Diaphorina citri psyllid: psy8741

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MVDTLVESAANVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQKSYTP
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccccccHHHHHHHHHHHccccc
**DTL*ESAANVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFKE***Q******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDTLVESAANVELILKYFDMFLKLKDLTSSASFMEIDINNEGWVYPKDFKEKMEQQKSYTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ryanodine receptor 44F Intracellular calcium channel that is required for proper muscle function during embryonic development and may be essential for excitation-contraction coupling in larval body wall muscles.confidentQ24498
Ryanodine receptor 3 Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca(2+) release by other calcium channels. Calcium channel that mediates Ca(2+)-induced Ca(2+) release from the endoplasmic reticulum in non-muscle cells. Plays a role in cellular calcium signaling. Contributes to cellular calcium ion homeostasis. Isoform 2 lacks a predicted transmembrane segment and does not form functional calcium channels by itself; however, it can form tetramers with isoforms that contain the full complement of transmembrane segements and modulate their activity.confidentA2AGL3
Ryanodine receptor 3 Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca(2+) release by other calcium channels. Calcium channel that mediates Ca(2+)-induced Ca(2+) release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis (By similarity). Plays a role in cellular calcium signaling.confidentQ15413

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005219 [MF]ryanodine-sensitive calcium-release channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0015278, GO:0015276, GO:0072509, GO:0022803, GO:0046873, GO:0008324, GO:0005218, GO:0005215, GO:0005216, GO:0005217, GO:0022891, GO:0022890, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:0033017 [CC]sarcoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0016528, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016529, GO:0044424, GO:0044425, GO:0044422
GO:0030509 [BP]BMP signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0014808 [BP]release of sequestered calcium ion into cytosol by sarcoplasmic reticulumprobableGO:0050801, GO:0055065, GO:0051282, GO:0051283, GO:0032844, GO:0042592, GO:0055074, GO:0050789, GO:0044699, GO:0072507, GO:0032879, GO:0072503, GO:0051209, GO:0065007, GO:0006874, GO:0048519, GO:0016482, GO:0019725, GO:0009987, GO:0060401, GO:0060402, GO:0006875, GO:0006812, GO:0006811, GO:0006810, GO:0006816, GO:0006873, GO:0050794, GO:0044765, GO:0030001, GO:0030003, GO:0051649, GO:0055080, GO:0072511, GO:0055082, GO:0051234, GO:0051179, GO:0051641, GO:0065008, GO:0070838, GO:0046907, GO:0051480, GO:0044763, GO:0007204, GO:0048878, GO:0070296, GO:2000021, GO:0008150
GO:0003007 [BP]heart morphogenesisprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0030314 [CC]junctional membrane complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0005575, GO:0016528, GO:0044424
GO:0043924 [MF]suramin bindingprobableGO:1901681, GO:0097159, GO:0003674, GO:0005488
GO:0048763 [MF]calcium-induced calcium release activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0015278, GO:0015276, GO:0072509, GO:0022803, GO:0046873, GO:0008324, GO:0005218, GO:0005215, GO:0005216, GO:0005217, GO:0022891, GO:0022890, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:1901896 [BP]positive regulation of calcium-transporting ATPase activityprobableGO:0032414, GO:0009894, GO:0019220, GO:0032411, GO:0032412, GO:0051049, GO:1901894, GO:0051174, GO:0034765, GO:0032879, GO:0050789, GO:0043085, GO:0080090, GO:0043462, GO:0031329, GO:0051345, GO:0031323, GO:0030811, GO:0032409, GO:1901021, GO:0043269, GO:0044093, GO:0048518, GO:0065007, GO:0065009, GO:0033121, GO:0051050, GO:0019219, GO:0032781, GO:0050790, GO:0050794, GO:0010959, GO:0008150, GO:0051171, GO:0019222, GO:0009118, GO:0051336, GO:1901019, GO:1900542, GO:0022898, GO:0051924, GO:0006140, GO:0034762
GO:0071286 [BP]cellular response to magnesium ionprobableGO:0051716, GO:0032026, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0014802 [CC]terminal cisternaprobableGO:0005737, GO:0005575, GO:0031984, GO:0005783, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0016528, GO:0016529, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0002027 [BP]regulation of heart rateprobableGO:0044057, GO:0008016, GO:0008150, GO:0051239, GO:0065007, GO:0065008, GO:0050789
GO:0072599 [BP]establishment of protein localization to endoplasmic reticulumprobableGO:0033036, GO:0070972, GO:0070727, GO:0072594, GO:0034613, GO:0045184, GO:0008104, GO:0008150, GO:0033365, GO:0044763, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0014706 [BP]striated muscle tissue developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0034236 [MF]protein kinase A catalytic subunit bindingprobableGO:0051018, GO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0055117 [BP]regulation of cardiac muscle contractionprobableGO:0044057, GO:0006937, GO:0008016, GO:0006942, GO:0065007, GO:0090257, GO:0051239, GO:0008150, GO:0050789
GO:0051775 [BP]response to redox stateprobableGO:0050896, GO:0008150
GO:0005513 [BP]detection of calcium ionprobableGO:0009593, GO:0051606, GO:0050896, GO:0051592, GO:0008150, GO:0010038, GO:0042221, GO:0010035
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0060048 [BP]cardiac muscle contractionprobableGO:0032501, GO:0044707, GO:0006936, GO:0008015, GO:0006941, GO:0003012, GO:0060047, GO:0008150, GO:0003015, GO:0003013, GO:0044699, GO:0003008
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0034237 [MF]protein kinase A regulatory subunit bindingprobableGO:0051018, GO:0003674, GO:0005488, GO:0005515
GO:0005891 [CC]voltage-gated calcium channel complexprobableGO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034704, GO:0071944, GO:0034702, GO:0034703, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0071313 [BP]cellular response to caffeineprobableGO:0070887, GO:0043279, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:0071415, GO:0071417, GO:0071312, GO:0071310, GO:0014070, GO:0071495, GO:0009987, GO:0031000, GO:0044763, GO:0010243, GO:0042221, GO:0010033, GO:0071407, GO:1901698, GO:1901699, GO:0008150, GO:0050896
GO:0071318 [BP]cellular response to ATPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0033198, GO:0050896
GO:0051481 [BP]reduction of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0051284 [BP]positive regulation of sequestering of calcium ionprobableGO:0032844, GO:0051282, GO:0050794, GO:2000021, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0035584 [BP]calcium-mediated signaling using intracellular calcium sourceprobableGO:0044700, GO:0051716, GO:0019722, GO:0050896, GO:0009987, GO:0008150, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0070588 [BP]calcium ion transmembrane transportprobableGO:0009987, GO:0070838, GO:0006812, GO:0006811, GO:0006810, GO:0044763, GO:0006816, GO:0051179, GO:0008150, GO:0034220, GO:0044765, GO:0030001, GO:0072511, GO:0051234, GO:0055085, GO:0044699
GO:0008627 [BP]intrinsic apoptotic signaling pathway in response to osmotic stressprobableGO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0007569, GO:0035556, GO:0044699, GO:0051716, GO:0050789, GO:0065007, GO:0010259, GO:0006915, GO:0044700, GO:0009987, GO:0050794, GO:0012501, GO:0006950, GO:0008150, GO:0007154, GO:0009628, GO:0050896, GO:0044763, GO:0006970
GO:0071277 [BP]cellular response to calcium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0051592, GO:0044763, GO:0008150, GO:0070887, GO:0042221, GO:0010035, GO:0044699
GO:0005245 [MF]voltage-gated calcium channel activityprobableGO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QRX, chain A
Confidence level:probable
Coverage over the Query: 53-55
View the alignment between query and template
View the model in PyMOL