BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy8743
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2KXP|A Chain A, Solution Nmr Structure Of V-1 Bound To Capping Protein
           (Cp)
          Length = 275

 Score = 29.6 bits (65), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 116 FTDTAPRAELALMLKVQEFCYENMNLMRVFQKII 149
           FT T P A++A +LK+Q   YE+ N+  V  K I
Sbjct: 173 FTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDI 206


>pdb|1IZN|A Chain A, Crystal Structure Of Actin Filament Capping Protein Capz
 pdb|1IZN|C Chain C, Crystal Structure Of Actin Filament Capping Protein Capz
 pdb|3LK2|A Chain A, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Carmil
 pdb|3LK3|A Chain A, Crystal Structure Of Capz Bound To The Cpi And Csi
           Uncapping Motifs From Carmil
 pdb|3LK4|A Chain A, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|D Chain D, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|G Chain G, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|J Chain J, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|M Chain M, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|P Chain P, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|S Chain S, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|V Chain V, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|Y Chain Y, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|1 Chain 1, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|4 Chain 4, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|3LK4|7 Chain 7, Crystal Structure Of Capz Bound To The Uncapping Motif
           From Cd2ap
 pdb|2KZ7|A Chain A, Solution Structure Of The Carmil Cah3aB DOMAIN BOUND TO
           CAPPING Protein (Cp)
 pdb|3AA0|A Chain A, Crystal Structure Of Actin Capping Protein In Complex With
           The Cp- Binding Motif Derived From Carmil
 pdb|3AA1|A Chain A, Crystal Structure Of Actin Capping Protein In Complex With
           The Cp- Binding Motif Derived From Ckip-1
 pdb|3AA6|A Chain A, Crystal Structure Of Actin Capping Protein In Complex With
           The Cp- Binding Motif Derived From Cd2ap
 pdb|3AA7|A Chain A, Crystal Structure Of Actin Capping Protein
 pdb|3AAA|A Chain A, Crystal Structure Of Actin Capping Protein In Complex With
           V-1
 pdb|3AAE|A Chain A, Crystal Structure Of Actin Capping Protein In Complex With
           Carmil Fragment
 pdb|3AAE|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With
           Carmil Fragment
 pdb|3AAE|E Chain E, Crystal Structure Of Actin Capping Protein In Complex With
           Carmil Fragment
 pdb|3AAE|G Chain G, Crystal Structure Of Actin Capping Protein In Complex With
           Carmil Fragment
 pdb|3AAE|I Chain I, Crystal Structure Of Actin Capping Protein In Complex With
           Carmil Fragment
          Length = 286

 Score = 29.3 bits (64), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 116 FTDTAPRAELALMLKVQEFCYENMNLMRVFQKII 149
           FT T P A++A +LK+Q   YE+ N+  V  K I
Sbjct: 179 FTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDI 212


>pdb|3S4L|A Chain A, The Crispr-Associated Cas3 Hd Domain Protein Mj0384 From
           Methanocaldococcus Jannaschii
          Length = 244

 Score = 28.5 bits (62), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 85  VMAQVEWNKKEELVAEQALKHLKQFTPLFGAFTD 118
           +M Q+   KK+EL AE  L  LK+F  +   F D
Sbjct: 128 IMGQIRNLKKKELTAEVVLDKLKKFDGMIEDFED 161


>pdb|2FTY|A Chain A, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri
 pdb|2FTY|B Chain B, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri
 pdb|2FTY|C Chain C, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri
 pdb|2FTY|D Chain D, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri
 pdb|2FVK|A Chain A, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Substrate
           Dihydrouracil
 pdb|2FVK|B Chain B, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Substrate
           Dihydrouracil
 pdb|2FVK|C Chain C, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Substrate
           Dihydrouracil
 pdb|2FVK|D Chain D, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Substrate
           Dihydrouracil
 pdb|2FVM|A Chain A, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Reaction
           Product N-carbamyl-beta-alanine
 pdb|2FVM|B Chain B, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Reaction
           Product N-carbamyl-beta-alanine
 pdb|2FVM|C Chain C, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Reaction
           Product N-carbamyl-beta-alanine
 pdb|2FVM|D Chain D, Crystal Structure Of Dihydropyrimidinase From
           Saccharomyces Kluyveri In Complex With The Reaction
           Product N-carbamyl-beta-alanine
          Length = 559

 Score = 28.5 bits (62), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 72  IPDQELIVLIWSTVMAQVEWNKKEELVAEQALKHLKQFTPLFGAFTDTAPR 122
           + D +L+  IW    ++ E+N K +L+  + ++H   +TP  G      PR
Sbjct: 444 VSDADLV--IWYPDDSKKEYNSKPKLITNKLMEHNCDYTPFEGIEIKNWPR 492


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.137    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,571,824
Number of Sequences: 62578
Number of extensions: 103937
Number of successful extensions: 227
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 223
Number of HSP's gapped (non-prelim): 4
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)