BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy8735
(115 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo
Form)
pdb|1YNP|B Chain B, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo
Form)
pdb|1YNQ|A Chain A, Aldo-Keto Reductase Akr11c1 From Bacillus Halodurans (Holo
Form)
pdb|1YNQ|B Chain B, Aldo-Keto Reductase Akr11c1 From Bacillus Halodurans (Holo
Form)
Length = 317
Score = 27.7 bits (60), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
Query: 53 EGEVDKKTITDTKEKMVKEYNKRKRMCTEMLE-AILENYPKSKKILLEEVGI 103
EG + I+ + ++KEY KR + + M++ +IL+ P+ L++E G+
Sbjct: 160 EGVIRYYGISSIRPNVIKEYLKRSNIVSIMMQYSILDRRPEEWFPLIQEHGV 211
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.308 0.126 0.320
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,984,574
Number of Sequences: 62578
Number of extensions: 54723
Number of successful extensions: 174
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 170
Number of HSP's gapped (non-prelim): 5
length of query: 115
length of database: 14,973,337
effective HSP length: 78
effective length of query: 37
effective length of database: 10,092,253
effective search space: 373413361
effective search space used: 373413361
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 45 (21.9 bits)