Diaphorina citri psyllid: psy8735


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MDDKEKVKSKLKQLSQQMTEAEAKQKKAELQAELEEKKSKLEKLSRNVNVISEGEVDKKTITDTKEKMVKEYNKRKRMCTEMLEAILENYPKSKKILLEEVGIETDEMVSMEKLQ
ccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccc
*************************************************************TDTKEKMVKEYNKRKRMCTEMLEAILENYPKSKKILLEEVGIETDEMVSME***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVDKKTITDTKEKMVKEYNKRKRMCTEMLEAILENYPKSKKILLEEVGIETDEMVSMEKLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050681 [MF]androgen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0046966 [MF]thyroid hormone receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0035259 [MF]glucocorticoid receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030331 [MF]estrogen receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0050692 [MF]DBD domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VIQ, chain B
Confidence level:probable
Coverage over the Query: 19-107
View the alignment between query and template
View the model in PyMOL