHLIELGHRRIGCI  123 (269)
T ss_pred             EeeCcHHHHHHHHHHHHHCCCceEEEE
Confidence            445556667788888888888776654


No 341
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=40.67  E-value=65  Score=17.83  Aligned_cols=25  Identities=20%  Similarity=0.085  Sum_probs=15.8

Q ss_pred             ecchhhHHHHHHHHHhcCCceeeee
Q psy8719           8 CRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .+....+..++++|.+.|++.+.++
T Consensus        96 ~d~~~ag~~a~~~L~~~g~~~i~~i  120 (265)
T cd06285          96 GDDVLGGRLATRHLLDLGHRRIAVL  120 (265)
T ss_pred             eCcHHHHHHHHHHHHHCCCccEEEE
Confidence            4445566667777777777666554


No 342
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein  (LIVBP)-like domain of the ionotropic glutamate receptors. This CD represents the ligand-binding domain of the family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein  (LIVBP)-like domain of the ionotropic glutamate receptors, all of which are structurally similar and related to the periplasmic-binding fold type I family. The family C GPCRs consist of metabotropic glutamate receptor (mGluR) receptors, a calcium-sensing receptor (CaSR), gamma-aminobutyric receptors (GABAb), the promiscuous L-alpha-amino acid receptor GPR6A, families of taste and pheromone receptors, and orphan receptors. Truncated splicing va
Probab=40.61  E-value=63  Score=17.65  Aligned_cols=24  Identities=13%  Similarity=0.115  Sum_probs=21.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++||.|..-+++..+.+.+.+.|.
T Consensus       197 ~viv~~~~~~~~~~~l~~a~~~g~  220 (298)
T cd06269         197 RVIVVFSSEEDALRLLEEAVELGM  220 (298)
T ss_pred             cEEEEEechHHHHHHHHHHHHcCC
Confidence            688999988899999999999987


No 343
>KOG0832|consensus
Probab=40.19  E-value=36  Score=21.57  Aligned_cols=28  Identities=11%  Similarity=0.031  Sum_probs=21.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      .-|.|++|+...+++.+.-.+.=++.++
T Consensus       109 GiILFv~tn~~~~~~ve~aA~r~~gy~~  136 (251)
T KOG0832|consen  109 GIILFVGTNNGFKDLVERAARRAGGYSH  136 (251)
T ss_pred             CeEEEEecCcchHHHHHHHHHHhcCcee
Confidence            4688999999999998877666555443


No 344
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional
Probab=40.18  E-value=65  Score=18.91  Aligned_cols=27  Identities=19%  Similarity=0.049  Sum_probs=20.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++.......++++|.+.|++.+-|+
T Consensus       156 V~~Dn~~~~~~a~~~L~~~G~~~I~~i  182 (343)
T PRK10727        156 IALDDRYGAWLATRHLIQQGHTRIGYL  182 (343)
T ss_pred             EEECcHHHHHHHHHHHHHCCCccEEEE
Confidence            445666777788889999998887665


No 345
>PRK03188 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=39.88  E-value=79  Score=18.92  Aligned_cols=25  Identities=8%  Similarity=0.113  Sum_probs=20.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++++++.++.++++++.|++.|..
T Consensus       255 tv~~l~~~~~~~~~~~~~l~~~g~~  279 (300)
T PRK03188        255 TCAFLCADADSAVDVAAALSGAGVC  279 (300)
T ss_pred             ceEEEeCCHHHHHHHHHHHHhcCcc
Confidence            3567788889999999999987753


No 346
>PF14417 MEDS:  MEDS: MEthanogen/methylotroph, DcmR Sensory domain
Probab=39.88  E-value=49  Score=18.64  Aligned_cols=26  Identities=15%  Similarity=0.198  Sum_probs=20.3

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +++|+.++.....+.+.+.|++.|-.
T Consensus        48 e~~l~v~~~~~~~~~l~~~L~~~~~d   73 (191)
T PF14417_consen   48 ERCLYVAPDPRRVEELRDELRKAGPD   73 (191)
T ss_pred             CeEEEEECCCCCHHHHHHHHHhcCCc
Confidence            46788887788889999999876543


No 347
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=39.86  E-value=49  Score=16.12  Aligned_cols=21  Identities=19%  Similarity=0.309  Sum_probs=17.9

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |.+.++.+++.+.|.++|...
T Consensus        66 v~~~~~l~~~~~~l~~~G~~~   86 (120)
T cd08362          66 VASRADVDALARQVAARGGTV   86 (120)
T ss_pred             eCCHHHHHHHHHHHHHcCCce
Confidence            567789999999999998864


No 348
>PRK10839 16S rRNA pseudouridylate synthase A; Provisional
Probab=39.85  E-value=37  Score=19.69  Aligned_cols=27  Identities=4%  Similarity=-0.010  Sum_probs=19.8

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++.+-+..|..  .+.+.++.|.
T Consensus       107 Glll~ak~~~~~~~l~~--~~~~i~K~Y~  133 (232)
T PRK10839        107 GLVLMTDDGQWSHRITS--PRHHCEKTYL  133 (232)
T ss_pred             eEEEEecCHHHHHHHhC--CCCCCCeEEE
Confidence            46899999887777765  4556777775


No 349
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism]
Probab=39.84  E-value=52  Score=20.97  Aligned_cols=26  Identities=8%  Similarity=0.135  Sum_probs=23.2

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++.-|+.++.+.+++++..|++.+..
T Consensus       156 ~~I~i~~r~~~~~e~~a~~l~~~~~~  181 (330)
T COG2423         156 REIRVYSRDPEAAEAFAARLRKRGGE  181 (330)
T ss_pred             cEEEEEcCCHHHHHHHHHHHHhhcCc
Confidence            56789999999999999999998864


No 350
>cd02566 PseudoU_synth_RluE PseudoU_synth_RluE: Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required.  Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.
Probab=39.76  E-value=40  Score=18.76  Aligned_cols=27  Identities=15%  Similarity=0.155  Sum_probs=16.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -.|||+++++-+..+.+.  +.+.++.|.
T Consensus        45 Glll~a~d~~~~~~l~~~--~~~v~K~Y~   71 (168)
T cd02566          45 GLLLLTDDGRLQHRITDP--SFKHPKTYY   71 (168)
T ss_pred             EEEEEEeCHHHHHHHHCC--CCCCCEEEE
Confidence            468999998644444432  223667764


No 351
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the C-terminal, catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as for other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=39.55  E-value=63  Score=17.28  Aligned_cols=24  Identities=13%  Similarity=0.090  Sum_probs=19.4

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |-| +...++.+++.+.|.++|...
T Consensus        60 iaf~v~~~~~v~~~~~~l~~~G~~~   84 (141)
T cd07258          60 VNFMVTDIDDIGKALYRIKAHDVKV   84 (141)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCcE
Confidence            445 667788999999999999864


No 352
>PRK14105 selenophosphate synthetase; Provisional
Probab=39.28  E-value=60  Score=20.02  Aligned_cols=24  Identities=17%  Similarity=0.037  Sum_probs=21.3

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCc
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .|+|+--+++++++.+.|++.|..
T Consensus       296 gLl~tv~~e~~~~~~~~l~~~g~~  319 (345)
T PRK14105        296 GLLISVKPEYKDKLIDKLEKNNVY  319 (345)
T ss_pred             eEEEEecHHHHHHHHHHHHhCCCC
Confidence            489999999999999999998764


No 353
>KOG0347|consensus
Probab=39.23  E-value=38  Score=24.27  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=19.4

Q ss_pred             EEEEecchhhHHHHHHHHHhc
Q psy8719           4 ALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +|||+.||+-|-.|.+.|.+.
T Consensus       266 ~LV~tPTRELa~QV~~Hl~ai  286 (731)
T KOG0347|consen  266 ALVVTPTRELAHQVKQHLKAI  286 (731)
T ss_pred             eEEecChHHHHHHHHHHHHHh
Confidence            899999999999999999764


No 354
>PRK08057 cobalt-precorrin-6x reductase; Reviewed
Probab=39.05  E-value=84  Score=19.06  Aligned_cols=29  Identities=24%  Similarity=0.314  Sum_probs=22.5

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      |...+||.-|.+ +..|++.|.+.|....+
T Consensus         2 ~~~IlvlgGT~e-gr~la~~L~~~g~~v~~   30 (248)
T PRK08057          2 MPRILLLGGTSE-ARALARALAAAGVDIVL   30 (248)
T ss_pred             CceEEEEechHH-HHHHHHHHHhCCCeEEE
Confidence            356788888864 68899999988876654


No 355
>PF11262 Tho2:  Transcription factor/nuclear export subunit protein 2;  InterPro: IPR021418  THO and TREX form a eukaryotic complex which functions in messenger ribonucleoprotein metabolism and plays a role in preventing the transcription-associated genetic instability [],[]. Tho2, along with four other subunits forms THO []. This entry represents a conserved domain found towards the C terminus of these proteins.
Probab=39.01  E-value=16  Score=22.57  Aligned_cols=21  Identities=43%  Similarity=0.705  Sum_probs=18.3

Q ss_pred             eEEEEecchhhHHHHHHHHHh
Q psy8719           3 RALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .++|||-|-.+|.++..+|..
T Consensus       155 ~~~ifscTe~EA~nlG~Fl~~  175 (298)
T PF11262_consen  155 SPLIFSCTENEAENLGRFLNE  175 (298)
T ss_pred             hhHHhccCHHHHHHHHHHHHH
Confidence            468999999999999998864


No 356
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=38.89  E-value=52  Score=23.67  Aligned_cols=24  Identities=13%  Similarity=0.228  Sum_probs=22.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++||.|.++..++++.+.|.+.|.
T Consensus       238 ~vii~~~s~~~~~~l~~~l~~~~~  261 (926)
T TIGR00580       238 KITVAAESESQAERLKSLLAEHDI  261 (926)
T ss_pred             eEEEEeCCHHHHHHHHHHHHHCCC
Confidence            689999999999999999998875


No 357
>PRK05600 thiamine biosynthesis protein ThiF; Validated
Probab=38.87  E-value=57  Score=20.74  Aligned_cols=26  Identities=8%  Similarity=0.416  Sum_probs=23.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..||.|++=.++...++.|+++|...
T Consensus       334 ~Ivv~C~sG~RS~~Aa~~L~~~G~~~  359 (370)
T PRK05600        334 NVVVYCASGIRSADFIEKYSHLGHEL  359 (370)
T ss_pred             cEEEECCCChhHHHHHHHHHHcCCCC
Confidence            47999999999999999999999764


No 358
>PF07652 Flavi_DEAD:  Flavivirus DEAD domain ;  InterPro: IPR011492 This is the Flavivirus DEAD domain. The domain is related to the DEAD/DEAH box helicase domain which is found in a large family of ATPases.; GO: 0005524 ATP binding, 0008026 ATP-dependent helicase activity, 0019079 viral genome replication; PDB: 2QEQ_A 2V6J_A 2V6I_A 8OHM_A 4A92_B 1JR6_A 1HEI_A 1ONB_A 1A1V_A 1YMF_A ....
Probab=38.44  E-value=37  Score=19.72  Aligned_cols=23  Identities=17%  Similarity=0.397  Sum_probs=20.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++||-..|+--++++.+.|+...
T Consensus        35 rvLvL~PTRvva~em~~aL~~~~   57 (148)
T PF07652_consen   35 RVLVLAPTRVVAEEMYEALKGLP   57 (148)
T ss_dssp             -EEEEESSHHHHHHHHHHTTTSS
T ss_pred             eEEEecccHHHHHHHHHHHhcCC
Confidence            78999999999999999997554


No 359
>TIGR01481 ccpA catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways.
Probab=38.25  E-value=81  Score=18.24  Aligned_cols=27  Identities=11%  Similarity=0.010  Sum_probs=18.8

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++.......++++|.+.|++.+-++
T Consensus       156 V~~D~~~~~~~a~~~L~~~G~~~I~~i  182 (329)
T TIGR01481       156 VNIDYKQATKEAVGELIAKGHKSIAFV  182 (329)
T ss_pred             EEECcHHHHHHHHHHHHHCCCCeEEEE
Confidence            344556667778888888888776554


No 360
>PF09413 DUF2007:  Domain of unknown function (DUF2007);  InterPro: IPR018551  This is a family of proteins with unknown function. ; PDB: 2HFV_A.
Probab=38.22  E-value=48  Score=15.54  Aligned_cols=24  Identities=8%  Similarity=0.105  Sum_probs=17.8

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCc
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      -|..++..-+|+.+...|++.|..
T Consensus         2 ~l~~~~~~~ea~~i~~~L~~~gI~   25 (67)
T PF09413_consen    2 KLYTAGDPIEAELIKGLLEENGIP   25 (67)
T ss_dssp             EEEEE--HHHHHHHHHHHHHTT--
T ss_pred             EEEEcCCHHHHHHHHHHHHhCCCc
Confidence            467788899999999999999975


No 361
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional
Probab=38.22  E-value=87  Score=19.32  Aligned_cols=27  Identities=11%  Similarity=0.190  Sum_probs=18.3

Q ss_pred             ceEEEEecchh-h----HHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKL-D----CDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~-~----ad~La~~L~~~G~~~   28 (33)
                      .++.|+.|... +    ++++.++|+++|.+.
T Consensus         6 ~~v~iv~~~~~~~~~e~~~~i~~~L~~~g~~v   37 (291)
T PRK02155          6 KTVALIGRYQTPGIAEPLESLAAFLAKRGFEV   37 (291)
T ss_pred             CEEEEEecCCCHHHHHHHHHHHHHHHHCCCEE
Confidence            45788888654 3    567777787777653


No 362
>PF14527 LAGLIDADG_WhiA:  WhiA LAGLIDADG-like domain; PDB: 3HYI_A 3HYJ_D.
Probab=38.21  E-value=48  Score=17.25  Aligned_cols=24  Identities=17%  Similarity=0.094  Sum_probs=16.4

Q ss_pred             EEEecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      -+.++..+.++.|.+.|++.|...
T Consensus        25 Ei~~~~~e~a~~l~~lL~~~~i~~   48 (93)
T PF14527_consen   25 EIRFNDEEFAEQLKELLNKFGINA   48 (93)
T ss_dssp             EEEES-HHHHHHHHHHHHHH----
T ss_pred             EEecCCHHHHHHHHHHHHHcCCCc
Confidence            467888999999999999877643


No 363
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational
Probab=38.20  E-value=72  Score=17.59  Aligned_cols=26  Identities=15%  Similarity=0.011  Sum_probs=17.1

Q ss_pred             EecchhhHHHHHHHHHhcCCceeeee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      -++..+....++++|.+.|++...++
T Consensus        97 ~~d~~~~~~~~~~~l~~~g~~~i~~i  122 (268)
T cd06273          97 GFDNREAGRLAARHLIALGHRRIAMI  122 (268)
T ss_pred             EeChHHHHHHHHHHHHHCCCCeEEEE
Confidence            34555666777777777777766554


No 364
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=38.16  E-value=52  Score=22.34  Aligned_cols=23  Identities=9%  Similarity=0.167  Sum_probs=20.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      ++||-|.|++-|.++++.|.+..
T Consensus        76 ~~LIL~PTreLa~Qv~~~l~~~~   98 (629)
T PRK11634         76 QILVLAPTRELAVQVAEAMTDFS   98 (629)
T ss_pred             eEEEEeCcHHHHHHHHHHHHHHH
Confidence            78999999999999998887653


No 365
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif. The SH3BGR gene was cloned in an effort to identify genes mapping to chromosome 21, which could be involved in the pathogenesis of congenital heart disease affecting Down syndrome newborns. Several human SH3BGR-like (SH3BGRL) genes have been identified since, mapping to different locations in the chromosome. Of these, SH3BGRL3 was identified as a tumor necrosis factor (TNF) alpha inhibitory protein and was also named TIP-B1. Upregulation of expression of SH3BGRL3 is associated with differentiation. It has been suggested that it functions as a regulator of differentiation-related signal transduction pathways.
Probab=38.13  E-value=37  Score=17.68  Aligned_cols=21  Identities=10%  Similarity=0.113  Sum_probs=17.8

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      -.+|++|+++-..|...|..+
T Consensus        13 ~~~k~~~~~v~~lL~~k~I~f   33 (92)
T cd03030          13 TEIKKRQQEVLGFLEAKKIEF   33 (92)
T ss_pred             HHHHHHHHHHHHHHHHCCCce
Confidence            357999999999999988764


No 366
>TIGR02024 FtcD glutamate formiminotransferase. This model covers enzymes from metazoa as well as gram-positive bacteria and archaea. In humans, deficiency of this enzyme results in a disease phenotype. The crystal structure of the enzyme has been studied in the context of the catalytic mechanism.
Probab=38.11  E-value=44  Score=21.41  Aligned_cols=26  Identities=4%  Similarity=-0.074  Sum_probs=21.8

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      -+-|.+...++++|..++..|+++.+
T Consensus       188 ~L~t~d~~~a~~IAk~vR~~gGGL~~  213 (298)
T TIGR02024       188 NLGTSNLEIAKKIAKAIRFQGGGLRF  213 (298)
T ss_pred             eecCCCHHHHHHHHHHhhhcCCCccc
Confidence            34577788999999999999999754


No 367
>PRK04164 hypothetical protein; Provisional
Probab=38.11  E-value=58  Score=18.97  Aligned_cols=27  Identities=15%  Similarity=0.022  Sum_probs=20.7

Q ss_pred             EEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .|+.-|++.-+.+++.|++.|++-..+
T Consensus        94 ~v~IIT~~~~~~i~~~Lr~~grGVT~~  120 (181)
T PRK04164         94 TVRVITKEYELELANELRELGYGVTVF  120 (181)
T ss_pred             EEEEEeCCchHHHHHHHHHCCCCEEEE
Confidence            466677777777999999998886543


No 368
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein 
Probab=37.98  E-value=56  Score=16.28  Aligned_cols=28  Identities=11%  Similarity=0.076  Sum_probs=20.8

Q ss_pred             eEEEEec------chhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCR------TKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~n------TK~~ad~La~~L~~~G~~~~~   30 (33)
                      .++||+.      .=--|.++.+.|++.|..+..
T Consensus         9 ~vvvf~k~~~~~~~Cp~C~~ak~~L~~~~i~y~~   42 (90)
T cd03028           9 PVVLFMKGTPEEPRCGFSRKVVQILNQLGVDFGT   42 (90)
T ss_pred             CEEEEEcCCCCCCCCcHHHHHHHHHHHcCCCeEE
Confidence            5789976      345688999999998876543


No 369
>PF00006 ATP-synt_ab:  ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f;  InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The F-ATPases (or F1F0-ATPases), V-ATPases (or V1V0-ATPases) and A-ATPases (or A1A0-ATPases) are composed of two linked complexes: the F1, V1 or A1 complex contains the catalytic core that synthesizes/hydrolyses ATP, and the F0, V0 or A0 complex that forms the membrane-spanning pore. The F-, V- and A-ATPases all contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, ]. In F-ATPases, there are three copies each of the alpha and beta subunits that form the catalytic core of the F1 complex, while the remaining F1 subunits (gamma, delta, epsilon) form part of the stalks. There is a substrate-binding site on each of the alpha and beta subunits, those on the beta subunits being catalytic, while those on the alpha subunits are regulatory. The alpha and beta subunits form a cylinder that is attached to the central stalk. The alpha/beta subunits undergo a sequence of conformational changes leading to the formation of ATP from ADP, which are induced by the rotation of the gamma subunit, itself driven by the movement of protons through the F0 complex C subunit []. In V- and A-ATPases, the alpha/A and beta/B subunits of the V1 or A1 complex are homologous to the alpha and beta subunits in the F1 complex of F-ATPases, except that the alpha subunit is catalytic and the beta subunit is regulatory. The structure of the alpha and beta subunits is almost identical. Each subunit consists of a N-terminal beta-barrel, a central domain containing the nucleotide-binding site and a C-terminal alpha bundle domain []. This entry represents the central domain. It is found in the alpha and beta subunits from F1, V1, and A1 complexes, as well as in flagellar ATPase and the termination factor Rho. ; GO: 0005524 ATP binding; PDB: 3OEE_N 2HLD_W 3FKS_N 3OE7_O 3OFN_M 2XOK_D 3OEH_V 2WPD_F 3ZRY_D 2OBL_A ....
Probab=37.85  E-value=47  Score=19.68  Aligned_cols=27  Identities=11%  Similarity=0.306  Sum_probs=19.5

Q ss_pred             ceEEEEecchh-----------hHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKL-----------DCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~-----------~ad~La~~L~~~G~~~   28 (33)
                      ++++|+++|-+           .+-.+|++++.+|+..
T Consensus        70 ~~t~vv~~t~~~~~~~r~~~~~~a~t~AEyfrd~G~dV  107 (215)
T PF00006_consen   70 ERTVVVAATSDEPPAARYRAPYTALTIAEYFRDQGKDV  107 (215)
T ss_dssp             GGEEEEEEETTS-HHHHHHHHHHHHHHHHHHHHTTSEE
T ss_pred             cccccccccchhhHHHHhhhhccchhhhHHHhhcCCce
Confidence            56778888866           4466788888877754


No 370
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional
Probab=37.76  E-value=83  Score=18.18  Aligned_cols=25  Identities=16%  Similarity=0.143  Sum_probs=18.3

Q ss_pred             ecchhhHHHHHHHHHhcCCceeeee
Q psy8719           8 CRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ++....+..++++|-+.|++.+-++
T Consensus       161 ~d~~~~~~~a~~~L~~~G~r~I~~i  185 (328)
T PRK11303        161 SDDQDDAEMLAESLLKFPAESILLL  185 (328)
T ss_pred             eCCHHHHHHHHHHHHHCCCCeEEEE
Confidence            4556677788888888888877654


No 371
>cd04448 DEP_PIKfyve DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGEF (GDP/GTP exchange factor) PIKfyve-like proteins. PIKfyve contains N-terminal Fyve finger and DEP domains, a central chaperonin-like domain and a C-terminal PIPK (phosphatidylinositol phosphate kinase) domain. PIKfyve-like proteins are important phosphatidylinositol (3)-monophosphate (PtdIns(3)P)-5-kinases, producing PtdIns(3,5)P2, which plays a major role in multivesicular body (MVB) sorting and control of retrograde traffic from the vacuole back to the endosome and/or Golgi. PIKfyve itself has been shown to be play a role in regulating early-endosome-to-trans-Golgi network (TGN) retrograde trafficking.
Probab=37.68  E-value=40  Score=17.20  Aligned_cols=19  Identities=11%  Similarity=0.085  Sum_probs=16.3

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.++.+|-.+++.|-..|.
T Consensus        44 ~~~R~eAv~~gq~Ll~~g~   62 (81)
T cd04448          44 AATRVQAIAIGQALLDAGW   62 (81)
T ss_pred             CCCHHHHHHHHHHHHHCCC
Confidence            5789999999999988774


No 372
>PF12579 DUF3755:  Protein of unknown function (DUF3755);  InterPro: IPR022228  This domain family is found in eukaryotes, and is approximately 40 amino acids in length. There is a single completely conserved residue N that may be functionally important. 
Probab=37.56  E-value=14  Score=16.73  Aligned_cols=21  Identities=19%  Similarity=0.417  Sum_probs=16.5

Q ss_pred             EEecchhhHHHHHHHHHhcCC
Q psy8719           6 IFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~   26 (33)
                      .||+||+....|-+.+...++
T Consensus        11 Lf~~~R~NI~~il~~m~~mpg   31 (35)
T PF12579_consen   11 LFCQTRDNILAILNDMNDMPG   31 (35)
T ss_pred             HHHHHHHHHHHHHHHHHcchh
Confidence            488999999988888876543


No 373
>PF13117 Cag12:  Cag pathogenicity island protein Cag12
Probab=37.35  E-value=69  Score=17.74  Aligned_cols=26  Identities=4%  Similarity=0.025  Sum_probs=22.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .+.||.+.......+.-++|+++|-.
T Consensus        81 ~~iIv~~~~~~~~~~~K~wL~~nGa~  106 (113)
T PF13117_consen   81 AKIIVLTGDGNLFFQYKNWLRKNGAT  106 (113)
T ss_pred             ccEEEEcCCHHHHHHHHHHHHHcCCc
Confidence            36789999999999999999999975


No 374
>PF13344 Hydrolase_6:  Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A ....
Probab=37.13  E-value=63  Score=16.61  Aligned_cols=25  Identities=4%  Similarity=0.125  Sum_probs=15.3

Q ss_pred             eEEEEecch-hhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTK-LDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK-~~ad~La~~L~~~G~~   27 (33)
                      +.++.+|+- ...+.+++.|++.|..
T Consensus        32 ~~~~lTNns~~s~~~~~~~L~~~Gi~   57 (101)
T PF13344_consen   32 PVVFLTNNSSRSREEYAKKLKKLGIP   57 (101)
T ss_dssp             EEEEEES-SSS-HHHHHHHHHHTTTT
T ss_pred             CEEEEeCCCCCCHHHHHHHHHhcCcC
Confidence            455666665 3447888888777754


No 375
>PF03033 Glyco_transf_28:  Glycosyltransferase family 28 N-terminal domain;  InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (2.4.1.- from EC) and related proteins into distinct sequence based families has been described []. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'. Glycosyltransferase family 28 GT28 from CAZY comprises enzymes with a number of known activities; 1,2-diacylglycerol 3-beta-galactosyltransferase (2.4.1.46 from EC); 1,2-diacylglycerol 3-beta-glucosyltransferase (2.4.1.157 from EC); beta-N-acetylglucosamine transferase (2.4.1 from EC).; GO: 0016758 transferase activity, transferring hexosyl groups, 0005975 carbohydrate metabolic process, 0030259 lipid glycosylation; PDB: 2IYF_B 2YJN_A 2P6P_A 1PNV_A 3H4T_A 3H4I_A 1PN3_B 3IA7_B 1NLM_B 1F0K_B ....
Probab=36.80  E-value=34  Score=17.44  Aligned_cols=16  Identities=19%  Similarity=0.094  Sum_probs=12.2

Q ss_pred             HHHHHHHHhcCCceee
Q psy8719          15 DNLERYLNSIDRRLIY   30 (33)
Q Consensus        15 d~La~~L~~~G~~~~~   30 (33)
                      -.|++.|+++|++-..
T Consensus        16 lala~~L~~rGh~V~~   31 (139)
T PF03033_consen   16 LALARALRRRGHEVRL   31 (139)
T ss_dssp             HHHHHHHHHTT-EEEE
T ss_pred             HHHHHHHhccCCeEEE
Confidence            3689999999998763


No 376
>PF07090 DUF1355:  Protein of unknown function (DUF1355);  InterPro: IPR010768 This entry is found in several hypothetical bacterial proteins of around 250 residues in length. The function of these proteins is unknown.; PDB: 2GK3_D 3SOZ_C 3RHT_D.
Probab=36.78  E-value=79  Score=18.44  Aligned_cols=26  Identities=15%  Similarity=0.301  Sum_probs=17.5

Q ss_pred             eEEEEec-----------chhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCR-----------TKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~n-----------TK~~ad~La~~L~~~G~~~~   29 (33)
                      .+|||.|           +-...+.|+++-++ |+++.
T Consensus        69 D~vIl~dv~~~~ll~~~~~~~~~~~l~~yV~~-GGgLl  105 (177)
T PF07090_consen   69 DVVILSDVPANSLLKSRRSPNQLELLADYVRD-GGGLL  105 (177)
T ss_dssp             SEEEEES--HHHHHT----HHHHHHHHHHHHT-T-EEE
T ss_pred             CEEEEeCCCchhcccccCCHHHHHHHHHHHHh-CCEEE
Confidence            3677777           55667788888765 88874


No 377
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=36.78  E-value=59  Score=16.26  Aligned_cols=21  Identities=14%  Similarity=0.121  Sum_probs=17.6

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +.+.++.+.+.+.|.++|...
T Consensus        65 v~~~~dl~~~~~~l~~~Gv~~   85 (120)
T cd07252          65 VADEAALDALAARLRAAGVAV   85 (120)
T ss_pred             ECCHHHHHHHHHHHHHcCCeE
Confidence            566789999999999998764


No 378
>PRK10876 recB exonuclease V subunit beta; Provisional
Probab=36.70  E-value=67  Score=23.59  Aligned_cols=28  Identities=11%  Similarity=0.252  Sum_probs=24.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCceee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLIY   30 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~~   30 (33)
                      ..-|-++|+.+++.+.+.|.+.|....|
T Consensus       553 DIAVLvRs~~~a~~i~~aL~~~gIP~v~  580 (1181)
T PRK10876        553 DITVLVRSRQEAALIRDALTLLAIPSVY  580 (1181)
T ss_pred             cEEEEEecCchHHHHHHHHHhCCCCEEE
Confidence            4568899999999999999999988654


No 379
>cd04442 DEP_1_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in DEP6-like proteins. DEP6 proteins contain two DEP and a PDZ domain. Their function is unknown.
Probab=36.67  E-value=43  Score=17.40  Aligned_cols=19  Identities=5%  Similarity=-0.080  Sum_probs=16.3

Q ss_pred             ecchhhHHHHHHHHHhcCC
Q psy8719           8 CRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~   26 (33)
                      +.|+.+|-.+++.|-+.|.
T Consensus        44 ~~sR~eAv~lgq~Ll~~gv   62 (82)
T cd04442          44 ASDRETAIKIMQKLLDHSI   62 (82)
T ss_pred             CCCHHHHHHHHHHHHHCCC
Confidence            5899999999999987763


No 380
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH). The C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate, found in Bacillus subtilis (BS) and other Firmicutes, Deinococci, and Bacteroidetes. PDH is the first enzyme in the aromatic amino acid pathway specific for the biosynthesis of tyrosine. This enzyme is feedback-inhibited by tyrosine in B. subtilis and other microorganisms. Both phenylalanine and tryptophan have been shown to be inhibitors of this activity in B. subtilis. Bifunctional  chorismate mutase-PDH (TyrA) enzymes such as those seen in Escherichia coli  do not contain an ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=36.66  E-value=49  Score=15.20  Aligned_cols=22  Identities=18%  Similarity=0.190  Sum_probs=16.8

Q ss_pred             EEecchhhHHHHHHHHHhcCCc
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +-++...+.+++.+.|+++|..
T Consensus        47 i~v~~~~~~~~~~~~L~~~G~~   68 (69)
T cd04909          47 ISFKTQEDRERAKEILKEAGYE   68 (69)
T ss_pred             EEECCHHHHHHHHHHHHHcCCc
Confidence            3444556889999999999864


No 381
>TIGR02643 T_phosphoryl thymidine phosphorylase. Thymidine phosphorylase (alternate name: pyrimidine phosphorylase), EC 2.4.2.4, is the designation for the enzyme of E. coli and other Proteobacteria involved in (deoxy)nucleotide degradation. It often occurs in an operon with a deoxyribose-phosphate aldolase, phosphopentomutase and a purine nucleoside phosphorylase. In many other lineages, the corresponding enzyme is designated pyrimidine-nucleoside phosphorylase (EC 2.4.2.2); the naming convention imposed by this model represents standard literature practice.
Probab=36.54  E-value=18  Score=24.14  Aligned_cols=22  Identities=23%  Similarity=0.298  Sum_probs=19.0

Q ss_pred             EEecchhhHHHHHHHHHhcCCc
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .|+.|.++|++||+.|.+-|.+
T Consensus       208 Afmk~~~~A~~LA~~mv~ig~~  229 (437)
T TIGR02643       208 AFMPTYEESEELARSLVDVANG  229 (437)
T ss_pred             CcCCCHHHHHHHHHHHHHHHHH
Confidence            3899999999999999877654


No 382
>cd01646 RT_Bac_retron_I RT_Bac_retron_I: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The polymerase reaction of this enzyme leads to the production of a unique RNA-DNA complex called msDNA (multicopy single-stranded (ss)DNA) in which a small ssDNA branches out from a small ssRNA molecule via a 2'-5'phosphodiester linkage. Bacterial retron RTs produce cDNA corresponding to only a small portion of the retron genome.
Probab=36.53  E-value=70  Score=17.27  Aligned_cols=20  Identities=25%  Similarity=0.385  Sum_probs=13.4

Q ss_pred             ceEEEEecchhhHHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERYL   21 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L   21 (33)
                      +-.+|+++++..++++.+.+
T Consensus        90 DD~~i~~~~~~~~~~~~~~i  109 (158)
T cd01646          90 DDIRIFADSKEEAEEILEEL  109 (158)
T ss_pred             CcEEEEcCCHHHHHHHHHHH
Confidence            44678999988775544443


No 383
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=36.48  E-value=24  Score=17.26  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=10.2

Q ss_pred             ceEEEEecchhhH
Q psy8719           2 DRALIFCRTKLDC   14 (33)
Q Consensus         2 ~~aIVF~nTK~~a   14 (33)
                      .+++.|||.|-..
T Consensus        26 gkv~~F~s~Kc~~   38 (54)
T cd00472          26 GKVFRFCSSKCEK   38 (54)
T ss_pred             CCEEEEECHHHHH
Confidence            4688999999653


No 384
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR. Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR, all of which are members of the LacI-GalR family of bacterial transcription regulators. RegR regulates bacterial competence and the expression of virulence factors, including hyaluronidase. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA b
Probab=36.47  E-value=76  Score=17.37  Aligned_cols=26  Identities=8%  Similarity=-0.054  Sum_probs=17.2

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      |-++..+....++++|.+.|++.+-+
T Consensus        96 v~~d~~~~g~~~~~~l~~~g~~~i~~  121 (267)
T cd06283          96 VTLDNYEAAKEAVDHLIEKGYERILF  121 (267)
T ss_pred             EEeccHHHHHHHHHHHHHcCCCcEEE
Confidence            45566667777777777777665543


No 385
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type. This enzyme, a homolog of bacterial ornithine cyclodeaminases and marsupial mu-crystallins, is a homodimeric, NAD-dependent alanine dehydrogenase found in Archaeoglobus fulgidus and several other Archaea. For a number of close homologs, scoring between trusted and noise cutoffs, it is not clear at present what is the enzymatic activity.
Probab=36.28  E-value=68  Score=19.80  Aligned_cols=26  Identities=12%  Similarity=0.308  Sum_probs=22.0

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      +++.|+-++++.++.+++.+++.|..
T Consensus       154 ~~v~V~~r~~~~~~~~~~~~~~~g~~  179 (325)
T TIGR02371       154 EEVSVYCRTPSTREKFALRASDYEVP  179 (325)
T ss_pred             CEEEEECCCHHHHHHHHHHHHhhCCc
Confidence            57889999999999999999876643


No 386
>CHL00067 rps2 ribosomal protein S2
Probab=36.26  E-value=50  Score=19.80  Aligned_cols=25  Identities=20%  Similarity=0.216  Sum_probs=20.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .-|.|++||....++.+...+.-++
T Consensus        69 g~ILfV~t~~~~~~~v~~~a~~~~~   93 (230)
T CHL00067         69 KKFLFVGTKKQAADLVASAAIRARC   93 (230)
T ss_pred             CeEEEEeCcHHHHHHHHHHHHHhCC
Confidence            4688999999999998888666543


No 387
>cd04450 DEP_RGS7-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in RGS (regulator of G-protein signaling) proteins of the subfamily R7. This subgroup contains RGS7, RGS6, RGS9 and RGS11. They share a common domain architecture, containing, beside the RGS domain, a DEP domain and a GGL (G-protein gamma subunit-like ) domain. RGS proteins are GTPase-activating (GAP) proteins of heterotrimeric G proteins by increasing the rate of GTP hydrolysis of the alpha subunit. The fungal homologs, like yeast Sst2, share a related common domain architecture, containing RGS and DEP domains. Sst2 has been identified as the principal regulator of mating pheromone signaling and recently the DEP domain of Sst2 has been shown to be necessary and sufficient to mediate receptor interaction.
Probab=36.26  E-value=44  Score=17.02  Aligned_cols=18  Identities=0%  Similarity=-0.095  Sum_probs=15.6

Q ss_pred             cchhhHHHHHHHHHhcCC
Q psy8719           9 RTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~   26 (33)
                      .++++|.++++.|-+.|.
T Consensus        45 ~~~~EA~~~~~~ll~~gl   62 (88)
T cd04450          45 VDPSEALEIAALFVKYGL   62 (88)
T ss_pred             CCHHHHHHHHHHHHHCCC
Confidence            688999999999988774


No 388
>PF02829 3H:  3H domain;  InterPro: IPR004173 The 3H domain is named after its three highly conserved histidine residues. The 3H domain appears to be a small molecule-binding domain, based on its occurrence with other domains []. Several proteins carrying this domain are transcriptional regulators from the biotin repressor family. The transcription regulator TM1602 from Thermotoga maritima is a DNA-binding protein thought to belong to a family of de novo NAD synthesis pathway regulators. TM1602 has an N-terminal DNA-binding domain and a C-terminal 3H regulatory domain. The N-terminal domain appears to bind to the NAD promoter region and repress the de novo NAD biosynthesis operon, while the C-terminal 3H domain may bind to nicotinamide, nicotinic acid, or other substrate/products []. The 3H domain has a 2-layer alpha/beta sandwich fold.; GO: 0005488 binding; PDB: 1J5Y_A.
Probab=36.25  E-value=67  Score=17.20  Aligned_cols=21  Identities=24%  Similarity=0.178  Sum_probs=14.8

Q ss_pred             EEecchhhHHHHHHHHHhcCC
Q psy8719           6 IFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~   26 (33)
                      |-|..++.-+++-+.|++.|.
T Consensus        76 I~a~~~e~l~~I~~~L~~~G~   96 (98)
T PF02829_consen   76 IEAPDEEDLDKIEEALKKKGF   96 (98)
T ss_dssp             EEESSHHHHHHHHHHHHHTT-
T ss_pred             EEECCHHHHHHHHHHHHHCCC
Confidence            556777777777777777763


No 389
>PF07545 Vg_Tdu:  Vestigial/Tondu family;  InterPro: IPR011520 The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. Transcriptional activation by these proteins likely requires interactions with specific coactivators. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed. This short conserved region is needed for interaction with Sd [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 4EAZ_C.
Probab=36.25  E-value=49  Score=15.07  Aligned_cols=19  Identities=16%  Similarity=0.200  Sum_probs=12.8

Q ss_pred             ceEEEEecchhhHHHHHHH
Q psy8719           2 DRALIFCRTKLDCDNLERY   20 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~   20 (33)
                      .+++||+-.+-+...+.++
T Consensus         5 s~cVvfTy~~Gd~~s~VDe   23 (33)
T PF07545_consen    5 SRCVVFTYFQGDIASVVDE   23 (33)
T ss_dssp             TTEEEEE-SSS-HHHHHHH
T ss_pred             ccEEEEEEEcCchHHHHHH
Confidence            4789999998887766553


No 390
>COG4004 Uncharacterized protein conserved in archaea [Function unknown]
Probab=36.08  E-value=33  Score=18.90  Aligned_cols=19  Identities=26%  Similarity=0.268  Sum_probs=16.2

Q ss_pred             hhhHHHHHHHHHhcCCcee
Q psy8719          11 KLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus        11 K~~ad~La~~L~~~G~~~~   29 (33)
                      +.+.|+|.+.|+..|.+++
T Consensus        11 ~~~~dri~~~l~e~g~~v~   29 (96)
T COG4004          11 KPDPDRIMRGLSELGWTVS   29 (96)
T ss_pred             CCCHHHHHHHHHHhCeeEe
Confidence            5688999999999997764


No 391
>TIGR01955 RfaH transcriptional activator RfaH. This model represents the transcriptional activator protein, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes.
Probab=35.95  E-value=60  Score=17.55  Aligned_cols=21  Identities=14%  Similarity=0.483  Sum_probs=16.0

Q ss_pred             EEEecchhhHHHHHHHHHhcCC
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~   26 (33)
                      ++.|+.+.+ +.+++.|+++|.
T Consensus         3 vl~~~~~~E-~~v~~~L~~~gi   23 (159)
T TIGR01955         3 LLYCKPRQE-QRAQEHLERQAV   23 (159)
T ss_pred             EEEEcCchH-HHHHHHHHHCCC
Confidence            567777766 677888999885


No 392
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type. This model represents a clade of shikimate-5-dehydrogenases found in Corynebacterium, Mycobacteria and fungi. The fungal sequences are pentafunctional proteins known as AroM which contain the central five seven steps in the chorismate biosynthesis pathway. The Corynebacterium and Mycobacterial sequences represent the sole shikimate-5-dehydrogenases in species which otherwise have every enzyme of the chorismate biosynthesis pathway.
Probab=35.81  E-value=78  Score=19.10  Aligned_cols=23  Identities=9%  Similarity=-0.015  Sum_probs=18.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      ++..|+-||.+.+++|++.+...
T Consensus       150 ~~i~I~nRt~~ka~~La~~~~~~  172 (282)
T TIGR01809       150 TDITVINRNPDKLSRLVDLGVQV  172 (282)
T ss_pred             CeEEEEeCCHHHHHHHHHHhhhc
Confidence            46788999999999999987543


No 393
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane]
Probab=35.75  E-value=75  Score=20.28  Aligned_cols=25  Identities=16%  Similarity=0.339  Sum_probs=22.1

Q ss_pred             EEEEe---cchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFC---RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~---nTK~~ad~La~~L~~~G~~~   28 (33)
                      +|+|.   .|++-.+++.++|++.|...
T Consensus       253 vi~~~~~d~tr~~~~r~~~~~~~~ga~v  280 (340)
T COG2222         253 VLLFVSEDETRELDERALKFLKNYGAKV  280 (340)
T ss_pred             EEEEecCCcchhHHHHHHHHHHhcCCeE
Confidence            68888   89999999999999988764


No 394
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype. This model describes a CRISPR-associated putative DEAH-box helicase, or Cas3, of a subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. This protein includes both DEAH and HD motifs.
Probab=35.55  E-value=31  Score=24.80  Aligned_cols=25  Identities=20%  Similarity=0.384  Sum_probs=21.0

Q ss_pred             eEEEEe-cchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFC-RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~-nTK~~ad~La~~L~~~G~~   27 (33)
                      +.|||+ +||+-++.+++.+++.+..
T Consensus        63 ~rLv~~vPtReLa~Qi~~~~~~~~k~   88 (844)
T TIGR02621        63 RRLVYVVNRRTVVDQVTEEAEKIGER   88 (844)
T ss_pred             ceEEEeCchHHHHHHHHHHHHHHHHH
Confidence            578877 9999999999988887753


No 395
>PF06877 RraB:  Regulator of ribonuclease activity B;  InterPro: IPR009671 This entry occurs in several hypothetical bacterial proteins of around 120 residues in length. The function of these proteins is unknown. The protein structure has been determined for one member of this group, the hypothetical protein VCO424 from Vibrio cholerae; it has an alpha+beta sandwich fold.; PDB: 1NXI_A.
Probab=35.21  E-value=64  Score=16.36  Aligned_cols=23  Identities=9%  Similarity=0.250  Sum_probs=16.3

Q ss_pred             EecchhhHHHHHHHHHhcCCcee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ...++.+++.+++.|.+.|....
T Consensus        31 ~f~~~~~~~~f~~~~~~~g~~v~   53 (104)
T PF06877_consen   31 YFEDEEDAEKFAEELEKLGYEVE   53 (104)
T ss_dssp             EES-HHHHHHHHHHHHHHS---B
T ss_pred             EeCCHHHHHHHHHHHHHCCCEEE
Confidence            34899999999999999987643


No 396
>TIGR01364 serC_1 phosphoserine aminotransferase. This model represents the common form of the phosphoserine aminotransferase SerC. The phosphoserine aminotransferase of the archaeon Methanosarcina barkeri and putative phosphoserine aminotransferase of Mycobacterium tuberculosis are represented by separate models. All are members of the class V aminotransferases (pfam00266).
Probab=35.19  E-value=32  Score=21.26  Aligned_cols=20  Identities=5%  Similarity=0.094  Sum_probs=17.1

Q ss_pred             EEEEecchhhHHHHHHHHHh
Q psy8719           4 ALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~   23 (33)
                      ++...||++++|.|.+.|++
T Consensus       325 S~~~~nt~edid~l~~al~~  344 (349)
T TIGR01364       325 SIYNAMPLEGVQALVDFMKE  344 (349)
T ss_pred             ECcCCCCHHHHHHHHHHHHH
Confidence            45678999999999999986


No 397
>PTZ00298 mevalonate kinase; Provisional
Probab=35.06  E-value=63  Score=19.79  Aligned_cols=22  Identities=5%  Similarity=0.104  Sum_probs=17.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++.++...++++++++.|.+.
T Consensus       288 ~v~al~~~~~~a~~~~~~l~~~  309 (328)
T PTZ00298        288 LVVALAASEDQRDAIAKAVRAR  309 (328)
T ss_pred             EEEEEecchhhHHHHHHHHHHH
Confidence            4677888888899999998776


No 398
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=35.01  E-value=60  Score=15.78  Aligned_cols=19  Identities=16%  Similarity=0.256  Sum_probs=16.2

Q ss_pred             chhhHHHHHHHHHhcCCce
Q psy8719          10 TKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~   28 (33)
                      ...+.+++.+.|++.|...
T Consensus        74 ~~~dv~~~~~~l~~~g~~~   92 (125)
T cd08357          74 SEEEFDALAERLEAAGVEF   92 (125)
T ss_pred             eHHHHHHHHHHHHHCCCcE
Confidence            3489999999999999754


No 399
>PRK10672 rare lipoprotein A; Provisional
Probab=35.00  E-value=51  Score=21.69  Aligned_cols=23  Identities=9%  Similarity=0.237  Sum_probs=16.8

Q ss_pred             cchhhHHHHHHHHHhcCCceeee
Q psy8719           9 RTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      .++++++.+.+.|++.|..-+|.
T Consensus       335 ~sr~eA~kl~~rLk~~g~~qsFI  357 (361)
T PRK10672        335 ASRQQASALQQRLQTEAQQQSFI  357 (361)
T ss_pred             CCHHHHHHHHHHHHhccCCCcEE
Confidence            46777888888888877766654


No 400
>PRK09004 FMN-binding protein MioC; Provisional
Probab=34.96  E-value=36  Score=18.66  Aligned_cols=19  Identities=16%  Similarity=0.135  Sum_probs=13.5

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ||+.-|++|++.|.+.|..
T Consensus        14 nae~~A~~l~~~~~~~g~~   32 (146)
T PRK09004         14 GAEYVADHLAEKLEEAGFS   32 (146)
T ss_pred             HHHHHHHHHHHHHHHcCCc
Confidence            5666777777888777764


No 401
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major group in this CD corresponds to phosphoserine aminotransferase (PSAT).  PSAT is active as a dimer and catalyzes the conversion of phosphohydroxypyruvate to phosphoserine.
Probab=34.72  E-value=34  Score=20.83  Aligned_cols=20  Identities=5%  Similarity=0.140  Sum_probs=16.9

Q ss_pred             EEEEecchhhHHHHHHHHHh
Q psy8719           4 ALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~   23 (33)
                      ++.+-||++++|+|.+.|++
T Consensus       333 S~~~~nt~edi~~l~~al~~  352 (355)
T cd00611         333 SIYNALSLEGVQALADFMKE  352 (355)
T ss_pred             EccCCCCHHHHHHHHHHHHH
Confidence            34567899999999999986


No 402
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Escherichia coli YbbB protein was shown to encode a selenophosphate-dependent tRNA 2-selenouridine synthase, essential for modification of some tRNAs to replace a sulfur atom with selenium. This enzyme works with SelD, the selenium donor protein, which also acts in selenocysteine incorporation. Although the members of this protein family show a fairly deep split, sequences from both sides of the split are supported by co-occurence with, and often proximity to, the selD gene.
Probab=34.59  E-value=80  Score=19.77  Aligned_cols=25  Identities=24%  Similarity=0.493  Sum_probs=21.3

Q ss_pred             eEEEEec-chhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCR-TKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~n-TK~~ad~La~~L~~~G~~   27 (33)
                      ++||+|. .=..+...+..|+..|..
T Consensus        76 ~vvvyC~~gG~RS~~aa~~L~~~G~~  101 (311)
T TIGR03167        76 QPLLYCWRGGMRSGSLAWLLAQIGFR  101 (311)
T ss_pred             cEEEEECCCChHHHHHHHHHHHcCCC
Confidence            4899994 567899999999999985


No 403
>PF02437 Ski_Sno:  SKI/SNO/DAC family;  InterPro: IPR003380 The c-ski proto-oncogene has been shown to influence proliferation, morphological transformation and myogenic differentiation []. It may play a role in terminal differentiation of skeletal muscle cells but not in the determination of cells to the myogenic lineage. Sno, a Ski proto-oncogene homologue, is expressed in two isoforms and plays a role in the response to proliferation stimuli.; GO: 0005634 nucleus; PDB: 1L8R_B 3EQ5_F 1SBX_A.
Probab=34.54  E-value=32  Score=19.18  Aligned_cols=14  Identities=29%  Similarity=0.233  Sum_probs=11.7

Q ss_pred             chhhHHHHHHHHHh
Q psy8719          10 TKLDCDNLERYLNS   23 (33)
Q Consensus        10 TK~~ad~La~~L~~   23 (33)
                      ||.|+++|.+.|..
T Consensus       100 tk~DaerL~~~~~~  113 (114)
T PF02437_consen  100 TKTDAERLCKSCLH  113 (114)
T ss_dssp             EHHHHHHHHHHHHS
T ss_pred             eHHHHHHHHHHHhc
Confidence            78999999988753


No 404
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=34.50  E-value=64  Score=15.92  Aligned_cols=24  Identities=21%  Similarity=0.272  Sum_probs=18.9

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCce
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~   28 (33)
                      |-| +.+.++.+.+.+.|.+.|...
T Consensus        72 ia~~v~~~~d~~~~~~~l~~~g~~~   96 (128)
T cd07242          72 LAFRAPSREAVDELYARLAKRGAEI   96 (128)
T ss_pred             EEEEcCCHHHHHHHHHHHHHcCCeE
Confidence            455 566788999999999888764


No 405
>PF09419 PGP_phosphatase:  Mitochondrial PGP phosphatase;  InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases. All characterised members of this subfamily and most characterised members of the HAD superfamily are phosphatases. HAD superfamily phosphatases contain active site residues in several conserved catalytic motifs [], all of which are found conserved here. This family consists of sequences from fungi, plants, cyanobacteria, Gram-positive bacteria and Deinococcus. There is presently no characterisation of any sequence in this family.
Probab=34.50  E-value=64  Score=18.71  Aligned_cols=21  Identities=33%  Similarity=0.488  Sum_probs=15.9

Q ss_pred             ceEEEEecc--------hhhHHHHHHHHH
Q psy8719           2 DRALIFCRT--------KLDCDNLERYLN   22 (33)
Q Consensus         2 ~~aIVF~nT--------K~~ad~La~~L~   22 (33)
                      ++++|..|+        .++|+.+++.|.
T Consensus        78 ~~v~IvSNsaGs~~d~~~~~a~~~~~~lg  106 (168)
T PF09419_consen   78 DRVLIVSNSAGSSDDPDGERAEALEKALG  106 (168)
T ss_pred             CeEEEEECCCCcccCccHHHHHHHHHhhC
Confidence            378999997        577777777764


No 406
>PHA03169 hypothetical protein; Provisional
Probab=34.43  E-value=25  Score=23.63  Aligned_cols=16  Identities=13%  Similarity=0.486  Sum_probs=13.1

Q ss_pred             EEEEecchhhHHHHHH
Q psy8719           4 ALIFCRTKLDCDNLER   19 (33)
Q Consensus         4 aIVF~nTK~~ad~La~   19 (33)
                      .-|||++|..+..|-.
T Consensus       369 ItVyCqsk~TaK~V~k  384 (413)
T PHA03169        369 ITVFCQSRGTAKAVIK  384 (413)
T ss_pred             EEEEecCcccHHHHHH
Confidence            4599999999988754


No 407
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The N-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=34.31  E-value=61  Score=15.62  Aligned_cols=21  Identities=10%  Similarity=0.096  Sum_probs=16.8

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +...++.+++++.|++.|...
T Consensus        81 v~~~~~~~~~~~~~~~~g~~~  101 (126)
T cd08346          81 VPSEASLDAWRERLRAAGVPV  101 (126)
T ss_pred             cCCHHHHHHHHHHHHHcCCcc
Confidence            355668899999999999764


No 408
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=34.31  E-value=62  Score=15.69  Aligned_cols=21  Identities=10%  Similarity=0.036  Sum_probs=16.9

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +...++.+.+.+.|.+.|...
T Consensus        67 v~~~~~~~~~~~~~~~~g~~v   87 (114)
T cd07261          67 VDDGAAVDALYAEWQAKGVKI   87 (114)
T ss_pred             cCCHHHHHHHHHHHHHCCCeE
Confidence            456778999999999998754


No 409
>PRK08862 short chain dehydrogenase; Provisional
Probab=34.29  E-value=92  Score=17.68  Aligned_cols=27  Identities=0%  Similarity=0.016  Sum_probs=18.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ++++..++....+++.+.+.+.|.+..
T Consensus        31 ~V~~~~r~~~~l~~~~~~i~~~~~~~~   57 (227)
T PRK08862         31 TLILCDQDQSALKDTYEQCSALTDNVY   57 (227)
T ss_pred             EEEEEcCCHHHHHHHHHHHHhcCCCeE
Confidence            456667777777778777777665543


No 410
>PRK11784 tRNA 2-selenouridine synthase; Provisional
Probab=34.28  E-value=84  Score=19.96  Aligned_cols=26  Identities=19%  Similarity=0.509  Sum_probs=21.6

Q ss_pred             ceEEEEec-chhhHHHHHHHHHhcCCc
Q psy8719           2 DRALIFCR-TKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         2 ~~aIVF~n-TK~~ad~La~~L~~~G~~   27 (33)
                      ..+||+|. .=..+..++..|...|..
T Consensus        89 ~~ivvyC~rgG~RS~~aa~~L~~~G~~  115 (345)
T PRK11784         89 PRGLLYCWRGGLRSGSVQQWLKEAGID  115 (345)
T ss_pred             CeEEEEECCCChHHHHHHHHHHHcCCC
Confidence            36899994 567899999999999975


No 411
>PRK11914 diacylglycerol kinase; Reviewed
Probab=34.23  E-value=1.1e+02  Score=18.35  Aligned_cols=32  Identities=3%  Similarity=0.044  Sum_probs=19.6

Q ss_pred             CceEEEEecch-------hhHHHHHHHHHhcCCceeeee
Q psy8719           1 MDRALIFCRTK-------LDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         1 ~~~aIVF~nTK-------~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |.+.+++.|-.       +..+++.+.|+++|.+...+.
T Consensus         8 ~~~~~iI~NP~sG~g~~~~~~~~~~~~l~~~g~~~~~~~   46 (306)
T PRK11914          8 IGKVTVLTNPLSGHGAAPHAAERAIARLHHRGVDVVEIV   46 (306)
T ss_pred             CceEEEEECCCCCCCcHHHHHHHHHHHHHHcCCeEEEEE
Confidence            34666666633       334567778888887765443


No 412
>TIGR02467 CbiE precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit. This model recognizes the CbiE methylase which is responsible, in part (along with CbiT), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiT subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL.
Probab=34.21  E-value=67  Score=18.15  Aligned_cols=24  Identities=8%  Similarity=0.141  Sum_probs=20.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++|+..-+...+++++.|.+.|.
T Consensus       141 ~~vvl~~~~~~~~~i~~~L~~~g~  164 (204)
T TIGR02467       141 KVAVLTDPRNGPAEIARELIELGI  164 (204)
T ss_pred             cEEEEeCCCCCHHHHHHHHHHCCC
Confidence            567887777889999999998874


No 413
>PRK10919 ATP-dependent DNA helicase Rep; Provisional
Probab=34.19  E-value=96  Score=21.14  Aligned_cols=27  Identities=15%  Similarity=0.122  Sum_probs=22.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ..-|-++|...+..+.+.|.++|....
T Consensus       344 diAVL~Rs~~~~~~le~~L~~~gIP~~  370 (672)
T PRK10919        344 DYAILYRGNHQSRVFEKFLMQNRIPYK  370 (672)
T ss_pred             cEEEEEeCchhHHHHHHHHHHcCCCEE
Confidence            345668999999999999999997654


No 414
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=34.18  E-value=1.2e+02  Score=18.81  Aligned_cols=29  Identities=7%  Similarity=0.229  Sum_probs=19.7

Q ss_pred             CceEEEEecch-----hhHHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTK-----LDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK-----~~ad~La~~L~~~G~~~~   29 (33)
                      +.+++++.|..     +.++++.++|++.|.+..
T Consensus         3 ~kkv~lI~n~~~~~~~~~~~~i~~~L~~~g~~v~   36 (305)
T PRK02645          3 LKQVIIAYKAGSSQAKEAAERCAKQLEARGCKVL   36 (305)
T ss_pred             cCEEEEEEeCCCHHHHHHHHHHHHHHHHCCCEEE
Confidence            35678888853     335577888888887744


No 415
>TIGR02519 pilus_MshL pilus (MSHA type) biogenesis protein MshL. Members of this family are predicted secretins, that is, outer membrane pore proteins associated with delivery of proteins from periplasm to the outside of the cell. Related families include GspD of type II secretion (TIGR02517), the YscC/HrcC family from type III secretion (TIGR02516), and the PilQ secretin of type IV pilus formation (TIGR02515). Members of this family are found in gene clusters associated with MSHA (mannose-sensitive hemagglutinin) and related pili, and appear to be the secretin of this pilus system.
Probab=33.90  E-value=70  Score=19.15  Aligned_cols=24  Identities=25%  Similarity=0.356  Sum_probs=21.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      +.|++..|+++.+++.+.|++...
T Consensus         8 nsl~v~~t~~~~~~i~~~i~~ld~   31 (290)
T TIGR02519         8 GLLTVTATPAQIRRVEEYLESLQE   31 (290)
T ss_pred             CEEEEEcCHHHHHHHHHHHHHHhh
Confidence            689999999999999999998753


No 416
>PF00466 Ribosomal_L10:  Ribosomal protein L10;  InterPro: IPR001790 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. On the basis of sequence similarities the following prokaryotic and eukaryotic ribosomal proteins can be grouped:  Bacterial 50S ribosomal protein L10; Archaebacterial acidic ribosomal protein P0 homologue (L10E); Eukaryotic 60S ribosomal protein P0 (L10E).    This entry represents the ribosomal protein L10P family, with includes the above mentioned ribosomal proteins.; GO: 0042254 ribosome biogenesis, 0005622 intracellular; PDB: 3A1Y_G 3D5D_J 3PYT_I 3PYV_I 3D5B_J 3PYO_I 3PYR_I 3MS1_I 3MRZ_I 1VQ9_G ....
Probab=33.88  E-value=68  Score=16.08  Aligned_cols=20  Identities=30%  Similarity=0.401  Sum_probs=14.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .++||+  .++...+++.|.+.
T Consensus        79 ~~~if~--~~d~~~~~k~l~~~   98 (100)
T PF00466_consen   79 TALIFS--NEDPFEIAKILKKF   98 (100)
T ss_dssp             EEEEEE--SSSHHHHHHHHHHS
T ss_pred             EEEEEE--CCCHHHHHHHHHHh
Confidence            588999  45677788877653


No 417
>PF04255 DUF433:  Protein of unknown function (DUF433);  InterPro: IPR007367 This is a family of uncharacterised proteins.; PDB: 2GA1_B.
Probab=33.86  E-value=45  Score=15.72  Aligned_cols=21  Identities=10%  Similarity=0.197  Sum_probs=15.4

Q ss_pred             EEEecchhhHHHHHHHHHhcCC
Q psy8719           5 LIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         5 IVF~nTK~~ad~La~~L~~~G~   26 (33)
                      -+|-.|+-.++.|.+.+ ++|.
T Consensus        12 P~i~GTRI~v~~i~~~~-~~G~   32 (56)
T PF04255_consen   12 PVIRGTRIPVRDILDLL-AAGE   32 (56)
T ss_dssp             -EETTSS-BHHHHHHHH-HTT-
T ss_pred             ceEcCceecHHHHHHHH-HcCC
Confidence            47888999999999998 6654


No 418
>PRK07677 short chain dehydrogenase; Provisional
Probab=33.81  E-value=90  Score=17.44  Aligned_cols=25  Identities=16%  Similarity=0.162  Sum_probs=18.2

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++++++....+++.+.+.+.+.+
T Consensus        27 ~Vi~~~r~~~~~~~~~~~~~~~~~~   51 (252)
T PRK07677         27 NVVITGRTKEKLEEAKLEIEQFPGQ   51 (252)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhcCCc
Confidence            5677788877788888888766543


No 419
>PRK12436 UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional
Probab=33.60  E-value=89  Score=19.35  Aligned_cols=27  Identities=7%  Similarity=0.114  Sum_probs=22.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ..++|+..|.++..++.++.++++..+
T Consensus        37 a~~vv~p~~~edv~~~l~~a~~~~ip~   63 (305)
T PRK12436         37 ADVFVAPTNYDEIQEVIKYANKYNIPV   63 (305)
T ss_pred             EEEEEecCCHHHHHHHHHHHHHcCCCE
Confidence            368999999999999999998877654


No 420
>PF14719 PID_2:  Phosphotyrosine interaction domain (PTB/PID)
Probab=33.44  E-value=56  Score=19.38  Aligned_cols=18  Identities=17%  Similarity=0.449  Sum_probs=15.5

Q ss_pred             EEecchhhHHHHHHHHHh
Q psy8719           6 IFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~   23 (33)
                      |.|.++..|..|+..|.+
T Consensus       100 vlC~k~~~Akama~~L~~  117 (182)
T PF14719_consen  100 VLCSKEEKAKAMARALYQ  117 (182)
T ss_pred             EEECCHHHHHHHHHHHHH
Confidence            689999999999888865


No 421
>PRK12903 secA preprotein translocase subunit SecA; Reviewed
Probab=33.41  E-value=71  Score=23.55  Aligned_cols=26  Identities=19%  Similarity=0.075  Sum_probs=23.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .+||.|.+-+..+.|++.|.+.|...
T Consensus       428 PVLVgT~SIe~SE~ls~~L~~~gi~h  453 (925)
T PRK12903        428 PILIGTAQVEDSETLHELLLEANIPH  453 (925)
T ss_pred             CEEEEeCcHHHHHHHHHHHHHCCCCc
Confidence            58999999999999999999998754


No 422
>PRK05723 flavodoxin; Provisional
Probab=33.25  E-value=40  Score=18.78  Aligned_cols=19  Identities=11%  Similarity=0.036  Sum_probs=13.5

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      ||+.-|++|++.|.+.|..
T Consensus        13 ~ae~~A~~la~~l~~~g~~   31 (151)
T PRK05723         13 TAEEVARHAESLLKAAGFE   31 (151)
T ss_pred             HHHHHHHHHHHHHHHCCCc
Confidence            5667777777777776654


No 423
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain. HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=33.13  E-value=57  Score=14.97  Aligned_cols=26  Identities=8%  Similarity=0.024  Sum_probs=17.7

Q ss_pred             eEEEEecch---hhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTK---LDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK---~~ad~La~~L~~~G~~~   28 (33)
                      +++|.+...   ..+-+++..|+++|...
T Consensus         3 ~v~i~~~~~~~~~~a~~i~~~Lr~~g~~v   31 (91)
T cd00859           3 DVYVVPLGEGALSEALELAEQLRDAGIKA   31 (91)
T ss_pred             cEEEEEcChHHHHHHHHHHHHHHHCCCEE
Confidence            345555443   35888999999988654


No 424
>PRK14608 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=33.04  E-value=78  Score=19.18  Aligned_cols=25  Identities=0%  Similarity=0.029  Sum_probs=20.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++.+|++++.++++++.|+++..+
T Consensus       257 tvf~l~~~~~~a~~~~~~l~~~~~~  281 (290)
T PRK14608        257 TCFALFADEAAAEAAAAAIAAAHPG  281 (290)
T ss_pred             CeEEEeCCHHHHHHHHHHhHhhCCC
Confidence            4677888999999999999876543


No 425
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs. This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.
Probab=33.03  E-value=96  Score=17.50  Aligned_cols=20  Identities=30%  Similarity=0.438  Sum_probs=17.2

Q ss_pred             chhhHHHHHHHHHhcCCcee
Q psy8719          10 TKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~~   29 (33)
                      |..+|.++-+.|++.|..+.
T Consensus        15 t~~~C~~ak~iL~~~~V~~~   34 (147)
T cd03031          15 TFEDCNNVRAILESFRVKFD   34 (147)
T ss_pred             cChhHHHHHHHHHHCCCcEE
Confidence            69999999999999987654


No 426
>PRK07594 type III secretion system ATPase SsaN; Validated
Probab=33.01  E-value=1e+02  Score=20.46  Aligned_cols=28  Identities=14%  Similarity=0.370  Sum_probs=21.8

Q ss_pred             ceEEEEecchhh-----------HHHHHHHHHhcCCcee
Q psy8719           2 DRALIFCRTKLD-----------CDNLERYLNSIDRRLI   29 (33)
Q Consensus         2 ~~aIVF~nTK~~-----------ad~La~~L~~~G~~~~   29 (33)
                      +++++|++|-.+           |-.+|++++.+|+..-
T Consensus       210 ~rtv~vv~tsd~p~~~r~~a~~~a~tiAEyfrd~G~~VL  248 (433)
T PRK07594        210 KRCVIVVATSDRPALERVRALFVATTIAEFFRDNGKRVV  248 (433)
T ss_pred             ceEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCcEE
Confidence            578888888666           6779999998887643


No 427
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=32.97  E-value=90  Score=17.19  Aligned_cols=27  Identities=7%  Similarity=0.201  Sum_probs=18.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ++++..++....+++.+.+...|.+..
T Consensus        33 ~Vi~~~r~~~~~~~~~~~~~~~~~~~~   59 (239)
T PRK07666         33 NVGLLARTEENLKAVAEEVEAYGVKVV   59 (239)
T ss_pred             EEEEEeCCHHHHHHHHHHHHHhCCeEE
Confidence            466777777777777777766555443


No 428
>cd05796 Ribosomal_P0_like Ribosomal protein L10 family, P0-like protein subfamily; composed of uncharacterized eukaryotic proteins with similarity to the 60S ribosomal protein P0, including the Saccharomyces cerevisiae protein called mRNA turnover protein 4 (MRT4). MRT4 may be involved in mRNA decay. P0 forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. It occupies the L7/L12 stalk of the ribosome. The stalk is known to contain the binding site for elongation factors EF-G and EF-Tu; however, there is disagreement as to whether or not P0 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, P0 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WAS
Probab=32.93  E-value=70  Score=18.00  Aligned_cols=21  Identities=19%  Similarity=0.360  Sum_probs=15.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .+|||+|  .+...+++.|.+..
T Consensus        80 ~~lift~--~dp~~v~k~l~~~~  100 (163)
T cd05796          80 VGLLFTN--EPPEEVIEYFDSYS  100 (163)
T ss_pred             EEEEEEC--CCHHHHHHHHHHcC
Confidence            4788887  57888888887654


No 429
>PRK00881 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional
Probab=32.85  E-value=85  Score=21.54  Aligned_cols=29  Identities=21%  Similarity=0.294  Sum_probs=25.3

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      |.+++|=+.-|.+...+++.|.+.|.+..
T Consensus         4 ~~~aLISVsDK~~iv~lAk~L~~lGfeI~   32 (513)
T PRK00881          4 IKRALISVSDKTGIVEFAKALVELGVEIL   32 (513)
T ss_pred             cCEEEEEEeCcccHHHHHHHHHHCCCEEE
Confidence            45788888899999999999999998763


No 430
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=32.83  E-value=65  Score=15.47  Aligned_cols=21  Identities=14%  Similarity=0.105  Sum_probs=17.4

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +.+.++.+.+.+.|++.|.+.
T Consensus        65 v~~~~~v~~~~~~l~~~g~~~   85 (117)
T cd07240          65 VASEEDLEALAAHLEAAGVAP   85 (117)
T ss_pred             cCCHHHHHHHHHHHHHcCCce
Confidence            556778999999999998764


No 431
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=32.77  E-value=25  Score=20.28  Aligned_cols=11  Identities=27%  Similarity=0.356  Sum_probs=9.1

Q ss_pred             ceEEEEecchh
Q psy8719           2 DRALIFCRTKL   12 (33)
Q Consensus         2 ~~aIVF~nTK~   12 (33)
                      .+++.|||+|=
T Consensus        27 Gkvf~FcssKC   37 (131)
T PRK14891         27 GTVLHFVDSKC   37 (131)
T ss_pred             CCEEEEecHHH
Confidence            47889999985


No 432
>PF13579 Glyco_trans_4_4:  Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A.
Probab=32.73  E-value=68  Score=15.78  Aligned_cols=17  Identities=18%  Similarity=0.178  Sum_probs=13.5

Q ss_pred             hHHHHHHHHHhcCCcee
Q psy8719          13 DCDNLERYLNSIDRRLI   29 (33)
Q Consensus        13 ~ad~La~~L~~~G~~~~   29 (33)
                      -+.+|++.|.++|++..
T Consensus         6 ~~~~l~~~L~~~G~~V~   22 (160)
T PF13579_consen    6 YVRELARALAARGHEVT   22 (160)
T ss_dssp             HHHHHHHHHHHTT-EEE
T ss_pred             HHHHHHHHHHHCCCEEE
Confidence            46789999999998865


No 433
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional
Probab=32.72  E-value=35  Score=21.10  Aligned_cols=20  Identities=5%  Similarity=0.094  Sum_probs=16.8

Q ss_pred             EEEEecchhhHHHHHHHHHh
Q psy8719           4 ALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~   23 (33)
                      ++...||++++|+|.+.|++
T Consensus       335 S~~~~nt~eei~~l~~~l~~  354 (360)
T PRK05355        335 SIYNAMPLEGVQALVDFMKE  354 (360)
T ss_pred             ECCCCCCHHHHHHHHHHHHH
Confidence            35677999999999999876


No 434
>PRK12597 F0F1 ATP synthase subunit beta; Provisional
Probab=32.67  E-value=98  Score=20.68  Aligned_cols=29  Identities=10%  Similarity=0.287  Sum_probs=21.7

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhc-CCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSI-DRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~-G~~~~   29 (33)
                      +++++|+++|-++           |-.+|++++.+ |+...
T Consensus       200 l~rsvvv~atsd~~~~~R~~a~~~a~tiAEyfrd~~G~~VL  240 (461)
T PRK12597        200 LDKTVMVYGQMNEPPGARMRVVLTGLTIAEYLRDEEKEDVL  240 (461)
T ss_pred             cceeEEEecCCCCCHHHHHHHHHHHHHHHHHHHHhcCCceE
Confidence            3578899998655           66789999887 76543


No 435
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]
Probab=32.55  E-value=34  Score=24.26  Aligned_cols=24  Identities=25%  Similarity=0.310  Sum_probs=19.1

Q ss_pred             ceEEEEecchhhHHHHH----HHHHhcC
Q psy8719           2 DRALIFCRTKLDCDNLE----RYLNSID   25 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La----~~L~~~G   25 (33)
                      -+.|+|++++..++.+.    +.+...|
T Consensus       307 ~~tL~F~~sr~~~e~~~~~~~~~~~~~~  334 (851)
T COG1205         307 IQTLVFFRSRKQVELLYLSPRRRLVREG  334 (851)
T ss_pred             ceEEEEEehhhhhhhhhhchhHHHhhcc
Confidence            37899999999999998    5555544


No 436
>PF00210 Ferritin:  Ferritin-like domain;  InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms []. It consists of a mineral core of hydrated ferric oxide, and a multi-subunit protein shell that encloses the former and assures its solubility in an aqueous environment.  In animals the protein is mainly cytoplasmic and there are generally two or more genes that encode closely related subunits - in mammals there are two subunits which are known as H(eavy) and L(ight). In plants ferritin is found in the chloroplast []. This entry represents the main structural domain of ferritin. The domain is also found in other ferritin-like proteins such as members of the DNA protection during starvation (DPS) family and bacterioferritins.; GO: 0008199 ferric iron binding, 0006879 cellular iron ion homeostasis; PDB: 1N1Q_C 4DYU_E 2YJJ_D 2YJK_B 2VXX_B 3FVB_A 2WLU_A 2XGW_A 2WLA_A 1Z4A_D ....
Probab=32.50  E-value=55  Score=16.48  Aligned_cols=16  Identities=13%  Similarity=0.196  Sum_probs=13.8

Q ss_pred             hhhHHHHHHHHHhcCC
Q psy8719          11 KLDCDNLERYLNSIDR   26 (33)
Q Consensus        11 K~~ad~La~~L~~~G~   26 (33)
                      ++.++.+++.+...|+
T Consensus        45 ~~h~~~l~e~i~~lgg   60 (142)
T PF00210_consen   45 REHADELAERILMLGG   60 (142)
T ss_dssp             HHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHhcCCC
Confidence            4678999999999987


No 437
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation. Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation (CCR), a process in which enzymes necessary for the metabolism of alternative sugars are inhibited in the presence of glucose. In gram-positive bacteria, CCR is controlled by HPr, a phosphoenolpyruvate:sugar phsophotrasnferase system (PTS) and a transcriptional regulator CcpA. Moreover, CcpA can regulate sporulation and antibiotic resistance as well as play a role in virulence development of certain pathogens such as the group A streptococcus. The ligand binding domain of CcpA is a member of the LacI-GalR family of bacterial transcription regulators.
Probab=32.44  E-value=92  Score=17.10  Aligned_cols=27  Identities=11%  Similarity=0.017  Sum_probs=17.3

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-.+..+.+..++++|.+.|++.+-++
T Consensus        96 v~~d~~~~~~~~~~~l~~~g~~~i~~l  122 (268)
T cd06298          96 VNIDYKKAAFEATELLIKNGHKKIAFI  122 (268)
T ss_pred             EEECcHHHHHHHHHHHHHcCCceEEEE
Confidence            334445666777777777777766554


No 438
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily.
Probab=32.42  E-value=92  Score=21.13  Aligned_cols=27  Identities=19%  Similarity=0.130  Sum_probs=22.4

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +..-|-++++..+..|.+.|.+.|...
T Consensus       345 ~diAVL~R~~~~~~~l~~~L~~~gIP~  371 (726)
T TIGR01073       345 GDFAILYRTNAQSRVFEETLLKANIPY  371 (726)
T ss_pred             CCEEEEEeCchhHHHHHHHHHHcCCCE
Confidence            345677999999999999999998764


No 439
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase. Members of this family are closely related to characterized examples of thymidine phosphorylase (EC 2.4.2.4) and pyrimidine nucleoside phosphorylase (RC 2.4.2.2). Most examples are found in the archaea, but other examples in Legionella pneumophila str. Paris and Rhodopseudomonas palustris CGA009.
Probab=32.36  E-value=23  Score=23.97  Aligned_cols=23  Identities=22%  Similarity=0.349  Sum_probs=19.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|++|.++|++|++.|.+-|.++
T Consensus       286 Af~~~~~~A~~La~~~~~vg~~~  308 (493)
T TIGR02645       286 AKVRSLQEAERLARLFIELGDRL  308 (493)
T ss_pred             CcCCCHHHHHHHHHHHHHHHHHc
Confidence            38999999999999998776543


No 440
>TIGR01011 rpsB_bact ribosomal protein S2, bacterial type. TIGR01012 describes the archaeal and cytosolic forms.
Probab=32.29  E-value=75  Score=19.00  Aligned_cols=22  Identities=14%  Similarity=0.175  Sum_probs=17.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .-|.|++||..+.++.+.+.+.
T Consensus        63 g~iLfV~tk~~~~~~v~~~a~~   84 (225)
T TIGR01011        63 GKILFVGTKKQAKEIIKEEAER   84 (225)
T ss_pred             CEEEEEeCCHHHHHHHHHHHHH
Confidence            4689999999998888776543


No 441
>cd05795 Ribosomal_P0_L10e Ribosomal protein L10 family, P0 and L10e subfamily; composed of eukaryotic 60S ribosomal protein P0 and the archaeal P0 homolog, L10e. P0 or L10e forms a tight complex with multiple copies of the small acidic protein L12(e). This complex forms a stalk structure on the large subunit of the ribosome. The stalk is known to contain the binding site for elongation factors G and Tu (EF-G and EF-Tu, respectively); however, there is disagreement as to whether or not L10 is involved in forming the binding site. The stalk is believed to be associated with GTPase activities in protein synthesis. In a neuroblastoma cell line, L10 has been shown to interact with the SH3 domain of Src and to activate the binding of the Nck1 adaptor protein with skeletal proteins such as the Wiskott-Aldrich Syndrome Protein (WASP) and the WASP-interacting protein (WIP). These eukaryotic and archaeal P0 sequences have an additional C-terminal domain homologous with acidic proteins P1 and P2.
Probab=31.98  E-value=73  Score=18.12  Aligned_cols=21  Identities=19%  Similarity=0.206  Sum_probs=16.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .+|||+|  .+...+++.|.+..
T Consensus        79 ~~liFt~--~dp~~v~k~l~~~~   99 (175)
T cd05795          79 VGFIFTN--GDPFEIRKILEENK   99 (175)
T ss_pred             EEEEEEC--CCHHHHHHHHHHcC
Confidence            5788886  67888888887654


No 442
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only]
Probab=31.92  E-value=1.3e+02  Score=18.54  Aligned_cols=31  Identities=16%  Similarity=0.185  Sum_probs=20.3

Q ss_pred             ceEEEEecch-------hhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTK-------LDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK-------~~ad~La~~L~~~G~~~~~~~   32 (33)
                      .++.++.|..       +..+++.+.|+++|++.+...
T Consensus         3 ~~~~~i~Np~sG~~~~~~~~~~~~~~l~~~g~~~~~~~   40 (301)
T COG1597           3 KKALLIYNPTSGKGKAKKLLREVEELLEEAGHELSVRV   40 (301)
T ss_pred             ceEEEEEcccccccchhhHHHHHHHHHHhcCCeEEEEE
Confidence            3555666554       346677788888888777654


No 443
>TIGR02992 ectoine_eutC ectoine utilization protein EutC. Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. This family belongs to the ornithine cyclodeaminase/mu-crystallin family (pfam02423).
Probab=31.90  E-value=79  Score=19.44  Aligned_cols=23  Identities=26%  Similarity=0.361  Sum_probs=19.9

Q ss_pred             ceEEEEecchhhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      +++.||-++.+.++.+++.+.+.
T Consensus       155 ~~v~V~~R~~~~a~~~a~~~~~~  177 (326)
T TIGR02992       155 RSARIWARDSAKAEALALQLSSL  177 (326)
T ss_pred             cEEEEECCCHHHHHHHHHHHHhh
Confidence            56889999999999999999654


No 444
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=31.89  E-value=71  Score=21.45  Aligned_cols=23  Identities=13%  Similarity=0.096  Sum_probs=17.8

Q ss_pred             ceEEEEecch--------hhHHHHHHHHHhc
Q psy8719           2 DRALIFCRTK--------LDCDNLERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK--------~~ad~La~~L~~~   24 (33)
                      .+++|||++.        ..++++++.|.+.
T Consensus       449 ~q~~v~~~~i~~s~~~~~~~a~~~~~~L~~~  479 (630)
T TIGR00643       449 RQAYVVYPLIEESEKLDLKAAEALYERLKKA  479 (630)
T ss_pred             CcEEEEEccccccccchHHHHHHHHHHHHhh
Confidence            4799999875        5677888888764


No 445
>PRK05599 hypothetical protein; Provisional
Probab=31.79  E-value=1e+02  Score=17.42  Aligned_cols=25  Identities=12%  Similarity=0.104  Sum_probs=19.7

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++-.++.+..+++++.|++.|..
T Consensus        25 ~Vil~~r~~~~~~~~~~~l~~~~~~   49 (246)
T PRK05599         25 DVVLAARRPEAAQGLASDLRQRGAT   49 (246)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhccCC
Confidence            4677788888889999999877654


No 446
>cd04439 DEP_1_P-Rex DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in P-Rex-like proteins. The P-Rex family is the guanine-nucleotide exchange factor (GEF) for the small GTPase Rac that contains an N-terminal RhoGEF domain, two DEP and PDZ domains. Rac-GEF activity is stimulated by phosphatidylinositol (3,4,5)-trisphosphate (PtdIns(3,4,5)P3), a lipid second messenger, and by the G beta-gamma subunits of heterotrimeric G proteins. The DEP domains are not involved in mediating these stimuli, but may be of importance for basal and stimulated levels Rac-GEF activity.
Probab=31.74  E-value=57  Score=16.73  Aligned_cols=20  Identities=15%  Similarity=-0.135  Sum_probs=16.3

Q ss_pred             EecchhhHHHHHHHHHhcCC
Q psy8719           7 FCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~   26 (33)
                      .+.++.+|-.+++.|-+.|.
T Consensus        43 ~~~~r~eAv~lg~~Ll~~G~   62 (81)
T cd04439          43 EISKPEEGVNLGQALLENGI   62 (81)
T ss_pred             CCCCHHHHHHHHHHHHHCCC
Confidence            36678899999999988763


No 447
>PRK05867 short chain dehydrogenase; Provisional
Probab=31.68  E-value=1e+02  Score=17.28  Aligned_cols=26  Identities=12%  Similarity=0.132  Sum_probs=18.3

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++++..++.+..+++.+.|+..|.+.
T Consensus        35 ~V~~~~r~~~~~~~~~~~l~~~~~~~   60 (253)
T PRK05867         35 QVAIAARHLDALEKLADEIGTSGGKV   60 (253)
T ss_pred             EEEEEcCCHHHHHHHHHHHHhcCCeE
Confidence            45666777777888888887766443


No 448
>PF13104 DUF3956:  Protein of unknown function (DUF3956)
Probab=31.52  E-value=40  Score=16.23  Aligned_cols=11  Identities=18%  Similarity=0.603  Sum_probs=8.2

Q ss_pred             CceEEEEecch
Q psy8719           1 MDRALIFCRTK   11 (33)
Q Consensus         1 ~~~aIVF~nTK   11 (33)
                      |+++++|.|..
T Consensus         1 m~sc~~fvngq   11 (45)
T PF13104_consen    1 MESCVVFVNGQ   11 (45)
T ss_pred             CceEEEEecCC
Confidence            57888888754


No 449
>PRK04020 rps2P 30S ribosomal protein S2; Provisional
Probab=31.51  E-value=64  Score=19.38  Aligned_cols=22  Identities=0%  Similarity=0.081  Sum_probs=17.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .-|.|++||..+.++.+.....
T Consensus        68 ~~ILfVgTk~~~~~~v~k~A~~   89 (204)
T PRK04020         68 EKILVVSSRQYGQKPVQKFAEV   89 (204)
T ss_pred             CeEEEEeCCHHHHHHHHHHHHH
Confidence            4589999999998877766543


No 450
>PRK06172 short chain dehydrogenase; Provisional
Probab=31.51  E-value=99  Score=17.19  Aligned_cols=26  Identities=4%  Similarity=0.054  Sum_probs=18.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      ++++.+++....+++.+.+.+.|...
T Consensus        33 ~v~~~~r~~~~~~~~~~~~~~~~~~~   58 (253)
T PRK06172         33 KVVVADRDAAGGEETVALIREAGGEA   58 (253)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhcCCce
Confidence            46777888777778777777666543


No 451
>PRK06136 uroporphyrin-III C-methyltransferase; Reviewed
Probab=31.46  E-value=96  Score=17.85  Aligned_cols=24  Identities=13%  Similarity=0.091  Sum_probs=20.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .++|+........++++.|.+.|.
T Consensus       166 ~~~vl~~~~~~~~~i~~~L~~~g~  189 (249)
T PRK06136        166 DTLVIYMGVRNLPYIAAQLLAAGR  189 (249)
T ss_pred             CeEEEECCHHHHHHHHHHHHHcCC
Confidence            568888889999999999998864


No 452
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription
Probab=31.43  E-value=97  Score=17.08  Aligned_cols=27  Identities=7%  Similarity=-0.178  Sum_probs=18.7

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++-...+..++++|.+.|++.+-++
T Consensus        92 V~~d~~~~g~~~~~~l~~~g~~~i~~i  118 (265)
T cd06291          92 VSSDNYEGGRLAAEELIERGCKHIAHI  118 (265)
T ss_pred             EeechHHHHHHHHHHHHHcCCcEEEEE
Confidence            445555667778888888888776554


No 453
>cd03411 Ferrochelatase_N Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is ubiquitous in nature and widely distributed in bacteria and eukaryotes. Recently, some archaeal members have been identified. The oligomeric state of these enzymes varies depending on the presence of a dimerization motif at the C-terminus.
Probab=31.41  E-value=61  Score=17.92  Aligned_cols=19  Identities=21%  Similarity=0.263  Sum_probs=14.7

Q ss_pred             cchhhHHHHHHHHHhcCCc
Q psy8719           9 RTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~   27 (33)
                      .|+..++.|.+.|.+.+.+
T Consensus        69 ~t~~q~~~l~~~L~~~~~~   87 (159)
T cd03411          69 ITRAQAEALEKALDERGID   87 (159)
T ss_pred             HHHHHHHHHHHHHhccCCC
Confidence            5788899999999876543


No 454
>PF13676 TIR_2:  TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A.
Probab=31.30  E-value=47  Score=16.31  Aligned_cols=17  Identities=24%  Similarity=0.202  Sum_probs=13.1

Q ss_pred             hhhHHHHHHHHHhcCCc
Q psy8719          11 KLDCDNLERYLNSIDRR   27 (33)
Q Consensus        11 K~~ad~La~~L~~~G~~   27 (33)
                      ++-++.|.+.|++.|..
T Consensus        10 ~~~a~~l~~~L~~~g~~   26 (102)
T PF13676_consen   10 REFAERLAERLESAGIR   26 (102)
T ss_dssp             CCCHHHHHHHHHHTT--
T ss_pred             HHHHHHHHHHHhhcCCE
Confidence            56789999999999874


No 455
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1,  is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.
Probab=31.26  E-value=1.1e+02  Score=19.02  Aligned_cols=29  Identities=3%  Similarity=0.193  Sum_probs=20.7

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhc-CCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSI-DRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~-G~~~~   29 (33)
                      +++++|+++|-++           +-.+|++++.+ |+...
T Consensus       126 ~~~tvvv~~t~d~~~~~r~~~~~~a~~~AEyfr~~~g~~Vl  166 (274)
T cd01133         126 LSKTALVYGQMNEPPGARARVALTGLTMAEYFRDEEGQDVL  166 (274)
T ss_pred             cceeEEEEECCCCCHHHHHHHHHHHHHHHHHHHHhcCCeEE
Confidence            3577888888665           55678888877 76543


No 456
>PRK08972 fliI flagellum-specific ATP synthase; Validated
Probab=31.23  E-value=1.1e+02  Score=20.52  Aligned_cols=29  Identities=7%  Similarity=0.233  Sum_probs=21.2

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~G~~~~   29 (33)
                      +++++|+++|-++           |-.+|++++.+|...-
T Consensus       216 l~rtvvv~atsd~p~~~R~~a~~~A~tiAEyfrd~G~~VL  255 (444)
T PRK08972        216 RARSVVVAAPADTSPLMRLKGCETATTIAEYFRDQGLNVL  255 (444)
T ss_pred             cccEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCCEE
Confidence            3578888888765           4558889988887644


No 457
>PF00325 Crp:  Bacterial regulatory proteins, crp family;  InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. This family groups together a range of proteins, including anr, crp, clp, cysR, fixK, flp, fnr, fnrN, hlyX and ntcA [, ]. Within this family, the HTH motif is situated towards the C terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2OZ6_A 1CGP_B 2GZW_C 1O3T_B 3ROU_A 2CGP_A 3RDI_A 1I5Z_A 3IYD_H 3FWE_B ....
Probab=31.17  E-value=57  Score=14.33  Aligned_cols=17  Identities=12%  Similarity=0.091  Sum_probs=12.8

Q ss_pred             chhhHHHHHHHHHhcCC
Q psy8719          10 TKLDCDNLERYLNSIDR   26 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~   26 (33)
                      |++.+.++-..|+++|.
T Consensus        15 t~ETVSR~l~~l~~~gl   31 (32)
T PF00325_consen   15 TRETVSRILKKLERQGL   31 (32)
T ss_dssp             -HHHHHHHHHHHHHTTS
T ss_pred             cHHHHHHHHHHHHHcCC
Confidence            67778888888888773


No 458
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=31.17  E-value=75  Score=15.72  Aligned_cols=23  Identities=4%  Similarity=-0.006  Sum_probs=18.7

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCc
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~   27 (33)
                      +-| +.+.++.+++.+.|++.|..
T Consensus        66 ~af~v~~~~~v~~~~~~l~~~G~~   89 (121)
T cd09013          66 IAWRASSPEALERRVAALEASGLG   89 (121)
T ss_pred             EEEEcCCHHHHHHHHHHHHHcCCc
Confidence            344 67889999999999998865


No 459
>PRK10689 transcription-repair coupling factor; Provisional
Probab=31.15  E-value=76  Score=23.41  Aligned_cols=24  Identities=13%  Similarity=0.099  Sum_probs=22.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      +++|.|.+..+++++.+.|...|.
T Consensus       384 ~v~i~~~~~~~~~~l~~~l~~~~~  407 (1147)
T PRK10689        384 PVVFSVESEGRREALGELLARIKI  407 (1147)
T ss_pred             cEEEEECChhHHHHHHHHHHHcCC
Confidence            689999999999999999988876


No 460
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
Probab=31.14  E-value=53  Score=19.72  Aligned_cols=18  Identities=11%  Similarity=-0.047  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhcCCceeee
Q psy8719          14 CDNLERYLNSIDRRLIYY   31 (33)
Q Consensus        14 ad~La~~L~~~G~~~~~~   31 (33)
                      +-.|++.|.++|++..++
T Consensus        17 ~l~la~~L~~rGh~V~~~   34 (401)
T cd03784          17 LVALAWALRAAGHEVRVA   34 (401)
T ss_pred             HHHHHHHHHHCCCeEEEe
Confidence            457899999999998876


No 461
>PF13734 Inhibitor_I69:  Spi protease inhibitor; PDB: 1PVJ_A 1DKI_D 2UZJ_A 2JTC_A 4D8E_A 4D8I_A 4D8B_A.
Probab=31.09  E-value=51  Score=17.64  Aligned_cols=18  Identities=17%  Similarity=0.229  Sum_probs=11.6

Q ss_pred             EecchhhHHHHHHHHHhc
Q psy8719           7 FCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~   24 (33)
                      |.+|+.+|.++|+..-+.
T Consensus         5 f~rt~~eA~~IA~~F~~~   22 (96)
T PF13734_consen    5 FQRTEKEALQIAKTFVQK   22 (96)
T ss_dssp             -B--HHHHHHHHHHHHH-
T ss_pred             cccCHHHHHHHHHHHHHh
Confidence            889999999999865443


No 462
>cd01644 RT_pepA17 RT_pepA17: Reverse transcriptase (RTs) in retrotransposons. This subfamily represents the RT domain of a multifunctional enzyme. C-terminal to the RT domain is a domain homologous to aspartic proteinases (corresponding to Merops family A17) encoded by retrotransposons and retroviruses. RT catalyzes DNA replication from an RNA template and is responsible for the replication of retroelements.
Probab=31.08  E-value=57  Score=19.10  Aligned_cols=21  Identities=24%  Similarity=0.270  Sum_probs=15.5

Q ss_pred             CceEEEEecchhhHHHHHHHH
Q psy8719           1 MDRALIFCRTKLDCDNLERYL   21 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L   21 (33)
                      ++-.||+.+|.+++.++++.+
T Consensus       141 vDDili~~~s~~e~~~~~~~v  161 (213)
T cd01644         141 VDDILVSTDTLNEAVNVAKRL  161 (213)
T ss_pred             cccceecCCCHHHHHHHHHHH
Confidence            356789999988877666554


No 463
>PRK14612 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional
Probab=30.99  E-value=1.1e+02  Score=18.29  Aligned_cols=25  Identities=4%  Similarity=-0.003  Sum_probs=20.6

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      .++.+|.+++.++++++.|++.+.+
T Consensus       243 tvfal~~~~~~a~~~~~~l~~~~~~  267 (276)
T PRK14612        243 TCFGLAEDAAQAQRAAAALRARHPA  267 (276)
T ss_pred             hhEEEeCCHHHHHHHHHHhHhhCCc
Confidence            4577888899999999999887654


No 464
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
Probab=30.86  E-value=70  Score=19.03  Aligned_cols=19  Identities=21%  Similarity=0.394  Sum_probs=15.8

Q ss_pred             hHHHHHHHHHhcCCceeee
Q psy8719          13 DCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus        13 ~ad~La~~L~~~G~~~~~~   31 (33)
                      +|-.||+.|++.|.+-.|.
T Consensus        19 Rcl~LA~~l~~~g~~v~f~   37 (279)
T TIGR03590        19 RCLTLARALHAQGAEVAFA   37 (279)
T ss_pred             HHHHHHHHHHHCCCEEEEE
Confidence            5788999999999887665


No 465
>PRK10645 divalent-cation tolerance protein CutA; Provisional
Probab=30.81  E-value=95  Score=16.93  Aligned_cols=22  Identities=5%  Similarity=0.141  Sum_probs=16.7

Q ss_pred             EEEE--ecchhhHHHHHHHHHhcC
Q psy8719           4 ALIF--CRTKLDCDNLERYLNSID   25 (33)
Q Consensus         4 aIVF--~nTK~~ad~La~~L~~~G   25 (33)
                      +||+  |..++.|++|++.|-+.+
T Consensus        12 ~lV~tT~p~~e~A~~ia~~Lve~r   35 (112)
T PRK10645         12 VVVLCTAPDEATAQDLAAKVLAEK   35 (112)
T ss_pred             EEEEEeCCCHHHHHHHHHHHHHCC
Confidence            3455  567899999999997654


No 466
>PF06470 SMC_hinge:  SMC proteins Flexible Hinge Domain;  InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins. The hinge region is responsible for formation of the DNA interacting dimer. It is also possible that the precise structure of it is an essential determinant of the specificity of the DNA-protein interaction [].; GO: 0005515 protein binding, 0005524 ATP binding, 0051276 chromosome organization, 0005694 chromosome; PDB: 2WD5_A 1GXL_C 1GXK_A 1GXJ_A 3NWC_B 3L51_A.
Probab=30.73  E-value=80  Score=15.86  Aligned_cols=24  Identities=8%  Similarity=0.097  Sum_probs=19.2

Q ss_pred             EEecchhhHHHHHHHHHhcCCcee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      |-|.+.+.+.++.+.|++++.+..
T Consensus        33 iVV~~~~~a~~~i~~l~~~~~gr~   56 (120)
T PF06470_consen   33 IVVEDEETAKKIIEFLKENKLGRA   56 (120)
T ss_dssp             EEESSHHHHHHHHHHHHHTTSCEE
T ss_pred             EEECcHHHHHHHHHHHhhccCCeE
Confidence            346788999999999998766654


No 467
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional
Probab=30.70  E-value=1.2e+02  Score=17.70  Aligned_cols=25  Identities=12%  Similarity=0.008  Sum_probs=16.9

Q ss_pred             ecchhhHHHHHHHHHhcCCceeeee
Q psy8719           8 CRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      ++.......++++|-++|++.+-++
T Consensus       164 ~D~~~~~~~a~~~L~~~G~~~I~~i  188 (342)
T PRK10014        164 PDNMQAAQLLTEHLIRNGHQRIAWL  188 (342)
T ss_pred             eCCHHHHHHHHHHHHHCCCCEEEEE
Confidence            3445566777788888887776654


No 468
>PRK14027 quinate/shikimate dehydrogenase; Provisional
Probab=30.67  E-value=94  Score=19.01  Aligned_cols=22  Identities=9%  Similarity=0.080  Sum_probs=18.6

Q ss_pred             ceEEEEecchhhHHHHHHHHHh
Q psy8719           2 DRALIFCRTKLDCDNLERYLNS   23 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~   23 (33)
                      .+..|+-+|.+.++.|++.+..
T Consensus       152 ~~i~i~nR~~~ka~~La~~~~~  173 (283)
T PRK14027        152 QKLQVADLDTSRAQALADVINN  173 (283)
T ss_pred             CEEEEEcCCHHHHHHHHHHHhh
Confidence            4677899999999999998864


No 469
>PF08495 FIST:  FIST N domain;  InterPro: IPR013702 The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids [].
Probab=30.49  E-value=83  Score=17.03  Aligned_cols=23  Identities=22%  Similarity=0.468  Sum_probs=19.1

Q ss_pred             ceEEEEecchhhHHH-HHHHHHhc
Q psy8719           2 DRALIFCRTKLDCDN-LERYLNSI   24 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~-La~~L~~~   24 (33)
                      +=+|+||....+-+. +.+.|++.
T Consensus         3 ~lvi~f~s~~~~~~~~i~~~l~~~   26 (198)
T PF08495_consen    3 DLVILFCSPEYDEEAKILEALRER   26 (198)
T ss_pred             EEEEEEecchhhhhHHHHHHHHHH
Confidence            347999999988888 99988874


No 470
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. The SalR binds to glucose based compound Salicin which is chemically related to aspirin. The ligand-binding of SalR is structurally homologous to the periplasmic sugar-binding domain of ABC-transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand bind
Probab=30.45  E-value=1e+02  Score=16.96  Aligned_cols=27  Identities=15%  Similarity=0.268  Sum_probs=16.1

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |.++-.......+++|.+.|++.+.++
T Consensus        98 V~~d~~~~g~~a~~~l~~~g~~~i~~i  124 (270)
T cd01545          98 VRIDDRAAAREMTRHLIDLGHRRIAFI  124 (270)
T ss_pred             EEeccHHHHHHHHHHHHHCCCceEEEE
Confidence            344455555666677776676665543


No 471
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=30.41  E-value=1e+02  Score=17.13  Aligned_cols=26  Identities=12%  Similarity=0.043  Sum_probs=16.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +++++.++.+..+.+.+.|++.|.+.
T Consensus        37 ~v~~~~r~~~~~~~~~~~~~~~~~~~   62 (256)
T PRK06124         37 HVLVNGRNAATLEAAVAALRAAGGAA   62 (256)
T ss_pred             eEEEEeCCHHHHHHHHHHHHhcCCce
Confidence            45666666666667777776665543


No 472
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=30.34  E-value=1.2e+02  Score=19.99  Aligned_cols=29  Identities=10%  Similarity=0.392  Sum_probs=21.1

Q ss_pred             CceEEEEecchhh-----------HHHHHHHHHhcCCcee
Q psy8719           1 MDRALIFCRTKLD-----------CDNLERYLNSIDRRLI   29 (33)
Q Consensus         1 ~~~aIVF~nTK~~-----------ad~La~~L~~~G~~~~   29 (33)
                      +++++|+++|-++           |-.+|++++.+|+...
T Consensus       194 ~~~tvvv~atsd~~~~~r~~a~~~a~~iAEyfrd~G~~Vl  233 (418)
T TIGR03498       194 LKRSVVVVATSDESPLMRRQAAYTATAIAEYFRDQGKDVL  233 (418)
T ss_pred             cceeEEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCCEE
Confidence            4578888888654           5568999988886543


No 473
>PF14698 ASL_C2:  Argininosuccinate lyase C-terminal; PDB: 1XWO_A 2E9F_A 1TJW_C 1TJU_A 1DCN_B 1K7W_B 1HY1_C 1TJV_B 1AUW_A 1U15_B ....
Probab=30.26  E-value=47  Score=16.46  Aligned_cols=15  Identities=20%  Similarity=0.279  Sum_probs=10.9

Q ss_pred             HHHHHHHHHhcCCce
Q psy8719          14 CDNLERYLNSIDRRL   28 (33)
Q Consensus        14 ad~La~~L~~~G~~~   28 (33)
                      +-+||++|.+.|..|
T Consensus         4 ATdlAD~LVr~GipF   18 (70)
T PF14698_consen    4 ATDLADYLVRKGIPF   18 (70)
T ss_dssp             HHHHHHHHHHTTS-H
T ss_pred             HHHHHHHHHHcCCCH
Confidence            567899998887543


No 474
>PRK11773 uvrD DNA-dependent helicase II; Provisional
Probab=30.13  E-value=1.2e+02  Score=20.71  Aligned_cols=27  Identities=19%  Similarity=0.154  Sum_probs=22.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCce
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +...|.++|...++.+.+.|.++|...
T Consensus       348 ~diAVL~R~~~~~~~le~~L~~~gIPy  374 (721)
T PRK11773        348 SDCAILYRSNAQSRVLEEALLQAGIPY  374 (721)
T ss_pred             ccEEEEEecchhHHHHHHHHHHCCCCE
Confidence            355677999999999999999998764


No 475
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=30.07  E-value=96  Score=17.19  Aligned_cols=24  Identities=13%  Similarity=0.063  Sum_probs=20.1

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCc
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ..|||.+-..+..+.+.|++.|..
T Consensus       185 ~~i~~~~d~~a~g~~~~l~~~g~~  208 (273)
T cd06310         185 KGIFGANEGSAVGAARAVRQAGKA  208 (273)
T ss_pred             eEEEecCchhHHHHHHHHHhcCCC
Confidence            468888888899999999988873


No 476
>PRK05787 cobalt-precorrin-6Y C(5)-methyltransferase; Validated
Probab=30.00  E-value=87  Score=17.47  Aligned_cols=23  Identities=4%  Similarity=0.122  Sum_probs=18.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSID   25 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G   25 (33)
                      .++++...+...+++++.|.+.|
T Consensus       144 ~~v~l~~~~~~~~~i~~~L~~~g  166 (210)
T PRK05787        144 KVIMLPDPRFGPKEIAAELLERG  166 (210)
T ss_pred             eEEEEcCCCCCHHHHHHHHHhCC
Confidence            46677766778899999999887


No 477
>PRK04101 fosfomycin resistance protein FosB; Provisional
Probab=29.98  E-value=89  Score=16.16  Aligned_cols=25  Identities=20%  Similarity=0.246  Sum_probs=19.7

Q ss_pred             EEEEecchhhHHHHHHHHHhcCCce
Q psy8719           4 ALIFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         4 aIVF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|.|.-...+.+.+.+.|+++|...
T Consensus        66 hiaf~v~~~dv~~~~~~l~~~G~~i   90 (139)
T PRK04101         66 HIAFSIEEEDFDHWYQRLKENDVNI   90 (139)
T ss_pred             EEEEEecHHHHHHHHHHHHHCCceE
Confidence            4566545689999999999999764


No 478
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain. Dbs (DBL's big sister) pleckstrin homology (PH) domain. Dbs is a guanine nucleotide exchange factor (GEF), which contains spectrin repeats, a rhoGEF (DH) domain and a PH domain. The Dbs PH domain participates in binding to both the Cdc42 and RhoA GTPases.  PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=29.94  E-value=26  Score=19.79  Aligned_cols=11  Identities=27%  Similarity=1.017  Sum_probs=9.0

Q ss_pred             ceEEEEecchh
Q psy8719           2 DRALIFCRTKL   12 (33)
Q Consensus         2 ~~aIVF~nTK~   12 (33)
                      +++||||..+.
T Consensus        38 E~~viF~K~~~   48 (133)
T cd01227          38 EKAVLFCKKRE   48 (133)
T ss_pred             cceEEEEEEec
Confidence            68999998764


No 479
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=29.93  E-value=1e+02  Score=16.84  Aligned_cols=26  Identities=12%  Similarity=-0.042  Sum_probs=15.7

Q ss_pred             EecchhhHHHHHHHHHhcCCceeeee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      -.+-......++++|.+.|++.+.++
T Consensus        96 ~~d~~~~g~~~~~~l~~~g~~~i~~i  121 (266)
T cd06278          96 CSDNYEAGRLAAELLLAKGCRRIAFI  121 (266)
T ss_pred             EEChHHHHHHHHHHHHHCCCceEEEE
Confidence            34445556666777777776665543


No 480
>cd00387 Ribosomal_L7_L12 Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of the ribosome. The stalk base consists of a portion of the 23S rRNA and ribosomal proteins L11 and L10. An extended C-terminal helix of L10 provides the binding site for L7/L12. L7/L12 consists of two domains joined by a flexible hinge, with the helical N-terminal domain (NTD) forming pairs of homodimers that bind to the extended helix of L10. It is the only multimeric ribosomal component, with either four or six copies per ribosome that occur as two or three dimers bound to the L10 helix. L7/L12 is the only ribosomal protein that does not interact directly with rRNA, but instead has indirect interactions through L10. The globular C-terminal domains of L7/L12 are highly mobile. They are exposed to the cytoplasm and
Probab=29.92  E-value=58  Score=18.26  Aligned_cols=19  Identities=11%  Similarity=0.380  Sum_probs=16.6

Q ss_pred             chhhHHHHHHHHHhcCCce
Q psy8719          10 TKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~   28 (33)
                      +|++|+.+-+.|...|...
T Consensus       107 sKeeAE~ik~kLe~aGA~V  125 (127)
T cd00387         107 SKEEAEEIKKKLEEAGAKV  125 (127)
T ss_pred             CHHHHHHHHHHHHHcCCEE
Confidence            6899999999999999753


No 481
>cd00821 PH Pleckstrin homology (PH) domain. Pleckstrin homology (PH) domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
Probab=29.91  E-value=62  Score=14.36  Aligned_cols=21  Identities=14%  Similarity=0.275  Sum_probs=15.2

Q ss_pred             eEEEE-ecchhhHHHHHHHHHh
Q psy8719           3 RALIF-CRTKLDCDNLERYLNS   23 (33)
Q Consensus         3 ~aIVF-~nTK~~ad~La~~L~~   23 (33)
                      +.++| |.+.++.+...+.|+.
T Consensus        74 ~~~~~~~~s~~~~~~W~~~l~~   95 (96)
T cd00821          74 RSYLLQAESEEEREEWIEALQS   95 (96)
T ss_pred             cEEEEEeCCHHHHHHHHHHHhc
Confidence            34555 7788888888888764


No 482
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia. This group includes the ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia.  This regulatory protein is a member of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial trans
Probab=29.91  E-value=1e+02  Score=16.92  Aligned_cols=25  Identities=12%  Similarity=0.115  Sum_probs=14.1

Q ss_pred             EecchhhHHHHHHHHHhcCCceeee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      -++....+..+++.|.+.|++.+-+
T Consensus        97 ~~d~~~~~~~~~~~l~~~g~~~I~~  121 (265)
T cd06299          97 TSDPQPGMTEAVSLLVALGHKKIGY  121 (265)
T ss_pred             EECcHHHHHHHHHHHHHcCCCcEEE
Confidence            3444555556666666666655544


No 483
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=29.88  E-value=1.1e+02  Score=17.33  Aligned_cols=27  Identities=7%  Similarity=0.166  Sum_probs=17.5

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCcee
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      ++++..++.+..+.+.+.+...|.+..
T Consensus        36 ~V~~~~r~~~~~~~~~~~~~~~~~~~~   62 (278)
T PRK08277         36 KVAILDRNQEKAEAVVAEIKAAGGEAL   62 (278)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhcCCeEE
Confidence            456666666677777777776655443


No 484
>PF00318 Ribosomal_S2:  Ribosomal protein S2;  InterPro: IPR001865 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal S2 proteins have been shown to belong to a family that includes 40S ribosomal subunit 40kDa proteins, putative laminin-binding proteins, NAB-1 protein and 29.3kDa protein from Haloarcula marismortui [, ]. The laminin-receptor proteins are thus predicted to be the eukaryotic homologue of the eubacterial S2 risosomal proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2QNH_c 3MR8_B 3PYS_B 3MS0_B 3PYN_B 1VOZ_B 2OW8_c 3PYQ_B 3D5C_B 3PYU_B ....
Probab=29.76  E-value=67  Score=18.77  Aligned_cols=24  Identities=13%  Similarity=0.227  Sum_probs=18.0

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .-|.|++|+.....+.+.+.+.-+
T Consensus        57 ~~ILfV~t~~~~~~~v~~~a~~~~   80 (211)
T PF00318_consen   57 GKILFVGTKPQASKIVKKFAKRTG   80 (211)
T ss_dssp             GGEEEEECSTTHHHHHHHHHHHHT
T ss_pred             CeEEEEEcchHHHHHHHHHHHHhC
Confidence            458999999888887777665443


No 485
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR). Ligand-binding domain of DNA transcription repressor specific for xylose (XylR), a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of XylR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=29.74  E-value=1.1e+02  Score=17.06  Aligned_cols=27  Identities=4%  Similarity=-0.081  Sum_probs=17.7

Q ss_pred             EEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      |-++-.+.+..++++|.++|++.+-++
T Consensus        89 v~~d~~~~g~~~~~~l~~~g~~~i~~i  115 (265)
T cd01543          89 VTTDNAAIGRMAAEHFLERGFRHFAFY  115 (265)
T ss_pred             EeeCHHHHHHHHHHHHHHCCCcEEEEE
Confidence            445556667777777777777766543


No 486
>PRK05820 deoA thymidine phosphorylase; Reviewed
Probab=29.70  E-value=26  Score=23.31  Aligned_cols=21  Identities=19%  Similarity=0.317  Sum_probs=18.3

Q ss_pred             EecchhhHHHHHHHHHhcCCc
Q psy8719           7 FCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~   27 (33)
                      |+.|.++|++|++.+.+-|..
T Consensus       210 fmkt~~~A~~La~~mv~ig~~  230 (440)
T PRK05820        210 FMKTYEEARELARSMVEVANG  230 (440)
T ss_pred             CCCCHHHHHHHHHHHHHHHHH
Confidence            899999999999999876654


No 487
>PRK07454 short chain dehydrogenase; Provisional
Probab=29.68  E-value=1.1e+02  Score=16.94  Aligned_cols=25  Identities=16%  Similarity=0.167  Sum_probs=15.9

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCCc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDRR   27 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~~   27 (33)
                      ++++..++....+++.+.+++.+.+
T Consensus        32 ~V~~~~r~~~~~~~~~~~~~~~~~~   56 (241)
T PRK07454         32 DLALVARSQDALEALAAELRSTGVK   56 (241)
T ss_pred             EEEEEeCCHHHHHHHHHHHHhCCCc
Confidence            4566677666666777666655544


No 488
>TIGR03327 AMP_phos AMP phosphorylase. This enzyme family is found, so far, strictly in the Archaea, and only in those with a type III Rubisco enzyme. Most of the members previously were annotated as thymidine phosphorylase, or DeoA. The AMP metabolized by this enzyme may be produced by ADP-dependent sugar kinases.
Probab=29.59  E-value=28  Score=23.67  Aligned_cols=23  Identities=22%  Similarity=0.211  Sum_probs=19.4

Q ss_pred             EEecchhhHHHHHHHHHhcCCce
Q psy8719           6 IFCRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|++|.+++++|++.|.+-|.++
T Consensus       287 Afm~~~~~A~~LA~~mv~vg~~~  309 (500)
T TIGR03327       287 AKVKTVEEGRKLARDFIELGDRL  309 (500)
T ss_pred             CcCCCHHHHHHHHHHHHHHHHHc
Confidence            38999999999999998776543


No 489
>TIGR01426 MGT glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production.
Probab=29.54  E-value=65  Score=19.49  Aligned_cols=18  Identities=17%  Similarity=0.086  Sum_probs=14.9

Q ss_pred             HHHHHHHHhcCCceeeee
Q psy8719          15 DNLERYLNSIDRRLIYYF   32 (33)
Q Consensus        15 d~La~~L~~~G~~~~~~~   32 (33)
                      -.||+.|+++|++..++.
T Consensus        13 l~lA~~L~~~Gh~V~~~~   30 (392)
T TIGR01426        13 LGVVEELVARGHRVTYAT   30 (392)
T ss_pred             HHHHHHHHhCCCeEEEEe
Confidence            368999999999987764


No 490
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the C-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dio
Probab=29.42  E-value=97  Score=16.45  Aligned_cols=25  Identities=4%  Similarity=-0.089  Sum_probs=18.7

Q ss_pred             EEE-ecchhhHHHHHHHHHhcCCcee
Q psy8719           5 LIF-CRTKLDCDNLERYLNSIDRRLI   29 (33)
Q Consensus         5 IVF-~nTK~~ad~La~~L~~~G~~~~   29 (33)
                      |-| +...++++++.+.|.+.|....
T Consensus        63 iaf~v~d~~~l~~~~~~l~~~Gi~~~   88 (144)
T cd07239          63 VAFEMPSIDEVMRGIGRMIDKGIDIL   88 (144)
T ss_pred             EEEECCCHHHHHHHHHHHHHcCCcee
Confidence            344 4666788888899999998754


No 491
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=29.40  E-value=1.1e+02  Score=17.03  Aligned_cols=26  Identities=19%  Similarity=0.194  Sum_probs=15.0

Q ss_pred             EecchhhHHHHHHHHHhcCCceeeee
Q psy8719           7 FCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         7 F~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      -.+....+..++++|.+.|++.+-++
T Consensus        97 ~~d~~~~g~~a~~~l~~~G~~~i~~l  122 (269)
T cd06281          97 LFDHAAGMRQAVEYLISLGHRRIALV  122 (269)
T ss_pred             EECcHHHHHHHHHHHHHCCCcEEEEe
Confidence            33444555666667766666655443


No 492
>PRK12311 rpsB 30S ribosomal protein S2/unknown domain fusion protein; Provisional
Probab=29.36  E-value=68  Score=20.56  Aligned_cols=24  Identities=13%  Similarity=0.094  Sum_probs=18.4

Q ss_pred             eEEEEecchhhHHHHHHHHHhcCC
Q psy8719           3 RALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      .-|.|++||..+.++.+...+.=+
T Consensus        60 g~iLfVgTk~~~~~~V~~~A~~~g   83 (326)
T PRK12311         60 GRVLFVGTKRQAQDAVADAAKRSA   83 (326)
T ss_pred             CEEEEEeCcHHHHHHHHHHHHHhC
Confidence            458999999999888777655443


No 493
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase. Members of this family all are enzymes active as catechol 2,3 dioxygenase (1.13.11.2), although some members have highly significant activity on catechol derivatives such as 3-methylcatechol, 3-chlorocatechol, and 4-chlorocatechol (see Mars, et al.). This enzyme is also called metapyrocatechase, as it performs a meta-cleavage (an extradiol ring cleavage), in contrast to the ortho-cleavage (intradiol ring cleavage)performed by catechol 1,2-dioxygenase (EC 1.13.11.1), also called pyrocatechase.
Probab=29.35  E-value=1.2e+02  Score=17.76  Aligned_cols=21  Identities=14%  Similarity=0.196  Sum_probs=18.3

Q ss_pred             ecchhhHHHHHHHHHhcCCce
Q psy8719           8 CRTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         8 ~nTK~~ad~La~~L~~~G~~~   28 (33)
                      +.+.++.+.+.+.|++.|...
T Consensus        68 v~~~~dl~~~~~~l~~~G~~~   88 (303)
T TIGR03211        68 VESEADLERLVKRLEAYGVGT   88 (303)
T ss_pred             eCCHHHHHHHHHHHHHcCCCe
Confidence            678889999999999998764


No 494
>PF07864 DUF1651:  Protein of unknown function (DUF1651);  InterPro: IPR012447  The proteins in this entry have not been characterised.
Probab=29.35  E-value=59  Score=16.13  Aligned_cols=19  Identities=21%  Similarity=0.197  Sum_probs=16.3

Q ss_pred             chhhHHHHHHHHHhcCCce
Q psy8719          10 TKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus        10 TK~~ad~La~~L~~~G~~~   28 (33)
                      ++++|.++...|.+.|-+.
T Consensus        51 ~~~~A~e~W~~L~~~GW~~   69 (75)
T PF07864_consen   51 TREEARELWKELQKTGWRR   69 (75)
T ss_pred             EHHHHHHHHHHHHHcCCEE
Confidence            5789999999999998764


No 495
>cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability. Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability. FcuR acts as an inducer of fucRRIAK and as a corepressor of another locus that regulates production of fucosylated glycans. FcuR and its close homologs in this group are a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes t
Probab=29.34  E-value=1.1e+02  Score=17.23  Aligned_cols=27  Identities=4%  Similarity=-0.224  Sum_probs=19.4

Q ss_pred             EEecchhhHHHHHHHHHh--cCCceeeee
Q psy8719           6 IFCRTKLDCDNLERYLNS--IDRRLIYYF   32 (33)
Q Consensus         6 VF~nTK~~ad~La~~L~~--~G~~~~~~~   32 (33)
                      |-.+-...+..++++|-+  +|++.+-|+
T Consensus        95 V~~D~~~~~~~a~~~L~~~~~G~~~Ia~i  123 (247)
T cd06276          95 VAQDFEKAIYNALQEGLEKLKKYKKLILV  123 (247)
T ss_pred             EEEccHHHHHHHHHHHHHHhcCCCEEEEE
Confidence            334555667778888888  888887664


No 496
>TIGR01012 Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archaeal). TIGR01011 describes the related protein of organelles and bacteria.
Probab=29.12  E-value=84  Score=18.76  Aligned_cols=22  Identities=0%  Similarity=0.078  Sum_probs=17.1

Q ss_pred             eEEEEecchhhHHHHHHHHHhc
Q psy8719           3 RALIFCRTKLDCDNLERYLNSI   24 (33)
Q Consensus         3 ~aIVF~nTK~~ad~La~~L~~~   24 (33)
                      .-|.|+.||..+.++.++..+.
T Consensus        62 ~~ILfVgtk~~~~~~V~~~A~~   83 (196)
T TIGR01012        62 EDILVVSARIYGQKPVLKFAKV   83 (196)
T ss_pred             CeEEEEecCHHHHHHHHHHHHH
Confidence            4589999999998887766543


No 497
>PF10678 DUF2492:  Protein of unknown function (DUF2492);  InterPro: IPR019620  This entry describes a family of small cytosolic proteins, about 80 amino acids in length, in which the eight invariant residues include three His residues and two Cys residues. Two pairs of these invariant residues occur in motifs HxH (where x is A or G) and CxH, both of which suggest metal-binding activity. This protein family was identified by searching with a phylogenetic profile based on an anaerobic sulphatase-maturase enzyme, which contains multiple 4Fe-4S clusters. The linkages by phylogenetic profiling and by iron-sulphur cluster-related motifs together suggest this protein may be an accessory protein to certain maturases in sulphatase/maturase systems. 
Probab=29.04  E-value=53  Score=17.25  Aligned_cols=15  Identities=20%  Similarity=0.474  Sum_probs=12.7

Q ss_pred             hhHHHHHHHHHhcCC
Q psy8719          12 LDCDNLERYLNSIDR   26 (33)
Q Consensus        12 ~~ad~La~~L~~~G~   26 (33)
                      -++++|.++|.+.|+
T Consensus        47 m~a~eLv~FL~~rgK   61 (78)
T PF10678_consen   47 MTADELVDFLEERGK   61 (78)
T ss_pred             CCHHHHHHHHHHcCC
Confidence            368999999999886


No 498
>TIGR01319 glmL_fam conserved hypothetical protein. This small family includes, so far, an uncharacterized protein from E. coli O157:H7 and GlmL from Clostridium tetanomorphum and Clostridium cochlearium. GlmL is located between the genes for the two subunits, epsilon (GlmE) and sigma (GlmS), of the coenzyme-B12-dependent glutamate mutase (methylaspartate mutase), the first enzyme in a pathway of glutamate fermentation. Members shows significant sequence similarity to the hydantoinase branch of the hydantoinase/oxoprolinase family (pfam01968).
Probab=29.03  E-value=1.1e+02  Score=20.74  Aligned_cols=29  Identities=21%  Similarity=0.315  Sum_probs=23.1

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYYF   32 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~~   32 (33)
                      +..||++-++...++|.+-|...  ++.||.
T Consensus       151 ~~pIIyAGN~~a~~~V~~il~~~--~~~~~i  179 (463)
T TIGR01319       151 DCAIIVAGNKDIQDEVQEIFDHA--DIFYRI  179 (463)
T ss_pred             CCcEEEeCCHHHHHHHHHHHhcC--CceEEe
Confidence            45699999999999999999954  555554


No 499
>PF11829 DUF3349:  Protein of unknown function (DUF3349);  InterPro: IPR021784  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 99 to 124 amino acids in length. ; PDB: 2KVC_A 3OL3_B 3OL4_A 2LKY_A.
Probab=28.95  E-value=62  Score=17.52  Aligned_cols=20  Identities=20%  Similarity=0.172  Sum_probs=12.7

Q ss_pred             cchhhHHHHHHHHHhcCCce
Q psy8719           9 RTKLDCDNLERYLNSIDRRL   28 (33)
Q Consensus         9 nTK~~ad~La~~L~~~G~~~   28 (33)
                      .|-++.++|+..|.+.|..+
T Consensus        73 P~~~di~RV~~~Laa~GWPl   92 (96)
T PF11829_consen   73 PTPEDIERVRARLAAAGWPL   92 (96)
T ss_dssp             S-HHHHHHHHHHHHTTT-GC
T ss_pred             cCHHHHHHHHHHHHhCCCCC
Confidence            35567777888887777543


No 500
>PRK07116 flavodoxin; Provisional
Probab=28.88  E-value=64  Score=17.62  Aligned_cols=20  Identities=15%  Similarity=0.203  Sum_probs=14.4

Q ss_pred             EEEEe----cchhhHHHHHHHHHh
Q psy8719           4 ALIFC----RTKLDCDNLERYLNS   23 (33)
Q Consensus         4 aIVF~----nTK~~ad~La~~L~~   23 (33)
                      .|||-    ||+.-|+.+++.|..
T Consensus         6 lIvY~S~tGnT~~iA~~Ia~~l~~   29 (160)
T PRK07116          6 LVAYFSATGTTKKVAEKLAEVTGA   29 (160)
T ss_pred             EEEEECCCCcHHHHHHHHHHHhcC
Confidence            45554    778888888888854


Done!