Query         psy8741
Match_columns 62
No_of_seqs    42 out of 44
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 18:01:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8741.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8741hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2243|consensus               99.9 4.2E-28 9.1E-33  207.4   2.6   62    1-62   4030-4091(5019)
  2 PF00036 EF-hand_1:  EF hand;    97.8 6.7E-06 1.5E-10   42.3   1.1   25   32-56      4-28  (29)
  3 PF13405 EF-hand_6:  EF-hand do  97.5 4.4E-05 9.5E-10   38.4   1.0   23   33-55      5-27  (31)
  4 PF13202 EF-hand_5:  EF hand; P  97.3 8.6E-05 1.9E-09   36.9   0.8   22   33-54      4-25  (25)
  5 PF13499 EF-hand_7:  EF-hand do  96.9 0.00039 8.5E-09   38.5   1.2   22   33-54     45-66  (66)
  6 PF13499 EF-hand_7:  EF-hand do  96.9 0.00045 9.7E-09   38.2   1.3   27   32-58      4-30  (66)
  7 smart00054 EFh EF-hand, calciu  96.7  0.0009 1.9E-08   29.7   1.4   24   33-56      5-28  (29)
  8 PF13833 EF-hand_8:  EF-hand do  96.3  0.0022 4.7E-08   34.6   1.5   26   31-56     28-53  (54)
  9 cd00051 EFh EF-hand, calcium b  96.3  0.0031 6.6E-08   31.9   1.9   25   33-57      5-29  (63)
 10 cd00052 EH Eps15 homology doma  96.2  0.0031 6.8E-08   34.2   1.5   26   32-57      3-28  (67)
 11 KOG0027|consensus               96.0   0.003 6.4E-08   40.6   1.2   26   31-56     88-113 (151)
 12 smart00027 EH Eps15 homology d  95.1   0.011 2.3E-07   35.6   1.1   26   32-57     14-39  (96)
 13 PTZ00184 calmodulin; Provision  94.9   0.015 3.3E-07   34.9   1.4   26   31-56     87-112 (149)
 14 cd05027 S-100B S-100B: S-100B   94.7   0.015 3.3E-07   35.6   1.0   25   32-56     12-38  (88)
 15 KOG0034|consensus               94.5   0.022 4.7E-07   39.8   1.6   24   33-56    109-132 (187)
 16 cd05022 S-100A13 S-100A13: S-1  94.4   0.019 4.2E-07   35.5   1.0   25   32-56     12-37  (89)
 17 KOG0034|consensus               94.2   0.025 5.5E-07   39.5   1.4   26   32-57    151-176 (187)
 18 PTZ00183 centrin; Provisional   94.1   0.031 6.8E-07   34.2   1.5   24   33-56     22-45  (158)
 19 cd00213 S-100 S-100: S-100 dom  94.1   0.028 6.1E-07   32.9   1.2   25   32-56     12-38  (88)
 20 cd05026 S-100Z S-100Z: S-100Z   93.8   0.031 6.7E-07   34.1   1.1   26   32-57     14-41  (93)
 21 cd05025 S-100A1 S-100A1: S-100  93.7   0.031 6.7E-07   33.4   1.0   25   32-56     13-39  (92)
 22 KOG0044|consensus               93.6   0.048   1E-06   38.5   2.0   26   32-57    104-129 (193)
 23 cd05031 S-100A10_like S-100A10  93.4   0.036 7.8E-07   33.3   0.9   25   32-56     12-38  (94)
 24 cd00252 SPARC_EC SPARC_EC; ext  93.2   0.046 9.9E-07   35.4   1.2   22   32-53     52-73  (116)
 25 PTZ00184 calmodulin; Provision  92.6   0.075 1.6E-06   31.9   1.5   24   33-56     16-39  (149)
 26 KOG0027|consensus               92.3   0.072 1.6E-06   34.2   1.2   27   32-58     12-38  (151)
 27 PTZ00183 centrin; Provisional   92.0   0.099 2.1E-06   32.0   1.5   26   32-57     94-119 (158)
 28 cd05022 S-100A13 S-100A13: S-1  90.5    0.19 4.1E-06   31.1   1.8   25   32-56     51-75  (89)
 29 COG5126 FRQ1 Ca2+-binding prot  90.1    0.16 3.4E-06   35.2   1.3   25   32-56     24-48  (160)
 30 cd05030 calgranulins Calgranul  90.0    0.23   5E-06   29.9   1.8   27   31-57     54-80  (88)
 31 KOG2643|consensus               89.1    0.26 5.5E-06   39.8   1.9   33   24-56    421-453 (489)
 32 cd05031 S-100A10_like S-100A10  88.5    0.33 7.1E-06   29.0   1.7   26   32-57     55-80  (94)
 33 PF14658 EF-hand_9:  EF-hand do  88.5    0.32   7E-06   29.6   1.7   23   34-56     41-64  (66)
 34 cd00252 SPARC_EC SPARC_EC; ext  88.2    0.26 5.5E-06   32.0   1.1   23   32-54     84-106 (116)
 35 cd05026 S-100Z S-100Z: S-100Z   87.9     0.4 8.6E-06   29.1   1.8   25   32-56     57-81  (93)
 36 cd00052 EH Eps15 homology doma  87.6     0.4 8.6E-06   25.7   1.5   25   31-55     36-60  (67)
 37 cd05023 S-100A11 S-100A11: S-1  87.2    0.46   1E-05   29.1   1.8   25   32-56     56-80  (89)
 38 cd05029 S-100A6 S-100A6: S-100  86.7    0.36 7.7E-06   29.4   1.1   24   33-56     15-40  (88)
 39 cd05025 S-100A1 S-100A1: S-100  86.2    0.54 1.2E-05   27.9   1.7   26   32-57     56-81  (92)
 40 cd05029 S-100A6 S-100A6: S-100  85.0    0.37 8.1E-06   29.3   0.6   26   30-55     53-78  (88)
 41 COG5126 FRQ1 Ca2+-binding prot  84.4    0.52 1.1E-05   32.6   1.1   23   32-54     96-118 (160)
 42 PLN02964 phosphatidylserine de  83.9    0.53 1.2E-05   38.6   1.2   27   31-57    218-244 (644)
 43 PRK12309 transaldolase/EF-hand  83.8    0.63 1.4E-05   35.7   1.5   23   33-55    362-384 (391)
 44 KOG0028|consensus               83.6    0.69 1.5E-05   33.0   1.5   24   32-55    110-133 (172)
 45 PRK12309 transaldolase/EF-hand  83.2    0.83 1.8E-05   35.1   1.9   37   15-51    305-357 (391)
 46 smart00027 EH Eps15 homology d  83.2    0.94   2E-05   27.1   1.8   28   32-59     48-75  (96)
 47 KOG2643|consensus               82.1    0.97 2.1E-05   36.6   2.0   39   16-54    216-259 (489)
 48 cd05030 calgranulins Calgranul  82.0    0.93   2E-05   27.2   1.5   25   32-56     12-38  (88)
 49 KOG0044|consensus               78.4     1.3 2.8E-05   31.3   1.4   27   32-58    151-177 (193)
 50 cd05023 S-100A11 S-100A11: S-1  76.0     1.8 3.8E-05   26.5   1.4   25   33-57     14-40  (89)
 51 cd05027 S-100B S-100B: S-100B   74.8     2.4 5.2E-05   25.8   1.8   25   32-56     55-79  (88)
 52 KOG0038|consensus               69.7     4.8  0.0001   29.1   2.6   39   17-55     92-135 (189)
 53 cd00213 S-100 S-100: S-100 dom  69.4     3.9 8.5E-05   23.7   1.8   24   33-56     56-79  (88)
 54 KOG0037|consensus               67.5     3.9 8.5E-05   30.1   1.8   24   33-56    129-152 (221)
 55 PF12763 EF-hand_4:  Cytoskelet  60.8     5.6 0.00012   25.3   1.4   20   37-56     52-71  (104)
 56 PLN02964 phosphatidylserine de  58.9       5 0.00011   33.1   1.1   26   31-56    182-207 (644)
 57 PF10591 SPARC_Ca_bdg:  Secrete  58.0     2.9 6.4E-05   26.6  -0.3   41   11-51     37-77  (113)
 58 PF05042 Caleosin:  Caleosin re  57.5       5 0.00011   28.5   0.8   14   37-50     16-29  (174)
 59 KOG0031|consensus               52.4     9.6 0.00021   27.3   1.6   24   32-55    105-128 (171)
 60 PF09851 SHOCT:  Short C-termin  49.5      15 0.00032   18.8   1.6   14   42-55     14-27  (31)
 61 PF15603 Imm45:  Immunity prote  49.2      17 0.00036   22.8   2.1   33   28-60     38-71  (82)
 62 PF15017 AF1Q:  Drug resistance  48.0      11 0.00024   24.1   1.2   17   36-52     67-83  (87)
 63 KOG4251|consensus               47.7      13 0.00028   29.0   1.7   21   32-52    144-164 (362)
 64 KOG4251|consensus               45.9      11 0.00023   29.5   1.0   18   34-51    107-124 (362)
 65 KOG0377|consensus               45.6      12 0.00027   31.1   1.4   23   34-56    553-575 (631)
 66 cd05024 S-100A10 S-100A10: A s  45.0      17 0.00036   23.1   1.7   24   33-57     13-36  (91)
 67 KOG0751|consensus               44.3     8.1 0.00018   32.5   0.2   38   20-57    171-208 (694)
 68 KOG4223|consensus               44.0     7.6 0.00017   30.0   0.0   33   25-57    197-229 (325)
 69 PHA02152 hypothetical protein   43.8      14  0.0003   24.2   1.2   14   40-53     22-35  (96)
 70 KOG0041|consensus               42.5      15 0.00032   27.6   1.3   25   32-56    103-127 (244)
 71 PF09693 Phage_XkdX:  Phage unc  41.5      15 0.00032   19.8   0.9   12   42-53     24-35  (40)
 72 PF03986 Autophagy_N:  Autophag  40.6      14 0.00031   25.1   1.0   12   42-53     25-36  (145)
 73 PF09336 Vps4_C:  Vps4 C termin  37.6      22 0.00049   20.7   1.3   15   44-58     29-43  (62)
 74 PF13724 DNA_binding_2:  DNA-bi  37.3      16 0.00034   21.3   0.6   11   22-32     17-27  (49)
 75 PF10552 ORF6C:  ORF6C domain;   37.2      20 0.00044   22.6   1.2   28   35-62     80-107 (116)
 76 KOG4065|consensus               34.6      23  0.0005   24.7   1.2   19   35-53    124-142 (144)
 77 PF06014 DUF910:  Bacterial pro  33.4      26 0.00057   21.2   1.2   38   11-55      6-53  (62)
 78 KOG2463|consensus               32.5      27 0.00059   27.7   1.4   18   37-54    176-193 (376)
 79 KOG0040|consensus               32.0      19 0.00042   34.0   0.6   28   33-60   2258-2285(2399)
 80 PF02417 Chromate_transp:  Chro  29.6      31 0.00068   22.7   1.2   21   35-55     28-48  (169)
 81 KOG0028|consensus               29.5      34 0.00073   24.6   1.4   25   32-56     37-61  (172)
 82 PF04081 DNA_pol_delta_4:  DNA   29.1      30 0.00065   23.5   1.0   16    9-24     61-76  (124)
 83 COG5663 Uncharacterized conser  28.8      42 0.00091   24.5   1.8   45    8-58     20-64  (194)
 84 PF03645 Tctex-1:  Tctex-1 fami  28.3      19 0.00041   21.6  -0.0   13   36-48     72-84  (101)
 85 PF14788 EF-hand_10:  EF hand;   28.2      26 0.00056   20.4   0.5   26   27-52     20-45  (51)
 86 PF12923 RRP7:  Ribosomal RNA-p  26.6      29 0.00063   22.6   0.6   35   12-46     16-54  (131)
 87 KOG0377|consensus               26.2      37  0.0008   28.4   1.3   55    2-56    539-615 (631)
 88 PF10256 Erf4:  Golgin subfamil  26.0      52  0.0011   20.4   1.6   18   40-57     25-42  (118)
 89 PF00447 HSF_DNA-bind:  HSF-typ  25.9      28  0.0006   21.2   0.4   31   23-53      4-39  (103)
 90 PF08726 EFhand_Ca_insen:  Ca2+  25.8      21 0.00045   21.6  -0.2   22   32-54     10-31  (69)
 91 COG2059 ChrA Chromate transpor  25.6      32  0.0007   24.3   0.7   23   35-57     33-55  (195)
 92 PF00404 Dockerin_1:  Dockerin   25.1      47   0.001   16.1   1.1   14   38-51      1-14  (21)
 93 TIGR01669 phage_XkdX phage unc  25.0      43 0.00094   18.6   1.0   13   42-54     29-41  (45)
 94 PF13331 DUF4093:  Domain of un  24.5      39 0.00084   21.0   0.9   11   45-55     77-87  (87)
 95 PF09953 DUF2187:  Uncharacteri  23.4      34 0.00073   20.5   0.4   25   25-49     29-53  (57)
 96 smart00415 HSF heat shock fact  22.5      59  0.0013   20.1   1.4   31   23-53      7-42  (105)
 97 PF06902 Fer4_19:  Divergent 4F  21.6      51  0.0011   19.3   1.0   17   33-49     25-41  (64)
 98 PHA02754 hypothetical protein;  21.3      51  0.0011   20.4   0.9   15   44-58     10-24  (67)
 99 COG2306 Predicted RNA-binding   21.2      60  0.0013   23.5   1.4   15   41-55    133-147 (183)
100 PF10747 DUF2522:  Protein of u  20.6 1.1E+02  0.0024   21.0   2.5   38    5-47     98-137 (142)
101 PF06226 DUF1007:  Protein of u  20.3      29 0.00063   24.0  -0.3   28   26-53     48-75  (212)

No 1  
>KOG2243|consensus
Probab=99.94  E-value=4.2e-28  Score=207.45  Aligned_cols=62  Identities=61%  Similarity=0.898  Sum_probs=61.2

Q ss_pred             CcccccccchhHHHHHHHHHHHHhhccccCCCccccccCCCCCcccchhHHHHHHHhhhcCC
Q psy8741           1 MVDTLVESAANVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQKSYTP   62 (62)
Q Consensus         1 mVd~LvEs~snve~ilkffdmflKLkdltsS~~F~e~d~~~~G~Is~keF~kaMe~qk~ys~   62 (62)
                      ||||||||+.|||||||||||||||||||||+.|+|||||++|+||++|||||||.+|+||+
T Consensus      4030 mvd~lvess~nvemilkffdmflklkdltssdtfkeydpdgkgiiskkdf~kame~~k~ytq 4091 (5019)
T KOG2243|consen 4030 MVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKDFHKAMEGHKHYTQ 4091 (5019)
T ss_pred             HHHHHHHcCccHHHHHHHHHHHHHHhhccccccchhcCCCCCccccHHHHHHHHhccccchh
Confidence            89999999999999999999999999999999999999999999999999999999999986


No 2  
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=97.84  E-value=6.7e-06  Score=42.27  Aligned_cols=25  Identities=32%  Similarity=0.558  Sum_probs=22.8

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .+|+.||.|++|-|+..||...|..
T Consensus         4 ~~F~~~D~d~dG~I~~~Ef~~~~~~   28 (29)
T PF00036_consen    4 EAFREFDKDGDGKIDFEEFKEMMKK   28 (29)
T ss_dssp             HHHHHHSTTSSSEEEHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCcCCHHHHHHHHHh
Confidence            4799999999999999999999864


No 3  
>PF13405 EF-hand_6:  EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B ....
Probab=97.49  E-value=4.4e-05  Score=38.44  Aligned_cols=23  Identities=13%  Similarity=0.436  Sum_probs=20.9

Q ss_pred             ccccccCCCCCcccchhHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      +|+.||.|++|.|+..||+.+|.
T Consensus         5 ~F~~~D~d~dG~I~~~el~~~l~   27 (31)
T PF13405_consen    5 AFKMFDKDGDGFIDFEELRAILR   27 (31)
T ss_dssp             HHHHH-TTSSSEEEHHHHHHHHH
T ss_pred             HHHHHCCCCCCcCcHHHHHHHHH
Confidence            68999999999999999999987


No 4  
>PF13202 EF-hand_5:  EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A ....
Probab=97.32  E-value=8.6e-05  Score=36.89  Aligned_cols=22  Identities=18%  Similarity=0.486  Sum_probs=19.9

Q ss_pred             ccccccCCCCCcccchhHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      +|+.+|.|++|.||+.||++.|
T Consensus         4 ~F~~~D~d~DG~is~~E~~~~~   25 (25)
T PF13202_consen    4 AFQQFDTDGDGKISFEEFQRLV   25 (25)
T ss_dssp             HHHHHTTTSSSEEEHHHHHHHH
T ss_pred             HHHHHcCCCCCcCCHHHHHHHC
Confidence            6899999999999999999754


No 5  
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=96.94  E-value=0.00039  Score=38.45  Aligned_cols=22  Identities=27%  Similarity=0.454  Sum_probs=18.1

Q ss_pred             ccccccCCCCCcccchhHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      .|+.+|+|++|.|+..||..+|
T Consensus        45 ~~~~~D~d~dG~i~~~Ef~~~~   66 (66)
T PF13499_consen   45 IFREFDTDGDGRISFDEFLNFM   66 (66)
T ss_dssp             HHHHHTTTSSSSEEHHHHHHHH
T ss_pred             HHHHhCCCCcCCCcHHHHhccC
Confidence            3778888888888888888876


No 6  
>PF13499 EF-hand_7:  EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E ....
Probab=96.92  E-value=0.00045  Score=38.24  Aligned_cols=27  Identities=11%  Similarity=0.485  Sum_probs=24.2

Q ss_pred             CccccccCCCCCcccchhHHHHHHHhh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQK   58 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~qk   58 (62)
                      .+|+.+|.|++|.|++.||++++....
T Consensus         4 ~~F~~~D~d~~G~i~~~el~~~~~~~~   30 (66)
T PF13499_consen    4 EAFKKFDKDGDGYISKEELRRALKHLG   30 (66)
T ss_dssp             HHHHHHSTTSSSEEEHHHHHHHHHHTT
T ss_pred             HHHHHHcCCccCCCCHHHHHHHHHHhc
Confidence            369999999999999999999998754


No 7  
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=96.75  E-value=0.0009  Score=29.65  Aligned_cols=24  Identities=21%  Similarity=0.426  Sum_probs=21.8

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .|+.+|+|++|.|+..+|...+..
T Consensus         5 ~f~~~d~~~~g~i~~~e~~~~~~~   28 (29)
T smart00054        5 AFRLFDKDGDGKIDFEEFKDLLKA   28 (29)
T ss_pred             HHHHHCCCCCCcEeHHHHHHHHHh
Confidence            588999999999999999998865


No 8  
>PF13833 EF-hand_8:  EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A ....
Probab=96.35  E-value=0.0022  Score=34.61  Aligned_cols=26  Identities=23%  Similarity=0.508  Sum_probs=23.1

Q ss_pred             CCccccccCCCCCcccchhHHHHHHH
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ...|..+|+|++|.|+..||...|..
T Consensus        28 ~~l~~~~D~~~~G~I~~~EF~~~~~~   53 (54)
T PF13833_consen   28 DRLFREFDTDGDGYISFDEFISMMQR   53 (54)
T ss_dssp             HHHHHHHTTSSSSSEEHHHHHHHHHH
T ss_pred             HHHHHhcccCCCCCCCHHHHHHHHHh
Confidence            35688999999999999999999875


No 9  
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
Probab=96.32  E-value=0.0031  Score=31.88  Aligned_cols=25  Identities=16%  Similarity=0.371  Sum_probs=22.4

Q ss_pred             ccccccCCCCCcccchhHHHHHHHh
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      .|..+|++++|.|+..||..+++..
T Consensus         5 ~f~~~d~~~~g~l~~~e~~~~l~~~   29 (63)
T cd00051           5 AFRLFDKDGDGTISADELKAALKSL   29 (63)
T ss_pred             HHHHhCCCCCCcCcHHHHHHHHHHh
Confidence            5888999999999999999999865


No 10 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=96.15  E-value=0.0031  Score=34.20  Aligned_cols=26  Identities=12%  Similarity=0.293  Sum_probs=22.7

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..|+.+|+|++|.|+..|+.+++...
T Consensus         3 ~~F~~~D~~~~G~i~~~el~~~l~~~   28 (67)
T cd00052           3 QIFRSLDPDGDGLISGDEARPFLGKS   28 (67)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHHc
Confidence            46889999999999999999998654


No 11 
>KOG0027|consensus
Probab=96.04  E-value=0.003  Score=40.61  Aligned_cols=26  Identities=15%  Similarity=0.457  Sum_probs=23.6

Q ss_pred             CCccccccCCCCCcccchhHHHHHHH
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      -++|+.||.|++|.||..|+++.|..
T Consensus        88 ~eaF~~fD~d~~G~Is~~el~~~l~~  113 (151)
T KOG0027|consen   88 KEAFRVFDKDGDGFISASELKKVLTS  113 (151)
T ss_pred             HHHHHHHccCCCCcCcHHHHHHHHHH
Confidence            46899999999999999999999864


No 12 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=95.08  E-value=0.011  Score=35.64  Aligned_cols=26  Identities=23%  Similarity=0.253  Sum_probs=22.1

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      .+|+.+|.|++|.|+..|+.++|...
T Consensus        14 ~~F~~~D~d~~G~Is~~el~~~l~~~   39 (96)
T smart00027       14 QIFRSLDKNQDGTVTGAQAKPILLKS   39 (96)
T ss_pred             HHHHHhCCCCCCeEeHHHHHHHHHHc
Confidence            46888999999999999999998763


No 13 
>PTZ00184 calmodulin; Provisional
Probab=94.89  E-value=0.015  Score=34.95  Aligned_cols=26  Identities=15%  Similarity=0.437  Sum_probs=23.3

Q ss_pred             CCccccccCCCCCcccchhHHHHHHH
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ..+|+.||.|++|.|++.||.+++..
T Consensus        87 ~~~F~~~D~~~~g~i~~~e~~~~l~~  112 (149)
T PTZ00184         87 KEAFKVFDRDGNGFISAAELRHVMTN  112 (149)
T ss_pred             HHHHHhhCCCCCCeEeHHHHHHHHHH
Confidence            46799999999999999999998865


No 14 
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=94.69  E-value=0.015  Score=35.55  Aligned_cols=25  Identities=12%  Similarity=0.210  Sum_probs=22.9

Q ss_pred             Ccccccc-CCCCC-cccchhHHHHHHH
Q psy8741          32 ASFMEID-INNEG-WVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d-~~~~G-~Is~keF~kaMe~   56 (62)
                      ++|+.|| .|++| .|++.|++..|..
T Consensus        12 ~aF~~fD~~dgdG~~I~~~eL~~ll~~   38 (88)
T cd05027          12 DVFHQYSGREGDKHKLKKSELKELINN   38 (88)
T ss_pred             HHHHHhcccCCCcCEECHHHHHHHHHH
Confidence            5799998 89999 7999999999987


No 15 
>KOG0034|consensus
Probab=94.51  E-value=0.022  Score=39.83  Aligned_cols=24  Identities=17%  Similarity=0.528  Sum_probs=22.2

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ||+-||.|++|.|+|.|+...++.
T Consensus       109 aF~vYD~~~~G~I~reel~~iv~~  132 (187)
T KOG0034|consen  109 AFRVYDLDGDGFISREELKQILRM  132 (187)
T ss_pred             HHHHhcCCCCCcCcHHHHHHHHHH
Confidence            799999999999999999998864


No 16 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=94.38  E-value=0.019  Score=35.52  Aligned_cols=25  Identities=16%  Similarity=0.375  Sum_probs=20.5

Q ss_pred             CccccccC-CCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDI-NNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~-~~~G~Is~keF~kaMe~   56 (62)
                      .+|+.||. +++|.|+..|++..|.+
T Consensus        12 ~~F~~fd~~~~~g~i~~~ELk~ll~~   37 (89)
T cd05022          12 SNFHKASVKGGKESLTASEFQELLTQ   37 (89)
T ss_pred             HHHHHHhCCCCCCeECHHHHHHHHHH
Confidence            46888888 88888888888888876


No 17 
>KOG0034|consensus
Probab=94.21  E-value=0.025  Score=39.49  Aligned_cols=26  Identities=27%  Similarity=0.460  Sum_probs=24.2

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..|.|+|.|+||.||-.||.++++++
T Consensus       151 ~t~~e~D~d~DG~IsfeEf~~~v~~~  176 (187)
T KOG0034|consen  151 KTFEEADTDGDGKISFEEFCKVVEKQ  176 (187)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHcC
Confidence            46899999999999999999999987


No 18 
>PTZ00183 centrin; Provisional
Probab=94.08  E-value=0.031  Score=34.25  Aligned_cols=24  Identities=29%  Similarity=0.486  Sum_probs=20.4

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .|..+|++++|.|+..||..++..
T Consensus        22 ~F~~~D~~~~G~i~~~e~~~~l~~   45 (158)
T PTZ00183         22 AFDLFDTDGSGTIDPKELKVAMRS   45 (158)
T ss_pred             HHHHhCCCCCCcccHHHHHHHHHH
Confidence            467779999999999999988874


No 19 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=94.05  E-value=0.028  Score=32.89  Aligned_cols=25  Identities=20%  Similarity=0.263  Sum_probs=22.7

Q ss_pred             CccccccC--CCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDI--NNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~--~~~G~Is~keF~kaMe~   56 (62)
                      .+|+.||.  |++|.|+..+|..++..
T Consensus        12 ~~F~~~D~~~~~~G~Is~~el~~~l~~   38 (88)
T cd00213          12 DVFHKYSGKEGDKDTLSKKELKELLET   38 (88)
T ss_pred             HHHHHHhhccCCCCcCcHHHHHHHHHH
Confidence            47999999  89999999999999864


No 20 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=93.77  E-value=0.031  Score=34.05  Aligned_cols=26  Identities=12%  Similarity=0.216  Sum_probs=22.4

Q ss_pred             Ccccccc-CCCCC-cccchhHHHHHHHh
Q psy8741          32 ASFMEID-INNEG-WVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d-~~~~G-~Is~keF~kaMe~q   57 (62)
                      .+|+.|| .|++| -||+.|++..|..+
T Consensus        14 ~~F~~~dd~dgdg~~Is~~EL~~ll~~~   41 (93)
T cd05026          14 RIFHNYSGKEGDRYKLSKGELKELLQRE   41 (93)
T ss_pred             HHHHHHHccCCCCCEECHHHHHHHHHHH
Confidence            4689999 89999 59999999999763


No 21 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=93.71  E-value=0.031  Score=33.36  Aligned_cols=25  Identities=12%  Similarity=0.209  Sum_probs=22.3

Q ss_pred             Ccccccc-CCCCC-cccchhHHHHHHH
Q psy8741          32 ASFMEID-INNEG-WVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d-~~~~G-~Is~keF~kaMe~   56 (62)
                      ++|+.|| .|++| .|++.|+..+|..
T Consensus        13 ~~F~~fDd~dg~G~~Is~~El~~~l~~   39 (92)
T cd05025          13 NVFHAHSGKEGDKYKLSKKELKDLLQT   39 (92)
T ss_pred             HHHHHHhcccCCCCeECHHHHHHHHHH
Confidence            4799997 99999 5999999999975


No 22 
>KOG0044|consensus
Probab=93.61  E-value=0.048  Score=38.51  Aligned_cols=26  Identities=12%  Similarity=0.349  Sum_probs=22.7

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      =+|+-||.|++|.|++.|+-+.+.+.
T Consensus       104 w~F~lyD~dgdG~It~~Eml~iv~~i  129 (193)
T KOG0044|consen  104 WAFRLYDLDGDGYITKEEMLKIVQAI  129 (193)
T ss_pred             hhheeecCCCCceEcHHHHHHHHHHH
Confidence            35999999999999999999888764


No 23 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=93.40  E-value=0.036  Score=33.27  Aligned_cols=25  Identities=20%  Similarity=0.271  Sum_probs=22.0

Q ss_pred             CccccccC-CC-CCcccchhHHHHHHH
Q psy8741          32 ASFMEIDI-NN-EGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~-~~-~G~Is~keF~kaMe~   56 (62)
                      .+|+.||. |+ +|.|+..|+..+|.+
T Consensus        12 ~~F~~~D~~dg~dG~Is~~El~~~l~~   38 (94)
T cd05031          12 LTFHRYAGKDGDKNTLSRKELKKLMEK   38 (94)
T ss_pred             HHHHHHhccCCCCCeECHHHHHHHHHH
Confidence            47999996 97 699999999999875


No 24 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=93.19  E-value=0.046  Score=35.44  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=19.0

Q ss_pred             CccccccCCCCCcccchhHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEK   53 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~ka   53 (62)
                      -+|..+|.|+||.||+.|....
T Consensus        52 w~F~~lD~d~DG~Ls~~EL~~~   73 (116)
T cd00252          52 WMFNQLDGNYDGKLSHHELAPI   73 (116)
T ss_pred             HHHHHHCCCCCCcCCHHHHHHH
Confidence            4688999999999999998865


No 25 
>PTZ00184 calmodulin; Provisional
Probab=92.63  E-value=0.075  Score=31.93  Aligned_cols=24  Identities=21%  Similarity=0.378  Sum_probs=18.5

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .|+.+|+|++|.|+..||..++..
T Consensus        16 ~F~~~D~~~~G~i~~~e~~~~l~~   39 (149)
T PTZ00184         16 AFSLFDKDGDGTITTKELGTVMRS   39 (149)
T ss_pred             HHHHHcCCCCCcCCHHHHHHHHHH
Confidence            455568888899999888887754


No 26 
>KOG0027|consensus
Probab=92.33  E-value=0.072  Score=34.17  Aligned_cols=27  Identities=11%  Similarity=0.243  Sum_probs=22.8

Q ss_pred             CccccccCCCCCcccchhHHHHHHHhh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQK   58 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~qk   58 (62)
                      .+|+.+|.|++|.|+.+++..+|++--
T Consensus        12 ~~F~~fD~d~~G~i~~~el~~~lr~lg   38 (151)
T KOG0027|consen   12 EAFQLFDKDGDGKISVEELGAVLRSLG   38 (151)
T ss_pred             HHHHHHCCCCCCcccHHHHHHHHHHcC
Confidence            578889999999999999999887643


No 27 
>PTZ00183 centrin; Provisional
Probab=92.00  E-value=0.099  Score=32.03  Aligned_cols=26  Identities=19%  Similarity=0.257  Sum_probs=22.5

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..|+.+|.|++|.|+..||..++...
T Consensus        94 ~~F~~~D~~~~G~i~~~e~~~~l~~~  119 (158)
T PTZ00183         94 KAFRLFDDDKTGKISLKNLKRVAKEL  119 (158)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHHh
Confidence            45999999999999999999888753


No 28 
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13. S100A13 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A13 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100A13 is involved in the cellular export of interleukin-1 (IL-1) and of fibroblast growth factor-1 (FGF-1), which plays an important role in angiogenesis and tissue regeneration. Export is based on the CuII-dependent formation of multiprotein complexes containing the S100A13 protein. Assembly of these complexes occurs near the inner surface of the plasma membrane. Binding of two Ca(II) ions per monomer triggers key conformational changes leading to the creation of two identical and symmetrical Cu(II)-binding sites on the surface of the protein, close to the interface between the two monomers. These Cu
Probab=90.53  E-value=0.19  Score=31.07  Aligned_cols=25  Identities=16%  Similarity=0.326  Sum_probs=22.0

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ..+++.|.|+||.|+-.||...|..
T Consensus        51 ~mi~~~D~d~DG~I~F~EF~~l~~~   75 (89)
T cd05022          51 EKMKNLDVNQDSKLSFEEFWELIGE   75 (89)
T ss_pred             HHHHHhCCCCCCCCcHHHHHHHHHH
Confidence            4578899999999999999988864


No 29 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=90.15  E-value=0.16  Score=35.15  Aligned_cols=25  Identities=12%  Similarity=0.343  Sum_probs=22.9

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ++|+-+|+|++|.|++.|+...|++
T Consensus        24 eaF~l~D~d~~G~I~~~el~~ilr~   48 (160)
T COG5126          24 EAFQLFDRDSDGLIDRNELGKILRS   48 (160)
T ss_pred             HHHHHhCcCCCCCCcHHHHHHHHHH
Confidence            5789999999999999999999974


No 30 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=90.03  E-value=0.23  Score=29.90  Aligned_cols=27  Identities=19%  Similarity=0.295  Sum_probs=23.1

Q ss_pred             CCccccccCCCCCcccchhHHHHHHHh
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ...|+++|+|++|-|+.+||...|...
T Consensus        54 ~~i~~~~D~d~dG~I~f~eF~~~~~~~   80 (88)
T cd05030          54 DKIFEDLDTNQDGQLSFEEFLVLVIKV   80 (88)
T ss_pred             HHHHHHcCCCCCCcCcHHHHHHHHHHH
Confidence            346889999999999999999988653


No 31 
>KOG2643|consensus
Probab=89.13  E-value=0.26  Score=39.80  Aligned_cols=33  Identities=30%  Similarity=0.422  Sum_probs=27.9

Q ss_pred             hhccccCCCccccccCCCCCcccchhHHHHHHH
Q psy8741          24 KLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        24 KLkdltsS~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      +|.|=+-.-.|.-+|-|+||.+|++||.-.|.+
T Consensus       421 eLSdhVvdvvF~IFD~N~Dg~LS~~EFl~Vmk~  453 (489)
T KOG2643|consen  421 ELSDHVVDVVFTIFDENNDGTLSHKEFLAVMKR  453 (489)
T ss_pred             ccccceeeeEEEEEccCCCCcccHHHHHHHHHH
Confidence            455556677899999999999999999988875


No 32 
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1_like group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=88.54  E-value=0.33  Score=29.05  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=22.3

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..++++|+|++|-|+..||...|...
T Consensus        55 ~~~~~~D~~~dg~I~f~eF~~l~~~~   80 (94)
T cd05031          55 KIMKDLDQNRDGKVNFEEFVSLVAGL   80 (94)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHHH
Confidence            46788999999999999999888653


No 33 
>PF14658 EF-hand_9:  EF-hand domain
Probab=88.53  E-value=0.32  Score=29.57  Aligned_cols=23  Identities=26%  Similarity=0.283  Sum_probs=20.3

Q ss_pred             cccccCCCC-CcccchhHHHHHHH
Q psy8741          34 FMEIDINNE-GWVYPKDFKEKMEQ   56 (62)
Q Consensus        34 F~e~d~~~~-G~Is~keF~kaMe~   56 (62)
                      -.++||++. |-|+..+|+.+|..
T Consensus        41 ~~elDP~g~~~~v~~d~F~~iM~~   64 (66)
T PF14658_consen   41 INELDPEGRDGSVNFDTFLAIMRD   64 (66)
T ss_pred             HHHhCCCCCCceEeHHHHHHHHHH
Confidence            357899999 99999999999974


No 34 
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP). SPARC (BM-40) is a multifunctional glycoprotein, a matricellular protein, that functions to regulate cell-matrix interactions; binds to such proteins as collagen and vitronectin and binds to endothelial cells thus inhibiting cellular proliferation. The EC domain interacts with a follistatin-like (FS) domain which appears to stabilize Ca2+ binding. The two EF-hands interact canonically but their conserved disulfide bonds confer a tight association between the EF-hand pair and an acid/amphiphilic N-terminal helix. Proposed active form involves a Ca2+ dependent symmetric homodimerization of EC-FS modules.
Probab=88.20  E-value=0.26  Score=31.96  Aligned_cols=23  Identities=13%  Similarity=0.250  Sum_probs=20.1

Q ss_pred             CccccccCCCCCcccchhHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      .-|...|.|+||-||..||....
T Consensus        84 ~f~~~~D~n~Dg~IS~~Ef~~cl  106 (116)
T cd00252          84 PFFESCDLDKDGSISLDEWCYCF  106 (116)
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHH
Confidence            35778899999999999998876


No 35 
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z. S100Z is a member of the S100 domain family within the EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100Z group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately.S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control. S100Z is normally expressed in various tissues, with its highest level of expression being in spleen and leukocytes. The function of S100Z remains unclear. Preliminary structural data suggests that S100Z is homodimer, however a heterodimer with S100P has been reported. S100Z is capable of binding calcium ions. When calcium binds to S110Z,  the protein experiences a conformational change, which exposes hydrophobic surfac
Probab=87.90  E-value=0.4  Score=29.13  Aligned_cols=25  Identities=16%  Similarity=0.162  Sum_probs=21.9

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ..+++.|.|++|-|+-.||...|..
T Consensus        57 ~i~~elD~n~dG~Idf~EF~~l~~~   81 (93)
T cd05026          57 KIMNDLDSNKDNEVDFNEFVVLVAA   81 (93)
T ss_pred             HHHHHhCCCCCCCCCHHHHHHHHHH
Confidence            3588899999999999999998865


No 36 
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction. The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs.
Probab=87.56  E-value=0.4  Score=25.73  Aligned_cols=25  Identities=16%  Similarity=0.262  Sum_probs=21.5

Q ss_pred             CCccccccCCCCCcccchhHHHHHH
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      ...|+.+|+|++|-|+.+||...|.
T Consensus        36 ~~i~~~~d~~~~g~i~~~ef~~~~~   60 (67)
T cd00052          36 AQIWDLADTDKDGKLDKEEFAIAMH   60 (67)
T ss_pred             HHHHHHhcCCCCCcCCHHHHHHHHH
Confidence            3458889999999999999998875


No 37 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=87.16  E-value=0.46  Score=29.05  Aligned_cols=25  Identities=16%  Similarity=0.332  Sum_probs=21.6

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ..+++.|.|+||-|+-.||-..|..
T Consensus        56 ~ll~~~D~d~DG~I~f~EF~~l~~~   80 (89)
T cd05023          56 RMMKKLDLNSDGQLDFQEFLNLIGG   80 (89)
T ss_pred             HHHHHcCCCCCCcCcHHHHHHHHHH
Confidence            3588999999999999999987754


No 38 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=86.70  E-value=0.36  Score=29.44  Aligned_cols=24  Identities=17%  Similarity=0.243  Sum_probs=20.4

Q ss_pred             ccccccC-CC-CCcccchhHHHHHHH
Q psy8741          33 SFMEIDI-NN-EGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~-~~-~G~Is~keF~kaMe~   56 (62)
                      .|.-||- |+ +|.|+..||.+.|..
T Consensus        15 ~F~~y~~~~~~~g~Is~~EL~~~l~~   40 (88)
T cd05029          15 IFHKYSGREGDKNTLSKKELKELIQK   40 (88)
T ss_pred             HHHHHHccCCCCCEECHHHHHHHHHH
Confidence            4778887 67 999999999999963


No 39 
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=86.23  E-value=0.54  Score=27.94  Aligned_cols=26  Identities=23%  Similarity=0.229  Sum_probs=22.9

Q ss_pred             CccccccCCCCCcccchhHHHHHHHh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..|+++|+|++|-|+-.+|...|...
T Consensus        56 ~i~~~~D~d~~G~I~f~eF~~l~~~~   81 (92)
T cd05025          56 KIMKELDENGDGEVDFQEFVVLVAAL   81 (92)
T ss_pred             HHHHHHCCCCCCcCcHHHHHHHHHHH
Confidence            56888999999999999999888754


No 40 
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6. S100A6 is a member of the S100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A6 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100A6 is normally expressed in the G1 phase of the cell cycle in neuronal cells. The function of S100A6 remains unclear, but evidence suggests that it is involved in cell cycle regulation and exocytosis. S100A6 may also be involved in tumorigenesis; the protein is overexpressed in several tumors. Ca2+ binding to S100A6 leads to a conformational change in the protein, which exposes a hydrophobic surface for interact
Probab=84.97  E-value=0.37  Score=29.34  Aligned_cols=26  Identities=12%  Similarity=0.138  Sum_probs=21.7

Q ss_pred             CCCccccccCCCCCcccchhHHHHHH
Q psy8741          30 SSASFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        30 sS~~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      -...+++.|.|++|-|+..||...|.
T Consensus        53 v~~m~~~~D~d~dG~Idf~EFv~lm~   78 (88)
T cd05029          53 IAKLMEDLDRNKDQEVNFQEYVTFLG   78 (88)
T ss_pred             HHHHHHHhcCCCCCCCcHHHHHHHHH
Confidence            34458899999999999999987764


No 41 
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]
Probab=84.36  E-value=0.52  Score=32.61  Aligned_cols=23  Identities=13%  Similarity=0.446  Sum_probs=19.2

Q ss_pred             CccccccCCCCCcccchhHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      .||+.||.|++|.||..+....+
T Consensus        96 ~aF~~fD~d~dG~Is~~eL~~vl  118 (160)
T COG5126          96 EAFKLFDKDHDGYISIGELRRVL  118 (160)
T ss_pred             HHHHHhCCCCCceecHHHHHHHH
Confidence            47999999999999988887665


No 42 
>PLN02964 phosphatidylserine decarboxylase
Probab=83.92  E-value=0.53  Score=38.56  Aligned_cols=27  Identities=22%  Similarity=0.332  Sum_probs=23.9

Q ss_pred             CCccccccCCCCCcccchhHHHHHHHh
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ..+|+.+|.|++|.|+..||...|..+
T Consensus       218 ~eaFk~fDkDgdG~Is~dEL~~vL~~~  244 (644)
T PLN02964        218 EELFKAADLNGDGVVTIDELAALLALQ  244 (644)
T ss_pred             HHHHHHhCCCCCCcCCHHHHHHHHHhc
Confidence            358999999999999999999998874


No 43 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=83.79  E-value=0.63  Score=35.73  Aligned_cols=23  Identities=22%  Similarity=0.609  Sum_probs=12.1

Q ss_pred             ccccccCCCCCcccchhHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      .|..+|.|+||-|+..||+..+.
T Consensus       362 ~F~~~D~d~DG~Is~eEf~~~~~  384 (391)
T PRK12309        362 VFDALDLNHDGKITPEEMRAGLG  384 (391)
T ss_pred             HHHHhCCCCCCCCcHHHHHHHHH
Confidence            45555555555555555555443


No 44 
>KOG0028|consensus
Probab=83.65  E-value=0.69  Score=33.03  Aligned_cols=24  Identities=17%  Similarity=0.299  Sum_probs=21.4

Q ss_pred             CccccccCCCCCcccchhHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      -+|+++|-|++|.||+++|...|.
T Consensus       110 ~afrl~D~D~~Gkis~~~lkrvak  133 (172)
T KOG0028|consen  110 KAFRLFDDDKTGKISQRNLKRVAK  133 (172)
T ss_pred             HHHHcccccCCCCcCHHHHHHHHH
Confidence            479999999999999999988764


No 45 
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional
Probab=83.23  E-value=0.83  Score=35.09  Aligned_cols=37  Identities=16%  Similarity=0.367  Sum_probs=27.7

Q ss_pred             HHHHHHHHHhhccccC----------------CCccccccCCCCCcccchhHH
Q psy8741          15 ILKYFDMFLKLKDLTS----------------SASFMEIDINNEGWVYPKDFK   51 (62)
Q Consensus        15 ilkffdmflKLkdlts----------------S~~F~e~d~~~~G~Is~keF~   51 (62)
                      |=+|.+.--||..+..                -.+|+-||.|++|.|++.||.
T Consensus       305 i~~F~~d~~~L~~~i~~~~~~~~~~~~~~~~l~~aF~~~D~dgdG~Is~~E~~  357 (391)
T PRK12309        305 IKGFSKALETLEKLLAHRLARLEGGEAFTHAAQEIFRLYDLDGDGFITREEWL  357 (391)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhccChhhHHHHHHHHHhCCCCCCcCcHHHHH
Confidence            4556666666555433                357899999999999999996


No 46 
>smart00027 EH Eps15 homology domain. Pair of EF hand motifs that recognise proteins containing Asn-Pro-Phe (NPF) sequences.
Probab=83.23  E-value=0.94  Score=27.08  Aligned_cols=28  Identities=21%  Similarity=0.231  Sum_probs=23.9

Q ss_pred             CccccccCCCCCcccchhHHHHHHHhhh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQKS   59 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~qk~   59 (62)
                      ..|+.+|++++|-|+..||..+|.....
T Consensus        48 ~i~~~~d~~~~g~I~~~eF~~~~~~~~~   75 (96)
T smart00027       48 KIWNLADIDNDGELDKDEFALAMHLIYR   75 (96)
T ss_pred             HHHHHhcCCCCCCcCHHHHHHHHHHHHH
Confidence            5678899999999999999999876543


No 47 
>KOG2643|consensus
Probab=82.08  E-value=0.97  Score=36.58  Aligned_cols=39  Identities=18%  Similarity=0.367  Sum_probs=30.7

Q ss_pred             HHHHHHHHhhccccCCC-----ccccccCCCCCcccchhHHHHH
Q psy8741          16 LKYFDMFLKLKDLTSSA-----SFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        16 lkffdmflKLkdltsS~-----~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      ++|-|-.+=+-=|+.|+     ||+-+|.|++|-|.+.||.+.+
T Consensus       216 IsfSdYiFLlTlLS~p~~~F~IAFKMFD~dgnG~IdkeEF~~v~  259 (489)
T KOG2643|consen  216 ISFSDYIFLLTLLSIPERNFRIAFKMFDLDGNGEIDKEEFETVQ  259 (489)
T ss_pred             eeHHHHHHHHHHHccCcccceeeeeeeecCCCCcccHHHHHHHH
Confidence            45556555555667776     7999999999999999998765


No 48 
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 . Note that the S-100 hierarchy, to which this Calgranulin group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. These proteins are expressed mainly in granulocytes, and are involved in inflammation, allergy, and neuritogenesis, as well as in host-parasite response. Calgranulins are modulated not only by calcium, but also by other metals such as zinc and copper. Structural data suggested that calgranulins may exist in  multiple structural forms, homodimers, as well as hetero-oligomers. For example, the S100A8/S100A9 complex called calprotectin plays important roles in the regulation of inflammatory processes, wound repair, and regulating zinc-dependent enzymes as well as microbial growth.
Probab=82.02  E-value=0.93  Score=27.22  Aligned_cols=25  Identities=24%  Similarity=0.507  Sum_probs=20.8

Q ss_pred             CccccccCC--CCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDIN--NEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~--~~G~Is~keF~kaMe~   56 (62)
                      .-|++|+.+  ++|.|++.||...|..
T Consensus        12 ~~f~~y~~~~~~~~~Is~~El~~ll~~   38 (88)
T cd05030          12 NVFHQYSVRKGHPDTLYKKEFKQLVEK   38 (88)
T ss_pred             HHHHHHhccCCCcccCCHHHHHHHHHH
Confidence            358899966  5899999999999963


No 49 
>KOG0044|consensus
Probab=78.37  E-value=1.3  Score=31.33  Aligned_cols=27  Identities=22%  Similarity=0.364  Sum_probs=23.0

Q ss_pred             CccccccCCCCCcccchhHHHHHHHhh
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQQK   58 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~qk   58 (62)
                      .-|+..|.|.||.||-+||..+..+.+
T Consensus       151 ~if~k~D~n~Dg~lT~eef~~~~~~d~  177 (193)
T KOG0044|consen  151 KIFSKMDKNKDGKLTLEEFIEGCKADP  177 (193)
T ss_pred             HHHHHcCCCCCCcccHHHHHHHhhhCH
Confidence            358889999999999999998876643


No 50 
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11. S100A11 is a member of the S-100 domain family within EF-hand Ca2+-binding proteins superfamily. Note that the S-100 hierarchy, to which this S-100A11 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins exhibit unique patterns of tissue- and cell type-specific expression and have been implicated in the Ca2+-dependent regulation of diverse physiological processes, including cell cycle regulation, differentiation, growth, and metabolic control . S100 proteins have also been associated with a variety of pathological events, including neoplastic transformation and neurodegenerative diseases such as Alzheimer's, usually via over expression of the protein. S100A11 is expressed in smooth muscle and other tissues and involves in calcium-dependent membrane aggregation, which is important for cell vesiculation . As is the case for many other S100 proteins, S
Probab=75.98  E-value=1.8  Score=26.48  Aligned_cols=25  Identities=12%  Similarity=0.231  Sum_probs=20.3

Q ss_pred             cccc-ccCCCCC-cccchhHHHHHHHh
Q psy8741          33 SFME-IDINNEG-WVYPKDFKEKMEQQ   57 (62)
Q Consensus        33 ~F~e-~d~~~~G-~Is~keF~kaMe~q   57 (62)
                      +|+. .|.+++| -||+.||+..|...
T Consensus        14 ~F~~y~~~dg~~~~Ls~~Elk~ll~~e   40 (89)
T cd05023          14 VFQKYAGKDGDSYQLSKTEFLSFMNTE   40 (89)
T ss_pred             HHHHHhccCCCcCeECHHHHHHHHHHh
Confidence            5667 4577876 99999999999875


No 51 
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B. S100B is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100B group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100B is most abundant in glial cells of the central nervous system, predominately in astrocytes. S100B is involved in signal transduction via the inhibition of protein phoshorylation, regulation of enzyme activity and by affecting the calcium homeostasis. Upon calcium binding the S100B homodimer changes conformation to expose a hydrophobic cleft, which represents the interaction site of S100B with its more than 20 known target  proteins. These target proteins include several cellular architecture proteins such as tubulin and GFAP; S100B can inhibit polymerization of these oligomeric molecules. Furthermore, S100B i
Probab=74.85  E-value=2.4  Score=25.77  Aligned_cols=25  Identities=12%  Similarity=0.161  Sum_probs=21.3

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ..+++.|+|++|-|+-.||...|..
T Consensus        55 ~~i~~~D~n~dG~v~f~eF~~li~~   79 (88)
T cd05027          55 KVMETLDSDGDGECDFQEFMAFVAM   79 (88)
T ss_pred             HHHHHhCCCCCCcCcHHHHHHHHHH
Confidence            4577889999999999999887754


No 52 
>KOG0038|consensus
Probab=69.74  E-value=4.8  Score=29.09  Aligned_cols=39  Identities=18%  Similarity=0.473  Sum_probs=30.6

Q ss_pred             HHHHHHHhhcc-----ccCCCccccccCCCCCcccchhHHHHHH
Q psy8741          17 KYFDMFLKLKD-----LTSSASFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        17 kffdmflKLkd-----ltsS~~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      .|.|||--++.     |-.--||+-||-|+|+.|-+.|..+-+.
T Consensus        92 dFlDmfSV~sE~APrdlK~~YAFkIYDfd~D~~i~~~DL~~~l~  135 (189)
T KOG0038|consen   92 DFLDMFSVFSEMAPRDLKAKYAFKIYDFDGDEFIGHDDLEKTLT  135 (189)
T ss_pred             HHHHHHHHHHhhChHHhhhhheeEEeecCCCCcccHHHHHHHHH
Confidence            46778776654     4455699999999999999999877654


No 53 
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. Intracellularly, S100 proteins act as Ca-signaling or Ca-buffering proteins. The most unusual characteristic of certain S100 proteins is their occurrence in extracellular space, where they act in a cytokine-like manner through RAGE, the receptor for advanced glycation products. Structural data suggest that many S100 members exist within cells as homo- or heterodimers and even oligomers; oligomerization contributes to their functional diversification. Upon binding calcium, most S100 proteins change conformation to a more open structure exposing a hydrophobic cleft. This hydrophobic surface represents th
Probab=69.37  E-value=3.9  Score=23.67  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=20.7

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .+.++|.|++|-|+-.+|...|..
T Consensus        56 i~~~~d~~~~g~I~f~eF~~~~~~   79 (88)
T cd00213          56 IMKDLDVNKDGKVDFQEFLVLIGK   79 (88)
T ss_pred             HHHHhccCCCCcCcHHHHHHHHHH
Confidence            577889999999999999887764


No 54 
>KOG0037|consensus
Probab=67.49  E-value=3.9  Score=30.08  Aligned_cols=24  Identities=17%  Similarity=0.369  Sum_probs=21.6

Q ss_pred             ccccccCCCCCcccchhHHHHHHH
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      -|+.||.|+-|-|++.|++.|..+
T Consensus       129 vF~~~D~D~SG~I~~sEL~~Al~~  152 (221)
T KOG0037|consen  129 VFRTYDRDRSGTIDSSELRQALTQ  152 (221)
T ss_pred             HHHhcccCCCCcccHHHHHHHHHH
Confidence            488899999999999999999864


No 55 
>PF12763 EF-hand_4:  Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A ....
Probab=60.83  E-value=5.6  Score=25.30  Aligned_cols=20  Identities=30%  Similarity=0.425  Sum_probs=17.0

Q ss_pred             ccCCCCCcccchhHHHHHHH
Q psy8741          37 IDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        37 ~d~~~~G~Is~keF~kaMe~   56 (62)
                      -|.|++|.++..||--||.-
T Consensus        52 aD~~~dG~L~~~EF~iAm~L   71 (104)
T PF12763_consen   52 ADIDNDGKLDFEEFAIAMHL   71 (104)
T ss_dssp             H-SSSSSEEEHHHHHHHHHH
T ss_pred             hcCCCCCcCCHHHHHHHHHH
Confidence            46999999999999999863


No 56 
>PLN02964 phosphatidylserine decarboxylase
Probab=58.86  E-value=5  Score=33.05  Aligned_cols=26  Identities=12%  Similarity=0.295  Sum_probs=22.8

Q ss_pred             CCccccccCCCCCcccchhHHHHHHH
Q psy8741          31 SASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        31 S~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ...|.++|.|++|.|+.+||...|..
T Consensus       182 ~~mf~~~D~DgdG~IdfdEFl~lL~~  207 (644)
T PLN02964        182 RRILAIVDYDEDGQLSFSEFSDLIKA  207 (644)
T ss_pred             HHHHHHhCCCCCCeEcHHHHHHHHHH
Confidence            35688999999999999999998874


No 57 
>PF10591 SPARC_Ca_bdg:  Secreted protein acidic and rich in cysteine Ca binding region;  InterPro: IPR019577  This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins. SPARC proteins are down-regulated in various tumours and may have a tumour-suppressor function [, ]. Testican-3 appears to be a novel regulator that reduces the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL) []. This cysteine-rich domain is responsible for the anti-spreading activity of human urothelial cells. This extracellular calcium-binding domain is rich in alpha-helices and contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2 []. ; GO: 0005509 calcium ion binding, 0007165 signal transduction, 0005578 proteinaceous extracellular matrix; PDB: 1BMO_A 1SRA_A 2V53_A 1NUB_B.
Probab=57.95  E-value=2.9  Score=26.63  Aligned_cols=41  Identities=17%  Similarity=0.170  Sum_probs=23.4

Q ss_pred             hHHHHHHHHHHHHhhccccCCCccccccCCCCCcccchhHH
Q psy8741          11 NVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFK   51 (62)
Q Consensus        11 nve~ilkffdmflKLkdltsS~~F~e~d~~~~G~Is~keF~   51 (62)
                      .+++..+.....-..+.-+..-.|...|.|+||.++++|..
T Consensus        37 ~~~~~~~~~~~~~~~~~~~~~W~F~~LD~n~d~~L~~~El~   77 (113)
T PF10591_consen   37 YIELLKRDESSSYSECKRVVHWKFCQLDRNKDGVLDRSELK   77 (113)
T ss_dssp             -HHHHHHHHHHTGGGGHHHHHHHHHHH--T-SSEE-TTTTG
T ss_pred             cccccccccccchhhhhhhhhhhHhhhcCCCCCccCHHHHH
Confidence            34445555555555555555556888999999999998853


No 58 
>PF05042 Caleosin:  Caleosin related protein;  InterPro: IPR007736 This family contains plant proteins related to caleosin. Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies []. The calcium binding domain is probably related to the calcium-binding EF-hands motif IPR002048 from INTERPRO.
Probab=57.51  E-value=5  Score=28.52  Aligned_cols=14  Identities=36%  Similarity=0.745  Sum_probs=12.3

Q ss_pred             ccCCCCCcccchhH
Q psy8741          37 IDINNEGWVYPKDF   50 (62)
Q Consensus        37 ~d~~~~G~Is~keF   50 (62)
                      ||.|+||+|.|-|=
T Consensus        16 FDrd~DGiI~P~dT   29 (174)
T PF05042_consen   16 FDRDKDGIIYPWDT   29 (174)
T ss_pred             eCCCCCeeECHHHH
Confidence            79999999999763


No 59 
>KOG0031|consensus
Probab=52.45  E-value=9.6  Score=27.29  Aligned_cols=24  Identities=17%  Similarity=0.268  Sum_probs=21.1

Q ss_pred             CccccccCCCCCcccchhHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe   55 (62)
                      .||+.+|++++|.|-.+.+++..-
T Consensus       105 ~AF~~FD~~~~G~I~~d~lre~Lt  128 (171)
T KOG0031|consen  105 NAFKTFDDEGSGKIDEDYLRELLT  128 (171)
T ss_pred             HHHHhcCccCCCccCHHHHHHHHH
Confidence            489999999999999999887654


No 60 
>PF09851 SHOCT:  Short C-terminal domain;  InterPro: IPR018649  This family of hypothetical prokaryotic proteins has no known function. 
Probab=49.52  E-value=15  Score=18.78  Aligned_cols=14  Identities=14%  Similarity=0.427  Sum_probs=11.8

Q ss_pred             CCcccchhHHHHHH
Q psy8741          42 EGWVYPKDFKEKME   55 (62)
Q Consensus        42 ~G~Is~keF~kaMe   55 (62)
                      .|.||..||.++-.
T Consensus        14 ~G~IseeEy~~~k~   27 (31)
T PF09851_consen   14 KGEISEEEYEQKKA   27 (31)
T ss_pred             cCCCCHHHHHHHHH
Confidence            69999999998643


No 61 
>PF15603 Imm45:  Immunity protein 45
Probab=49.21  E-value=17  Score=22.79  Aligned_cols=33  Identities=12%  Similarity=0.124  Sum_probs=25.9

Q ss_pred             ccCCCccccccCCCCCc-ccchhHHHHHHHhhhc
Q psy8741          28 LTSSASFMEIDINNEGW-VYPKDFKEKMEQQKSY   60 (62)
Q Consensus        28 ltsS~~F~e~d~~~~G~-Is~keF~kaMe~qk~y   60 (62)
                      ++=-.+=+.|||+.++. |+..|=|+.+++=..|
T Consensus        38 vvy~~si~~We~P~e~~~it~~e~q~II~aI~~~   71 (82)
T PF15603_consen   38 VVYKDSIKNWEPPHENEPITIAERQKIIEAIEKY   71 (82)
T ss_pred             EEEccccccccCCCCCcccCHHHHHHHHHHHHHH
Confidence            33445668899999995 9999999999875543


No 62 
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=48.04  E-value=11  Score=24.08  Aligned_cols=17  Identities=35%  Similarity=0.812  Sum_probs=12.7

Q ss_pred             cccCCCCCcccchhHHH
Q psy8741          36 EIDINNEGWVYPKDFKE   52 (62)
Q Consensus        36 e~d~~~~G~Is~keF~k   52 (62)
                      +=|.|+.|||+|....+
T Consensus        67 ~~ddD~gGWITPsNIkq   83 (87)
T PF15017_consen   67 EEDDDGGGWITPSNIKQ   83 (87)
T ss_pred             cccCCCCccccchhhhh
Confidence            34588999999976543


No 63 
>KOG4251|consensus
Probab=47.74  E-value=13  Score=29.04  Aligned_cols=21  Identities=24%  Similarity=0.447  Sum_probs=13.2

Q ss_pred             CccccccCCCCCcccchhHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKE   52 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~k   52 (62)
                      .-|+..|||+||-||-.||.-
T Consensus       144 thFraVDpdgDGhvsWdEykv  164 (362)
T KOG4251|consen  144 THFRAVDPDGDGHVSWDEYKV  164 (362)
T ss_pred             hheeeeCCCCCCceehhhhhh
Confidence            346666667777666666653


No 64 
>KOG4251|consensus
Probab=45.91  E-value=11  Score=29.50  Aligned_cols=18  Identities=22%  Similarity=0.569  Sum_probs=15.3

Q ss_pred             cccccCCCCCcccchhHH
Q psy8741          34 FMEIDINNEGWVYPKDFK   51 (62)
Q Consensus        34 F~e~d~~~~G~Is~keF~   51 (62)
                      |...|.|-||-||-+|-|
T Consensus       107 FsKvDVNtDrkisAkEmq  124 (362)
T KOG4251|consen  107 FSKVDVNTDRKISAKEMQ  124 (362)
T ss_pred             HhhcccCccccccHHHHH
Confidence            777899999999988864


No 65 
>KOG0377|consensus
Probab=45.62  E-value=12  Score=31.07  Aligned_cols=23  Identities=26%  Similarity=0.413  Sum_probs=19.8

Q ss_pred             cccccCCCCCcccchhHHHHHHH
Q psy8741          34 FMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        34 F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      |+-+|.|+.|.||-+||..+.+-
T Consensus       553 F~~iD~D~SG~isldEF~~a~~l  575 (631)
T KOG0377|consen  553 FNIIDADNSGEISLDEFRTAWKL  575 (631)
T ss_pred             HHHhccCCCCceeHHHHHHHHHH
Confidence            56688999999999999988763


No 66 
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10. S100A10 is a member of the S100 family of EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A10 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are expressed exclusively in vertebrates, and are implicated in intracellular and extracellular regulatory activities. A unique feature of S100A10 is that it contains mutation in both of the calcium binding sites, making it calcium insensitive. S100A10 has been detected in brain, heart, gastrointestinal tract, kidney, liver, lung, spleen, testes, epidermis, aorta, and thymus. Structural data supports the homo- and hetero-dimeric as well as hetero-tetrameric nature of the protein. S100A10 has multiple binding partners in its calcium free state and is therefore involved in many diverse biological functions.
Probab=45.04  E-value=17  Score=23.10  Aligned_cols=24  Identities=17%  Similarity=0.480  Sum_probs=18.5

Q ss_pred             ccccccCCCCCcccchhHHHHHHHh
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      .|+.|. -.+|-+|++||++-|+.+
T Consensus        13 ~FhkYa-G~~~tLsk~Elk~Ll~~E   36 (91)
T cd05024          13 TFHKFA-GEKNYLNRDDLQKLMEKE   36 (91)
T ss_pred             HHHHHc-CCCCcCCHHHHHHHHHHH
Confidence            456666 346799999999999875


No 67 
>KOG0751|consensus
Probab=44.30  E-value=8.1  Score=32.45  Aligned_cols=38  Identities=18%  Similarity=0.308  Sum_probs=29.2

Q ss_pred             HHHHhhccccCCCccccccCCCCCcccchhHHHHHHHh
Q psy8741          20 DMFLKLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        20 dmflKLkdltsS~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      -.+.+.-.=-+-++|+++|+.+.|.||.=+||..|-.-
T Consensus       171 Q~lh~~~~E~~~qafr~~d~~~ng~is~Ldfq~imvt~  208 (694)
T KOG0751|consen  171 QFLHEFQLEHAEQAFREKDKAKNGFISVLDFQDIMVTI  208 (694)
T ss_pred             HHHHHHHHHHHHHHHHHhcccCCCeeeeechHhhhhhh
Confidence            33444443446789999999999999999999988543


No 68 
>KOG4223|consensus
Probab=44.04  E-value=7.6  Score=30.04  Aligned_cols=33  Identities=21%  Similarity=0.430  Sum_probs=26.4

Q ss_pred             hccccCCCccccccCCCCCcccchhHHHHHHHh
Q psy8741          25 LKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        25 LkdltsS~~F~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      +++++=-+.-.+.|.|+||-|+-+||..-|.++
T Consensus       197 M~~iVi~Etl~d~Dkn~DG~I~~eEfigd~~~~  229 (325)
T KOG4223|consen  197 MKDIVIAETLEDIDKNGDGKISLEEFIGDLYSH  229 (325)
T ss_pred             HHHHHHHHHHhhcccCCCCceeHHHHHhHHhhc
Confidence            455555566778999999999999999888664


No 69 
>PHA02152 hypothetical protein
Probab=43.83  E-value=14  Score=24.24  Aligned_cols=14  Identities=36%  Similarity=0.890  Sum_probs=12.2

Q ss_pred             CCCCcccchhHHHH
Q psy8741          40 NNEGWVYPKDFKEK   53 (62)
Q Consensus        40 ~~~G~Is~keF~ka   53 (62)
                      -+-|||||.+.|+|
T Consensus        22 gnhgwisp~~i~~a   35 (96)
T PHA02152         22 GNHGWVSPSNIRYA   35 (96)
T ss_pred             cccCccChhHHHHH
Confidence            46799999999987


No 70 
>KOG0041|consensus
Probab=42.48  E-value=15  Score=27.63  Aligned_cols=25  Identities=24%  Similarity=0.489  Sum_probs=22.0

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      .-|+-||.+.||.|+--|...-||-
T Consensus       103 ~~Fk~yDe~rDgfIdl~ELK~mmEK  127 (244)
T KOG0041|consen  103 SMFKQYDEDRDGFIDLMELKRMMEK  127 (244)
T ss_pred             HHHHHhcccccccccHHHHHHHHHH
Confidence            3588999999999999999998884


No 71 
>PF09693 Phage_XkdX:  Phage uncharacterised protein (Phage_XkdX);  InterPro: IPR010022 This entry is represented by Bacteriophage 69, Orf86. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry identifies a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes.
Probab=41.54  E-value=15  Score=19.84  Aligned_cols=12  Identities=33%  Similarity=0.974  Sum_probs=10.3

Q ss_pred             CCcccchhHHHH
Q psy8741          42 EGWVYPKDFKEK   53 (62)
Q Consensus        42 ~G~Is~keF~ka   53 (62)
                      -||||+.+|++.
T Consensus        24 ~g~IT~eey~eI   35 (40)
T PF09693_consen   24 AGWITKEEYKEI   35 (40)
T ss_pred             cCeECHHHHHHh
Confidence            589999999875


No 72 
>PF03986 Autophagy_N:  Autophagocytosis associated protein (Atg3), N-terminal domain ;  InterPro: IPR007134 Proteins in this entry belong to the Atg3 group of proteins and the Atg3 conjugation enzymes. Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. Atg3 is the E2 enzyme for the LC3 lipidation process []. It is essential for autophagocytosis. The super protein complex, the Atg16L complex, consists of multiple Atg12-Atg5 conjugates. Atg16L has an E3-like role in the LC3 lipidation reaction. The activated intermediate, LC3-Atg3 (E2), is recruited to the site where the lipidation takes place [].  Atg3 catalyses the conjugation of Atg8 and phosphatidylethanolamine (PE). Atg3 has an alpha/beta-fold, and its core region is topologically similar to canonical E2 enzymes. Atg3 has two regions inserted in the core region and another with a long alpha-helical structure that protrudes from the core region as far as 30 A []. It interacts with atg8 through an intermediate thioester bond between Cys-288 and the C-terminal Gly of atg8. It also interacts with the C-terminal region of the E1-like atg7 enzyme. Autophagocytosis is a starvation-induced process responsible for transport of cytoplasmic proteins to the lysosome/vacuole. Atg3 is a ubiquitin like modifier that is topologically similar to the canonical E2 enzyme []. It catalyses the conjugation of Atg8 and phosphatidylethanolamine []. This domain is the N-terminal of Atg3 while the C-terminal is represented by IPR007135 from INTERPRO.; PDB: 3T7G_C 2DYT_A.
Probab=40.64  E-value=14  Score=25.07  Aligned_cols=12  Identities=25%  Similarity=0.598  Sum_probs=8.1

Q ss_pred             CCcccchhHHHH
Q psy8741          42 EGWVYPKDFKEK   53 (62)
Q Consensus        42 ~G~Is~keF~ka   53 (62)
                      .|.|||.||-.|
T Consensus        25 tG~iTPeEFV~A   36 (145)
T PF03986_consen   25 TGVITPEEFVAA   36 (145)
T ss_dssp             HS---HHHHHHH
T ss_pred             cceeCHHHHHHh
Confidence            699999999887


No 73 
>PF09336 Vps4_C:  Vps4 C terminal oligomerisation domain;  InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerisation []. ; PDB: 1XWI_A 3EIH_C 2QPA_C 3EIE_A 2RKO_A 2QP9_X 3MHV_C 3CF3_C 3CF1_A 3CF2_A ....
Probab=37.63  E-value=22  Score=20.65  Aligned_cols=15  Identities=27%  Similarity=0.408  Sum_probs=12.6

Q ss_pred             cccchhHHHHHHHhh
Q psy8741          44 WVYPKDFKEKMEQQK   58 (62)
Q Consensus        44 ~Is~keF~kaMe~qk   58 (62)
                      -|+++||..|+...+
T Consensus        29 ~it~~DF~~Al~~~k   43 (62)
T PF09336_consen   29 PITMEDFEEALKKVK   43 (62)
T ss_dssp             HBCHHHHHHHHHTCG
T ss_pred             CCCHHHHHHHHHHcC
Confidence            489999999998754


No 74 
>PF13724 DNA_binding_2:  DNA-binding domain
Probab=37.29  E-value=16  Score=21.34  Aligned_cols=11  Identities=45%  Similarity=0.797  Sum_probs=9.0

Q ss_pred             HHhhccccCCC
Q psy8741          22 FLKLKDLTSSA   32 (62)
Q Consensus        22 flKLkdltsS~   32 (62)
                      |-|||||..+-
T Consensus        17 FYKLkDM~k~r   27 (49)
T PF13724_consen   17 FYKLKDMSKPR   27 (49)
T ss_pred             HHHHhhcccCC
Confidence            89999998553


No 75 
>PF10552 ORF6C:  ORF6C domain;  InterPro: IPR018878  This entry represents the carboxy-terminal domain from ORF6 (Q9B012 from SWISSPROT), an antirepressor protein from Lactococcus phage bIL285 []. 
Probab=37.18  E-value=20  Score=22.61  Aligned_cols=28  Identities=21%  Similarity=0.321  Sum_probs=23.5

Q ss_pred             ccccCCCCCcccchhHHHHHHHhhhcCC
Q psy8741          35 MEIDINNEGWVYPKDFKEKMEQQKSYTP   62 (62)
Q Consensus        35 ~e~d~~~~G~Is~keF~kaMe~qk~ys~   62 (62)
                      ++++.+.-..|-+++|.+||+.=+.|.|
T Consensus        80 ~~F~V~sY~~I~~kdfd~A~~~I~~W~p  107 (116)
T PF10552_consen   80 RHFGVPSYKDIPRKDFDEALEFINNWEP  107 (116)
T ss_pred             HHhCCchHHhhhHHHHHHHHHHHHHcCC
Confidence            4567788888999999999998887765


No 76 
>KOG4065|consensus
Probab=34.56  E-value=23  Score=24.72  Aligned_cols=19  Identities=21%  Similarity=0.354  Sum_probs=16.3

Q ss_pred             ccccCCCCCcccchhHHHH
Q psy8741          35 MEIDINNEGWVYPKDFKEK   53 (62)
Q Consensus        35 ~e~d~~~~G~Is~keF~ka   53 (62)
                      ++-|-|+||.|-.-||.|+
T Consensus       124 ~DdDfN~DG~IDYgEflK~  142 (144)
T KOG4065|consen  124 DDDDFNGDGVIDYGEFLKR  142 (144)
T ss_pred             cccccCCCceeeHHHHHhh
Confidence            3557899999999999886


No 77 
>PF06014 DUF910:  Bacterial protein of unknown function (DUF910);  InterPro: IPR009256 This family consists of several short bacterial proteins of unknown function.; PDB: 2NN4_A.
Probab=33.40  E-value=26  Score=21.17  Aligned_cols=38  Identities=21%  Similarity=0.360  Sum_probs=20.7

Q ss_pred             hHHHHHHHHHHHHhhccccCCCcccccc----------CCCCCcccchhHHHHHH
Q psy8741          11 NVELILKYFDMFLKLKDLTSSASFMEID----------INNEGWVYPKDFKEKME   55 (62)
Q Consensus        11 nve~ilkffdmflKLkdltsS~~F~e~d----------~~~~G~Is~keF~kaMe   55 (62)
                      .|+-.||-|..|+-..|       +.||          .-.-|+|++++|.+|+-
T Consensus         6 DVqQLLK~fG~~IY~gd-------r~~DielM~~El~~Ly~~~lidk~~y~~A~l   53 (62)
T PF06014_consen    6 DVQQLLKKFGIIIYVGD-------RLWDIELMEIELKELYKSGLIDKKEYLTAKL   53 (62)
T ss_dssp             HHHHHHHTTS-----S--------HHHHHHHHHHHHHHHHHTTSS-HHHHHHHHH
T ss_pred             HHHHHHHHCCEEEEeCC-------hHHHHHHHHHHHHHHHHcCCCCHHHHHHHHH
Confidence            45666666666655444       2333          33569999999999873


No 78 
>KOG2463|consensus
Probab=32.47  E-value=27  Score=27.70  Aligned_cols=18  Identities=28%  Similarity=0.870  Sum_probs=14.4

Q ss_pred             ccCCCCCcccchhHHHHH
Q psy8741          37 IDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        37 ~d~~~~G~Is~keF~kaM   54 (62)
                      =|.|.||||++..-.++.
T Consensus       176 ed~DdDgwitp~ni~~~~  193 (376)
T KOG2463|consen  176 EDADDDGWITPSNITEAI  193 (376)
T ss_pred             cccccccccccchHHHHH
Confidence            467888999999887664


No 79 
>KOG0040|consensus
Probab=32.02  E-value=19  Score=33.97  Aligned_cols=28  Identities=18%  Similarity=0.230  Sum_probs=24.3

Q ss_pred             ccccccCCCCCcccchhHHHHHHHhhhc
Q psy8741          33 SFMEIDINNEGWVYPKDFKEKMEQQKSY   60 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~keF~kaMe~qk~y   60 (62)
                      +|+++|-+..||..+++|.--.+++--|
T Consensus      2258 ~fkhFDkek~G~Ldhq~F~sCLrslgY~ 2285 (2399)
T KOG0040|consen 2258 MFKHFDKEKNGRLDHQHFKSCLRSLGYD 2285 (2399)
T ss_pred             HHHHhchhhccCCcHHHHHHHHHhcCCC
Confidence            6889999999999999999888876543


No 80 
>PF02417 Chromate_transp:  Chromate transporter;  InterPro: IPR003370 This entry represents chromate transporters (CHR) [, ]. These proteins reduce chromate accumulation and are essential for chromate resistance. They are composed of one or two copies of this region. The short-chain CHR proteins form heterodimer transporters which efflux chromate ions from the cytoplasm, while the long chain CHR proteins appear to have arisen from a gene fusion event of two short chain transporters[].; GO: 0015109 chromate transmembrane transporter activity, 0015703 chromate transport
Probab=29.60  E-value=31  Score=22.74  Aligned_cols=21  Identities=19%  Similarity=0.496  Sum_probs=15.8

Q ss_pred             ccccCCCCCcccchhHHHHHH
Q psy8741          35 MEIDINNEGWVYPKDFKEKME   55 (62)
Q Consensus        35 ~e~d~~~~G~Is~keF~kaMe   55 (62)
                      ++.=-+..||||.+||....-
T Consensus        28 ~~~~V~~~~wlt~~~f~~~~a   48 (169)
T PF02417_consen   28 QREFVERRGWLTEEEFLEGLA   48 (169)
T ss_pred             HHHHhHccCCCCHHHHHHHHH
Confidence            333357789999999997654


No 81 
>KOG0028|consensus
Probab=29.47  E-value=34  Score=24.56  Aligned_cols=25  Identities=20%  Similarity=0.259  Sum_probs=19.2

Q ss_pred             CccccccCCCCCcccchhHHHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaMe~   56 (62)
                      ++|.-+||+++|.|--+|+.-||.+
T Consensus        37 e~f~lfd~~~~g~iD~~EL~vAmra   61 (172)
T KOG0028|consen   37 EAFELFDPDMAGKIDVEELKVAMRA   61 (172)
T ss_pred             HHHHhhccCCCCcccHHHHHHHHHH
Confidence            4677778888888888888777764


No 82 
>PF04081 DNA_pol_delta_4:  DNA polymerase delta, subunit 4 ;  InterPro: IPR007218 DNA polymerase is responsible for effective DNA replication. The function of the delta subunit 4 of DNA polymerase is not yet known.; GO: 0006260 DNA replication, 0005634 nucleus
Probab=29.10  E-value=30  Score=23.45  Aligned_cols=16  Identities=31%  Similarity=0.422  Sum_probs=12.6

Q ss_pred             chhHHHHHHHHHHHHh
Q psy8741           9 AANVELILKYFDMFLK   24 (62)
Q Consensus         9 ~snve~ilkffdmflK   24 (62)
                      -+.+|.||++|||=.+
T Consensus        61 ~~~~e~~Lr~FDl~~~   76 (124)
T PF04081_consen   61 LSQHEKILRQFDLSSQ   76 (124)
T ss_pred             hhHHHHHHHHhccccc
Confidence            4678999999998543


No 83 
>COG5663 Uncharacterized conserved protein [Function unknown]
Probab=28.81  E-value=42  Score=24.52  Aligned_cols=45  Identities=20%  Similarity=0.189  Sum_probs=36.2

Q ss_pred             cchhHHHHHHHHHHHHhhccccCCCccccccCCCCCcccchhHHHHHHHhh
Q psy8741           8 SAANVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQK   58 (62)
Q Consensus         8 s~snve~ilkffdmflKLkdltsS~~F~e~d~~~~G~Is~keF~kaMe~qk   58 (62)
                      .+--++..=.+|.-+|-++|+|      +||.-.-|||.-.||.+-||+-+
T Consensus        20 ~~t~~~~~n~~f~kslse~d~t------~y~lhkil~i~~ee~~k~~e~~e   64 (194)
T COG5663          20 DPTFAPYLNPAFEKSLSEADPT------DYDLHKILNITTEEFWKWMEQTE   64 (194)
T ss_pred             CcccchhccHHHHhhhhhcccc------cccHHHHhCccHHHHHHHHHHHH
Confidence            3344455557888888888876      79999999999999999999854


No 84 
>PF03645 Tctex-1:  Tctex-1 family;  InterPro: IPR005334 Tctex-1 is a dynein light chain. Dynein translocates rhodopsin-bearing vesicles along microtubules and it has been shown that Tctex-1 can bind to the cytoplasmic tail of rhodopsin. An efficient vectorial transport system must be required to deliver large numbers of newly synthesized rhodopsin molecules (~107 molecules per day per photoreceptor) to the base of the outer segment of the photoreceptor, Tctex-1 may well play a role in this process. C-terminal rhodopsin mutations responsible for retinitis pigmentosa inhibit the interaction between Tctex-1 and rhodopsin, which may be the molecular basis of retinitis pigmentosa.  In the mouse, the chromosomal location and pattern of expression of Tctex-1 make it a candidate for involvement in male sterility [].; PDB: 1YGT_A 3FM7_A 2PG1_E 1XDX_B.
Probab=28.33  E-value=19  Score=21.60  Aligned_cols=13  Identities=31%  Similarity=0.358  Sum_probs=9.2

Q ss_pred             cccCCCCCcccch
Q psy8741          36 EIDINNEGWVYPK   48 (62)
Q Consensus        36 e~d~~~~G~Is~k   48 (62)
                      -||++.||+++.+
T Consensus        72 lWD~~~D~~~~~~   84 (101)
T PF03645_consen   72 LWDPETDGYVSYK   84 (101)
T ss_dssp             ECETTT-EEEEEE
T ss_pred             eeCCCCCcEEEEE
Confidence            4889999988753


No 85 
>PF14788 EF-hand_10:  EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A ....
Probab=28.18  E-value=26  Score=20.41  Aligned_cols=26  Identities=27%  Similarity=0.382  Sum_probs=19.8

Q ss_pred             cccCCCccccccCCCCCcccchhHHH
Q psy8741          27 DLTSSASFMEIDINNEGWVYPKDFKE   52 (62)
Q Consensus        27 dltsS~~F~e~d~~~~G~Is~keF~k   52 (62)
                      +--+...|++.|..++|.+-..||..
T Consensus        20 ~~yA~~LFq~~D~s~~g~Le~~Ef~~   45 (51)
T PF14788_consen   20 DEYARQLFQECDKSQSGRLEGEEFEE   45 (51)
T ss_dssp             HHHHHHHHHHH-SSSSSEBEHHHHHH
T ss_pred             HHHHHHHHHHhcccCCCCccHHHHHH
Confidence            33345578999999999999999875


No 86 
>PF12923 RRP7:  Ribosomal RNA-processing protein 7 (RRP7);  InterPro: IPR024326 Ribosomal RNA-processing protein 7 (RRP7) is an essential protein in yeast that is involved in pre-rRNA processing and ribosome assembly []. It is speculated to be required for correct assembly of rpS27 into the pre-ribosomal particle [, ]. This entry includes RRP7 and homologous sequences from other organisms. 
Probab=26.60  E-value=29  Score=22.64  Aligned_cols=35  Identities=17%  Similarity=0.314  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHhhccccCCCc----cccccCCCCCccc
Q psy8741          12 VELILKYFDMFLKLKDLTSSAS----FMEIDINNEGWVY   46 (62)
Q Consensus        12 ve~ilkffdmflKLkdltsS~~----F~e~d~~~~G~Is   46 (62)
                      .+.+.+.-|.|+..=|-.....    -..--||-||||+
T Consensus        16 ~~~Lq~~vd~~m~~yd~~~~~~~~~~~~~~~~DEDGwvt   54 (131)
T PF12923_consen   16 PDALQEEVDEYMAKYDKREEEEKKEAKKENEPDEDGWVT   54 (131)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCCCEE
Confidence            3444455555554433332222    1233489999986


No 87 
>KOG0377|consensus
Probab=26.21  E-value=37  Score=28.38  Aligned_cols=55  Identities=29%  Similarity=0.360  Sum_probs=44.8

Q ss_pred             cccccccchhHHHHHHHHH----------HHHhhccccCCCccccc------------cCCCCCcccchhHHHHHHH
Q psy8741           2 VDTLVESAANVELILKYFD----------MFLKLKDLTSSASFMEI------------DINNEGWVYPKDFKEKMEQ   56 (62)
Q Consensus         2 Vd~LvEs~snve~ilkffd----------mflKLkdltsS~~F~e~------------d~~~~G~Is~keF~kaMe~   56 (62)
                      |++|-.--|++|-|+.+-|          =|.-.++|-+|+--.++            |.|+||-|---||.+|-+-
T Consensus       539 vetLYr~ks~LetiF~~iD~D~SG~isldEF~~a~~l~~sh~~~~i~~~~i~~la~~mD~NkDG~IDlNEfLeAFrl  615 (631)
T KOG0377|consen  539 VETLYRNKSSLETIFNIIDADNSGEISLDEFRTAWKLLSSHMNGAISDDEILELARSMDLNKDGKIDLNEFLEAFRL  615 (631)
T ss_pred             HHHHHhchhhHHHHHHHhccCCCCceeHHHHHHHHHHHHhhcCCCcCHHHHHHHHHhhccCCCCcccHHHHHHHHhh
Confidence            5677777899999999875          47788888888877665            5999999999999998653


No 88 
>PF10256 Erf4:  Golgin subfamily A member 7/ERF4 family;  InterPro: IPR019383 Proteins in this entry include Golgin subfamily A member 7 and the Ras modification protein ERF4. 
Probab=25.96  E-value=52  Score=20.39  Aligned_cols=18  Identities=22%  Similarity=0.606  Sum_probs=15.2

Q ss_pred             CCCCcccchhHHHHHHHh
Q psy8741          40 NNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        40 ~~~G~Is~keF~kaMe~q   57 (62)
                      .-.|.||++||++.+..=
T Consensus        25 ~L~~~is~~ef~~iI~~I   42 (118)
T PF10256_consen   25 ELSGYISPEEFEEIINTI   42 (118)
T ss_pred             hhcCCCCHHHHHHHHHHH
Confidence            368999999999998763


No 89 
>PF00447 HSF_DNA-bind:  HSF-type DNA-binding;  InterPro: IPR000232 Heat shock factor (HSF) is a transcriptional activator of heat shock genes []: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs []. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus []. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats []. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear []. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus []. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1FBQ_B 1FYL_B 1FBS_A 1FYM_B 3HTS_B 2HTS_A 3HSF_A 1FBU_B 1FYK_A 2LDU_A ....
Probab=25.87  E-value=28  Score=21.20  Aligned_cols=31  Identities=13%  Similarity=0.411  Sum_probs=21.1

Q ss_pred             HhhccccCCCcc---ccccCCCCCccc--chhHHHH
Q psy8741          23 LKLKDLTSSASF---MEIDINNEGWVY--PKDFKEK   53 (62)
Q Consensus        23 lKLkdltsS~~F---~e~d~~~~G~Is--~keF~ka   53 (62)
                      -||-.|.+++.+   -.|+++|+++|=  +++|.+.
T Consensus         4 ~kL~~~l~~~~~~~~I~W~~~G~~fiI~d~~~f~~~   39 (103)
T PF00447_consen    4 SKLYEMLEDPENSDIIRWSPDGDSFIIHDPEEFEKE   39 (103)
T ss_dssp             HHHHHHHCTTTTTTTCEECTTSSEEEES-HHHHHHH
T ss_pred             HHHHHHHcCCCCCCEEEEeCCCCEEEEeecHHHhhh
Confidence            366667776655   458999999643  5667763


No 90 
>PF08726 EFhand_Ca_insen:  Ca2+ insensitive EF hand;  InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes. EF hands usually bind to Ca2+ ions, which cause a major conformational change that allows the protein to interact with its designated targets. This protein corresponds to an EF hand which has partially or entirely lost its calcium-binding properties. The calcium insensitive EF hand is still able to mediate protein-protein recognition []. ; PDB: 1H8B_A 1SJJ_B.
Probab=25.77  E-value=21  Score=21.58  Aligned_cols=22  Identities=14%  Similarity=0.422  Sum_probs=19.0

Q ss_pred             CccccccCCCCCcccchhHHHHH
Q psy8741          32 ASFMEIDINNEGWVYPKDFKEKM   54 (62)
Q Consensus        32 ~~F~e~d~~~~G~Is~keF~kaM   54 (62)
                      .+||.. .++++.|+..|.++++
T Consensus        10 ~aFr~l-A~~KpyVT~~dLr~~l   31 (69)
T PF08726_consen   10 EAFRAL-AGGKPYVTEEDLRRSL   31 (69)
T ss_dssp             HHHHHH-CTSSSCEEHHHHHHHS
T ss_pred             HHHHHH-HcCCCcccHHHHHHHc
Confidence            478999 8899999999998875


No 91 
>COG2059 ChrA Chromate transport protein ChrA [Inorganic ion transport and metabolism]
Probab=25.60  E-value=32  Score=24.30  Aligned_cols=23  Identities=9%  Similarity=0.371  Sum_probs=17.4

Q ss_pred             ccccCCCCCcccchhHHHHHHHh
Q psy8741          35 MEIDINNEGWVYPKDFKEKMEQQ   57 (62)
Q Consensus        35 ~e~d~~~~G~Is~keF~kaMe~q   57 (62)
                      ++---|..+|||.+||-..+-=+
T Consensus        33 ~~e~V~~r~Wis~~ef~~~lais   55 (195)
T COG2059          33 RREVVERRKWISEEEFADALAIS   55 (195)
T ss_pred             HHHHHHhccCCCHHHHHHHHHHH
Confidence            44446788999999998877543


No 92 
>PF00404 Dockerin_1:  Dockerin type I repeat;  InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ]. The cellulosome contains at least 30 polypeptides, the majority of the enzymes are endoglucanases (3.2.1.4 from EC), but there are also some xylanases (3.2.1.8 from EC), beta-glucosidases (3.2.1.21 from EC) and endo-beta-1,3-1,4-glucanases (3.2.1.73 from EC). Complete sequence data for many of these enzymes has been obtained. A majority of these proteins contain a highly conserved type I dockerin domain of about 65 to 70 residues, which is generally (but not always) located in the C terminus. The dockerin domain is the binding partner of the cohesin domain (see IPR002102 from INTERPRO). The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome []. The dockerin domain contains a tandem repeat of two calcium-binding loop-helix motifs (distinct from EF-hand Ca-binding motifs). These motifs are about 24 amino acids in length. This entry represents these repeated Ca-binding motifs.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3P0D_J 1OHZ_B 2CCL_B 1DAV_A 1DAQ_A 2VN5_B 2VN6_B.
Probab=25.09  E-value=47  Score=16.06  Aligned_cols=14  Identities=36%  Similarity=0.579  Sum_probs=10.8

Q ss_pred             cCCCCCcccchhHH
Q psy8741          38 DINNEGWVYPKDFK   51 (62)
Q Consensus        38 d~~~~G~Is~keF~   51 (62)
                      |.|+||.|.--|+.
T Consensus         1 DvN~DG~vna~D~~   14 (21)
T PF00404_consen    1 DVNGDGKVNAIDLA   14 (21)
T ss_dssp             -TTSSSSSSHHHHH
T ss_pred             CCCCCCcCCHHHHH
Confidence            67999999877764


No 93 
>TIGR01669 phage_XkdX phage uncharacterized protein, XkdX family. This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes.
Probab=24.96  E-value=43  Score=18.64  Aligned_cols=13  Identities=8%  Similarity=0.143  Sum_probs=10.6

Q ss_pred             CCcccchhHHHHH
Q psy8741          42 EGWVYPKDFKEKM   54 (62)
Q Consensus        42 ~G~Is~keF~kaM   54 (62)
                      -|||++.++++..
T Consensus        29 ~~~IT~eey~eIT   41 (45)
T TIGR01669        29 KKLITREQYKVIT   41 (45)
T ss_pred             cCccCHHHHHHHh
Confidence            4899999998753


No 94 
>PF13331 DUF4093:  Domain of unknown function (DUF4093)
Probab=24.48  E-value=39  Score=21.02  Aligned_cols=11  Identities=18%  Similarity=0.595  Sum_probs=8.5

Q ss_pred             ccchhHHHHHH
Q psy8741          45 VYPKDFKEKME   55 (62)
Q Consensus        45 Is~keF~kaMe   55 (62)
                      ||+.||.+||+
T Consensus        77 it~~e~~~alk   87 (87)
T PF13331_consen   77 ITREEFEEALK   87 (87)
T ss_pred             CCHHHHHHHhC
Confidence            78888888774


No 95 
>PF09953 DUF2187:  Uncharacterized protein conserved in bacteria (DUF2187);  InterPro: IPR018690  This family consists of various hypothetical bacterial proteins with known function. It includes the uncharacterised YkvS protein from Bacillus subtilis.
Probab=23.39  E-value=34  Score=20.49  Aligned_cols=25  Identities=28%  Similarity=0.432  Sum_probs=21.4

Q ss_pred             hccccCCCccccccCCCCCcccchh
Q psy8741          25 LKDLTSSASFMEIDINNEGWVYPKD   49 (62)
Q Consensus        25 LkdltsS~~F~e~d~~~~G~Is~ke   49 (62)
                      +.|+|.-+.|++.|.+.+=+|+||.
T Consensus        29 IVdIT~m~~~~e~~l~~ktVVnHKn   53 (57)
T PF09953_consen   29 IVDITIMENFDELDLEEKTVVNHKN   53 (57)
T ss_pred             EEEEEecCCccccCCCccEEEeece
Confidence            4578888999999999999998875


No 96 
>smart00415 HSF heat shock factor.
Probab=22.47  E-value=59  Score=20.09  Aligned_cols=31  Identities=23%  Similarity=0.296  Sum_probs=21.7

Q ss_pred             HhhccccCCCccc---cccCCCCCccc--chhHHHH
Q psy8741          23 LKLKDLTSSASFM---EIDINNEGWVY--PKDFKEK   53 (62)
Q Consensus        23 lKLkdltsS~~F~---e~d~~~~G~Is--~keF~ka   53 (62)
                      .||-+|.+...+.   .|+++|+++|=  ++.|.+.
T Consensus         7 ~kL~~~l~~~~~~~iI~W~~~G~~f~I~d~~~f~~~   42 (105)
T smart00415        7 TKLYLLVEDPSTDKIISWSPSGKSFVIWDPEEFAKN   42 (105)
T ss_pred             HHHHHHHhCCCCCCEEEECCCCCEEEEcCHHHHHHH
Confidence            4667777766665   48999999775  5557654


No 97 
>PF06902 Fer4_19:  Divergent 4Fe-4S mono-cluster;  InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues. These ferredoxins each bind a 3Fe-4S cluster. Ferredoxin-soy (SoyB) act as electron transport protein for the cytochrome P450-SOY system []. Ferredoxin-1 (SuaB) and Ferredoxin-2 (SubB) act as electron transport proteins for the herbicide-metabolising cytochrome P-450 SU1 and SU2 systems, respectively [, ]. Ferredoxin-fas2 also plays a role in electrontransfer, the fas operon encoding genes involved in cytokinin production and in host plant fasciation (leafy gall).
Probab=21.62  E-value=51  Score=19.32  Aligned_cols=17  Identities=29%  Similarity=0.591  Sum_probs=12.2

Q ss_pred             ccccccCCCCCcccchh
Q psy8741          33 SFMEIDINNEGWVYPKD   49 (62)
Q Consensus        33 ~F~e~d~~~~G~Is~ke   49 (62)
                      +..-||++.+|||++.+
T Consensus        25 ~p~VFd~~~~~~v~~d~   41 (64)
T PF06902_consen   25 APEVFDQDDEPWVSPDE   41 (64)
T ss_pred             CCCcccCCCCCcCCcCc
Confidence            34557888899997643


No 98 
>PHA02754 hypothetical protein; Provisional
Probab=21.26  E-value=51  Score=20.41  Aligned_cols=15  Identities=47%  Similarity=0.625  Sum_probs=12.6

Q ss_pred             cccchhHHHHHHHhh
Q psy8741          44 WVYPKDFKEKMEQQK   58 (62)
Q Consensus        44 ~Is~keF~kaMe~qk   58 (62)
                      +|.-|+|.++|++-|
T Consensus        10 ~i~eK~Fke~MRelk   24 (67)
T PHA02754         10 AIMEKDFKEAMRELK   24 (67)
T ss_pred             HHHHhHHHHHHHHHH
Confidence            577899999999765


No 99 
>COG2306 Predicted RNA-binding protein, associated with RNAses E/G family [General function prediction only]
Probab=21.18  E-value=60  Score=23.50  Aligned_cols=15  Identities=20%  Similarity=0.525  Sum_probs=13.1

Q ss_pred             CCCcccchhHHHHHH
Q psy8741          41 NEGWVYPKDFKEKME   55 (62)
Q Consensus        41 ~~G~Is~keF~kaMe   55 (62)
                      .-|.|||+.|++|..
T Consensus       133 ~~GlIT~~qf~~Ay~  147 (183)
T COG2306         133 RYGLITPEQFEKAYR  147 (183)
T ss_pred             HcCCCCHHHHHHHHH
Confidence            469999999999975


No 100
>PF10747 DUF2522:  Protein of unknown function (DUF2522);  InterPro: IPR019683  This entry represents the Sporulation inhibitor of replication (sirA) family of proteins from Bacillus sp. Induction of sporulation in rapidly growing cells inhibits replication; this is thought to be through the action of SirA protein and independent of phosphorylated Spo0A; however SirA protein synthesis is induced by Spo0A [].
Probab=20.62  E-value=1.1e+02  Score=20.96  Aligned_cols=38  Identities=21%  Similarity=0.586  Sum_probs=28.5

Q ss_pred             ccccchhHHHHHHHHHHHHhhccccCCCcccccc--CCCCCcccc
Q psy8741           5 LVESAANVELILKYFDMFLKLKDLTSSASFMEID--INNEGWVYP   47 (62)
Q Consensus         5 LvEs~snve~ilkffdmflKLkdltsS~~F~e~d--~~~~G~Is~   47 (62)
                      +++++.+...=.-||.+.=|+     +..|...|  -+.-||++|
T Consensus        98 ~l~~~Gs~~aet~~FevLrk~-----~~~FlAvd~~~~ryGWL~P  137 (142)
T PF10747_consen   98 QLNCSGSYDAETDFFEVLRKI-----SPCFLAVDFENKRYGWLKP  137 (142)
T ss_pred             EEEecCCHHHHHHHHHHHHhC-----CCceEEEecCCCcccCcCc
Confidence            467788888888888887664     56777766  556799987


No 101
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=20.34  E-value=29  Score=24.04  Aligned_cols=28  Identities=14%  Similarity=0.299  Sum_probs=21.7

Q ss_pred             ccccCCCccccccCCCCCcccchhHHHH
Q psy8741          26 KDLTSSASFMEIDINNEGWVYPKDFKEK   53 (62)
Q Consensus        26 kdltsS~~F~e~d~~~~G~Is~keF~ka   53 (62)
                      -++.|.....++|+|++|..+++|-++.
T Consensus        48 De~~S~~ll~~~D~~~dg~~~~~el~~l   75 (212)
T PF06226_consen   48 DEFFSAYLLEGLDKDGDGKLDPEELAAL   75 (212)
T ss_pred             CchhHHHHHHhhhhcccCCCCHHHHHHH
Confidence            3456666777999999999999886543


Done!