Diaphorina citri psyllid: psy873


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MDEDLLLENSQKLQAVLPSVKDKSKPSAATSYTIGGVKVEFPVKAYPSQISMMTKESSKYISSMHLSVLCTVDLSCPIWFWWGTSLINMDIRSVPFRIRVRLSRRRNDDEDSPHKLYTLVTWVPVPTFKELQTENVDASAD
ccHHHcccccHHHccccccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccEEEcccccccccccccccEEEEEEEccccccccccccccEEEEEEEEcccccccEEEEEccccc
******************************SYTIGGVKVEFPVKAYPSQISMMTKESSKYISSMHLSVLCTVDLSCPIWFWWGTSLINMDIRSVPFRIRVRL***********HKLYTLVTWVPVPTFKELQ*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEDLLLENSQKLQAVLPSVKDKSKPSAATSYTIGGVKVEFPVKAYPSQISMMTKESSKYISSMHLSVLCTVDLSCPIWFWWGTSLINMDIRSVPFRIRVRLSRRRNDDEDSPHKLYTLVTWVPVPTFKELQTENVDASAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L31 confidentQ9V597

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0000022 [BP]mitotic spindle elongationprobableGO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain x
Confidence level:very confident
Coverage over the Query: 29-115
View the alignment between query and template
View the model in PyMOL