Query         psy8745
Match_columns 317
No_of_seqs    289 out of 1678
Neff          6.3 
Searched_HMMs 46136
Date          Fri Aug 16 18:07:41 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8745.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8745hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4720|consensus              100.0 2.6E-46 5.7E-51  349.1  16.1  171   12-183   217-387 (391)
  2 PLN02421 phosphotransferase, a 100.0 3.5E-38 7.5E-43  303.0  17.7  163   23-186   161-323 (330)
  3 PTZ00296 choline kinase; Provi 100.0 1.6E-36 3.5E-41  302.2  18.4  159   22-182   256-433 (442)
  4 PLN02236 choline kinase        100.0   2E-35 4.3E-40  285.5  18.8  160   22-182   178-343 (344)
  5 KOG2686|consensus              100.0 7.9E-35 1.7E-39  279.1  16.4  159   22-180   190-359 (366)
  6 PTZ00384 choline kinase; Provi 100.0 1.8E-32   4E-37  268.6  18.8  158   22-181   198-376 (383)
  7 cd05156 ChoK_euk Choline Kinas  99.9 2.1E-26 4.6E-31  216.6  12.9  112   41-152   176-302 (302)
  8 KOG4720|consensus               99.9 1.5E-23 3.2E-28  196.7   5.1   95  186-281   130-226 (391)
  9 COG0510 ycfN Thiamine kinase a  99.8 2.7E-18 5.8E-23  161.4  14.5  133   22-180   130-263 (269)
 10 PF01633 Choline_kinase:  Choli  99.8 1.2E-19 2.6E-24  162.9   5.0   84   22-105   121-211 (211)
 11 TIGR02721 ycfN_thiK thiamine k  99.8 1.1E-17 2.3E-22  154.3  13.3  111   41-171   143-253 (256)
 12 cd05157 ETNK_euk Ethanolamine   99.7   5E-18 1.1E-22  153.7   9.3   88   22-110   148-235 (235)
 13 KOG2686|consensus               99.7 5.1E-19 1.1E-23  170.4   2.8   84  183-266    91-176 (366)
 14 PRK10271 thiK thiamine kinase;  99.6   6E-15 1.3E-19  131.9  10.8  117   30-168    63-179 (188)
 15 PTZ00296 choline kinase; Provi  99.4 9.9E-14 2.1E-18  138.8   4.8   80  186-265   161-247 (442)
 16 PTZ00384 choline kinase; Provi  99.4 8.9E-14 1.9E-18  136.8   4.0   78  186-263   104-187 (383)
 17 cd05153 HomoserineK_II Homoser  99.4   4E-12 8.7E-17  119.0  13.3  101   40-152   171-271 (296)
 18 PF01633 Choline_kinase:  Choli  99.4 2.5E-13 5.4E-18  121.9   4.1   73  186-258    25-99  (211)
 19 PLN02421 phosphotransferase, a  99.4 5.9E-13 1.3E-17  128.2   6.2   89  186-274    65-155 (330)
 20 PLN02236 choline kinase         99.3 8.5E-13 1.8E-17  127.9   5.4   81  186-266    88-169 (344)
 21 TIGR02906 spore_CotS spore coa  99.3 1.3E-10 2.8E-15  109.2  15.2  100   41-154   184-283 (313)
 22 TIGR02904 spore_ysxE spore coa  99.3 3.7E-11 8.1E-16  114.1  11.5  101   40-154   192-292 (309)
 23 cd05151 ChoK Choline Kinase (C  99.2 5.4E-11 1.2E-15  101.5  10.0   62   43-116   106-167 (170)
 24 PRK05231 homoserine kinase; Pr  99.2 1.6E-10 3.4E-15  109.7  13.4  101   26-135   166-270 (319)
 25 TIGR02172 Fb_sc_TIGR02172 Fibr  99.2 5.7E-11 1.2E-15  108.8   8.4   71   34-116   143-213 (226)
 26 TIGR00938 thrB_alt homoserine   99.1 3.8E-10 8.2E-15  106.9  12.2   86   41-134   184-269 (307)
 27 cd05154 ACAD10_11_like Acyl-Co  99.1 2.9E-10 6.2E-15  100.4   7.3   61   28-89    159-220 (223)
 28 PF01636 APH:  Phosphotransfera  99.0 6.2E-10 1.3E-14   98.4   8.4   75   30-117   153-227 (239)
 29 cd05150 APH Aminoglycoside 3'-  99.0   1E-09 2.2E-14  100.1   8.8   65   41-113   160-224 (244)
 30 smart00587 CHK ZnF_C4 abd HLH   99.0 2.2E-09 4.9E-14   95.9   9.9   65   42-117   118-186 (196)
 31 cd05157 ETNK_euk Ethanolamine   98.9 1.6E-09 3.5E-14   98.0   6.2   82  186-267    47-135 (235)
 32 COG2334 Putative homoserine ki  98.9 3.3E-08 7.2E-13   95.8  15.3  105   46-163   199-303 (331)
 33 PRK09550 mtnK methylthioribose  98.9   1E-08 2.2E-13  101.7   9.7   61   26-90    207-267 (401)
 34 cd05156 ChoK_euk Choline Kinas  98.9 2.7E-09 5.8E-14  100.5   5.3   81  186-266    52-138 (302)
 35 cd05155 APH_ChoK_like_1 Unchar  98.8 1.5E-08 3.3E-13   92.3   8.4   59   42-114   162-221 (235)
 36 cd05152 MPH2' Macrolide 2'-Pho  98.8 6.8E-08 1.5E-12   91.1  12.0   63   41-116   182-245 (276)
 37 PRK11768 serine/threonine prot  98.8 7.8E-08 1.7E-12   92.5  12.3  119   41-178   193-316 (325)
 38 PRK12396 5-methylribose kinase  98.7 4.6E-08   1E-12   96.8   9.5   62   25-90    210-271 (409)
 39 PF02958 EcKinase:  Ecdysteroid  98.7 4.2E-08 9.1E-13   92.0   8.6   68   39-117   210-281 (294)
 40 TIGR01767 MTRK 5-methylthiorib  98.7 8.8E-08 1.9E-12   93.8   9.7   46   42-89    190-235 (370)
 41 PLN02876 acyl-CoA dehydrogenas  98.6 4.3E-07 9.3E-12   97.6  12.3  114   25-149   203-333 (822)
 42 PRK06149 hypothetical protein;  98.6   1E-06 2.2E-11   96.4  15.1  178   41-241   205-406 (972)
 43 TIGR02721 ycfN_thiK thiamine k  98.5 1.6E-07 3.5E-12   86.5   7.1   79  186-264    43-121 (256)
 44 PRK06148 hypothetical protein;  98.5   8E-07 1.7E-11   97.5  13.4  129   41-186   200-330 (1013)
 45 cd05120 APH_ChoK_like Aminogly  98.4 8.3E-07 1.8E-11   72.2   7.7   45   44-89    108-152 (155)
 46 PLN02756 S-methyl-5-thioribose  98.4 1.3E-06 2.8E-11   87.0   9.3   60   25-88    213-272 (418)
 47 PF07914 DUF1679:  Protein of u  98.4 2.8E-06 6.1E-11   84.7  11.6   82   41-133   265-361 (414)
 48 PRK10593 hypothetical protein;  98.4 1.4E-06   3E-11   82.9   8.5   70   33-117   182-252 (297)
 49 COG3173 Predicted aminoglycosi  98.2 3.8E-06 8.2E-11   81.2   8.2   61   25-86    179-239 (321)
 50 TIGR02905 spore_yutH spore coa  98.2 6.4E-06 1.4E-10   78.9   9.1   96   42-154   187-283 (313)
 51 COG3178 Predicted phosphotrans  97.8 0.00014 2.9E-09   69.7  10.3  106   41-157   197-308 (351)
 52 COG4857 Predicted kinase [Gene  97.8 9.3E-05   2E-09   70.5   8.0   59   26-88    212-270 (408)
 53 PRK14879 serine/threonine prot  97.7 0.00013 2.9E-09   64.4   7.8   83   44-134   114-198 (211)
 54 TIGR03724 arch_bud32 Kae1-asso  97.7  0.0001 2.2E-09   64.6   6.6   41   44-86    109-149 (199)
 55 PF06293 Kdo:  Lipopolysacchari  97.4 0.00047   1E-08   62.0   7.7   64   43-113   136-206 (206)
 56 PF03881 Fructosamin_kin:  Fruc  97.4 0.00031 6.8E-09   67.0   6.1   75   28-118   172-246 (288)
 57 cd05151 ChoK Choline Kinase (C  97.3 0.00036 7.9E-09   59.1   5.1   59  186-244    44-104 (170)
 58 COG3642 Mn2+-dependent serine/  97.1   0.003 6.5E-08   57.0   8.8   68   43-118   110-181 (204)
 59 PF04655 APH_6_hur:  Aminoglyco  97.1   0.004 8.7E-08   58.4  10.2   53   35-89    151-203 (253)
 60 PRK09605 bifunctional UGMP fam  96.9  0.0013 2.9E-08   67.3   5.4   41   44-86    447-487 (535)
 61 TIGR02172 Fb_sc_TIGR02172 Fibr  96.7  0.0016 3.5E-08   59.6   4.3   78  186-263    44-132 (226)
 62 PRK15123 lipopolysaccharide co  96.7  0.0083 1.8E-07   56.6   9.0   66   43-115   156-233 (268)
 63 PRK01723 3-deoxy-D-manno-octul  96.6   0.012 2.6E-07   54.3   9.0   34   44-78    161-194 (239)
 64 PRK12274 serine/threonine prot  96.6  0.0063 1.4E-07   55.9   7.0   35   43-78    109-144 (218)
 65 cd05145 RIO1_like RIO kinase f  96.4  0.0042   9E-08   54.8   4.2   31   44-76    137-167 (190)
 66 PRK09902 hypothetical protein;  96.3   0.016 3.5E-07   53.1   7.9   63   43-115   146-215 (216)
 67 COG3570 StrB Streptomycin 6-ki  96.3   0.015 3.3E-07   53.5   7.4   47   40-88    157-203 (274)
 68 cd05147 RIO1_euk RIO kinase fa  96.1  0.0048   1E-07   54.8   3.2   29   44-74    137-165 (190)
 69 cd05119 RIO RIO kinase family,  96.0   0.007 1.5E-07   52.3   3.6   29   44-74    134-162 (187)
 70 cd05150 APH Aminoglycoside 3'-  95.8  0.0098 2.1E-07   54.1   4.0   60  186-245    43-108 (244)
 71 COG3001 Uncharacterized protei  95.7   0.028 6.1E-07   52.6   6.7   81   17-118   164-244 (286)
 72 cd05144 RIO2_C RIO kinase fami  95.7   0.017 3.6E-07   51.0   5.0   30   44-74    144-173 (198)
 73 smart00090 RIO RIO-like kinase  95.7    0.02 4.3E-07   52.8   5.7   28   46-75    170-197 (237)
 74 PF01163 RIO1:  RIO1 family;  I  95.6    0.02 4.3E-07   51.3   5.0   29   44-74    126-154 (188)
 75 KOG0668|consensus               95.3   0.011 2.4E-07   55.2   2.4   41   42-82    149-189 (338)
 76 cd05154 ACAD10_11_like Acyl-Co  95.2    0.04 8.7E-07   48.2   5.8   79  187-265    48-149 (223)
 77 cd05146 RIO3_euk RIO kinase fa  95.1   0.015 3.3E-07   52.5   2.8   28   44-73    144-171 (197)
 78 PRK10359 lipopolysaccharide co  94.9   0.019   4E-07   53.3   2.7   38   43-82    153-192 (232)
 79 cd00180 PKc Catalytic domain o  94.8   0.033 7.2E-07   46.7   3.9   57   23-80     91-147 (215)
 80 PF06176 WaaY:  Lipopolysacchar  94.7   0.045 9.8E-07   50.7   4.8   30   44-75    154-183 (229)
 81 cd05594 STKc_PKB_alpha Catalyt  94.7   0.046   1E-06   51.5   4.9   30   44-74    115-144 (325)
 82 COG3231 Aph Aminoglycoside pho  94.6    0.14   3E-06   47.8   7.4   64   42-114   183-247 (266)
 83 TIGR01982 UbiB 2-polyprenylphe  94.5   0.025 5.4E-07   56.9   2.8   34   44-78    276-309 (437)
 84 cd06605 PKc_MAPKK Catalytic do  94.3   0.051 1.1E-06   48.8   4.1   51   23-74     99-149 (265)
 85 KOG0583|consensus               94.2   0.025 5.4E-07   55.8   1.9   35   43-77    138-172 (370)
 86 COG2187 Uncharacterized protei  94.1    0.46   1E-05   45.7  10.1  115   41-180   206-331 (337)
 87 PF00069 Pkinase:  Protein kina  94.1   0.026 5.6E-07   50.4   1.7   30   45-75    118-147 (260)
 88 KOG0983|consensus               94.0    0.06 1.3E-06   51.6   4.0   60   12-74    181-240 (391)
 89 KOG0984|consensus               93.8   0.044 9.5E-07   50.6   2.5   44   31-75    155-198 (282)
 90 cd05122 PKc_STE Catalytic doma  93.7   0.092   2E-06   46.0   4.5   53   23-77     97-149 (253)
 91 KOG0667|consensus               93.6   0.073 1.6E-06   55.3   4.1   36   43-78    307-343 (586)
 92 KOG0658|consensus               93.6   0.042   9E-07   53.8   2.1   31   44-74    144-174 (364)
 93 cd08528 STKc_Nek10 Catalytic d  93.5     0.1 2.3E-06   47.1   4.7   32   43-75    132-163 (269)
 94 COG0478 RIO-like serine/threon  93.5     0.1 2.2E-06   49.9   4.5   29   43-72    220-248 (304)
 95 cd08223 STKc_Nek4 Catalytic do  93.4    0.11 2.3E-06   46.4   4.5   31   44-75    121-151 (257)
 96 cd08215 STKc_Nek Catalytic dom  93.4   0.082 1.8E-06   46.7   3.6   32   44-76    122-153 (258)
 97 cd05604 STKc_SGK3 Catalytic do  93.4   0.089 1.9E-06   49.6   4.0   31   44-75    115-145 (325)
 98 cd05069 PTKc_Yes Catalytic dom  93.3   0.094   2E-06   47.3   4.0   31   44-75    121-151 (260)
 99 KOG0599|consensus               93.3   0.076 1.7E-06   50.8   3.4   41   44-85    142-182 (411)
100 cd05068 PTKc_Frk_like Catalyti  93.2   0.095 2.1E-06   47.2   3.9   32   44-76    122-153 (261)
101 cd06649 PKc_MEK2 Catalytic dom  93.2    0.11 2.4E-06   49.2   4.5   29   45-74    124-152 (331)
102 KOG0603|consensus               93.2     0.1 2.3E-06   54.2   4.5   36   44-79    434-469 (612)
103 smart00219 TyrKc Tyrosine kina  93.2    0.13 2.9E-06   45.6   4.7   32   44-76    122-153 (258)
104 cd08217 STKc_Nek2 Catalytic do  93.2     0.1 2.2E-06   46.4   3.9   33   43-76    128-160 (265)
105 cd05614 STKc_MSK2_N N-terminal  93.2     0.1 2.2E-06   49.2   4.1   30   44-74    124-153 (332)
106 cd05573 STKc_ROCK_NDR_like Cat  93.2   0.072 1.5E-06   50.4   3.1   31   44-75    120-150 (350)
107 cd06622 PKc_MAPKK_PBS2_like Ca  93.1     0.1 2.2E-06   47.7   3.9   30   44-74    122-151 (286)
108 KOG0594|consensus               93.1   0.055 1.2E-06   52.5   2.2   32   42-74    137-168 (323)
109 cd07863 STKc_CDK4 Catalytic do  93.1   0.081 1.8E-06   48.3   3.2   31   44-75    127-157 (288)
110 cd05586 STKc_Sck1_like Catalyt  93.1   0.099 2.1E-06   49.3   3.9   31   44-75    115-145 (330)
111 PRK09188 serine/threonine prot  93.0   0.066 1.4E-06   52.8   2.7   35   44-79    130-165 (365)
112 cd05585 STKc_YPK1_like Catalyt  93.0    0.11 2.4E-06   48.6   4.1   31   44-75    112-142 (312)
113 cd06616 PKc_MKK4 Catalytic dom  93.0   0.096 2.1E-06   47.9   3.5   30   44-74    127-156 (288)
114 cd00192 PTKc Catalytic domain   92.9    0.12 2.6E-06   45.8   4.0   33   44-77    124-156 (262)
115 cd05603 STKc_SGK2 Catalytic do  92.9    0.11 2.5E-06   48.7   4.0   31   44-75    115-145 (321)
116 cd05082 PTKc_Csk Catalytic dom  92.9    0.13 2.7E-06   46.2   4.1   31   44-75    121-151 (256)
117 cd06650 PKc_MEK1 Catalytic dom  92.8    0.13 2.9E-06   48.8   4.4   29   45-74    124-152 (333)
118 cd05571 STKc_PKB Catalytic dom  92.8    0.12 2.7E-06   48.7   4.1   31   44-75    114-144 (323)
119 PHA02882 putative serine/threo  92.8   0.064 1.4E-06   49.8   2.2   30   44-74    145-174 (294)
120 cd05627 STKc_NDR2 Catalytic do  92.8   0.055 1.2E-06   51.9   1.7   30   44-74    120-149 (360)
121 PTZ00263 protein kinase A cata  92.8    0.12 2.5E-06   49.0   3.9   31   44-75    137-167 (329)
122 cd05601 STKc_CRIK Catalytic do  92.7   0.058 1.3E-06   50.8   1.8   30   44-74    121-150 (330)
123 PRK10345 hypothetical protein;  92.7    0.23   5E-06   45.1   5.6   45   26-74    110-157 (210)
124 cd05602 STKc_SGK1 Catalytic do  92.7    0.11 2.4E-06   49.0   3.6   30   44-74    115-144 (325)
125 cd05621 STKc_ROCK2 Catalytic d  92.7   0.059 1.3E-06   52.3   1.8   31   44-75    161-191 (370)
126 cd06617 PKc_MKK3_6 Catalytic d  92.7    0.14   3E-06   46.6   4.1   31   44-75    123-153 (283)
127 cd05591 STKc_nPKC_epsilon Cata  92.6    0.13 2.8E-06   48.4   4.0   30   44-74    115-144 (321)
128 cd05083 PTKc_Chk Catalytic dom  92.6   0.064 1.4E-06   48.1   1.8   32   44-76    119-150 (254)
129 cd05628 STKc_NDR1 Catalytic do  92.5   0.064 1.4E-06   51.6   1.8   31   44-75    120-150 (363)
130 cd05624 STKc_MRCK_beta Catalyt  92.5    0.12 2.6E-06   49.0   3.7   30   44-74    121-150 (331)
131 cd05584 STKc_p70S6K Catalytic   92.5    0.13 2.9E-06   48.4   3.9   30   44-74    119-148 (323)
132 cd05070 PTKc_Fyn_Yrk Catalytic  92.5    0.12 2.7E-06   46.4   3.5   31   44-75    121-151 (260)
133 cd05575 STKc_SGK Catalytic dom  92.5    0.14   3E-06   48.2   4.0   30   44-74    115-144 (323)
134 PTZ00036 glycogen synthase kin  92.5    0.15 3.1E-06   51.0   4.3   31   44-74    189-219 (440)
135 cd06618 PKc_MKK7 Catalytic dom  92.4    0.12 2.6E-06   47.7   3.4   29   45-74    135-163 (296)
136 PLN00034 mitogen-activated pro  92.4    0.14   3E-06   49.0   4.0   31   44-75    187-217 (353)
137 cd05052 PTKc_Abl Catalytic dom  92.4    0.16 3.4E-06   45.9   4.1   31   44-75    123-153 (263)
138 cd05587 STKc_cPKC Catalytic do  92.4    0.15 3.1E-06   48.1   4.0   30   44-74    120-149 (324)
139 cd05598 STKc_LATS Catalytic do  92.4    0.14   3E-06   49.3   4.0   30   44-74    120-149 (376)
140 cd05590 STKc_nPKC_eta Catalyti  92.4    0.15 3.2E-06   48.2   4.0   31   44-75    115-145 (320)
141 cd05574 STKc_phototropin_like   92.3    0.17 3.8E-06   47.0   4.3   33   44-77    122-154 (316)
142 PTZ00267 NIMA-related protein   92.2    0.19 4.1E-06   50.7   4.8   31   44-75    188-218 (478)
143 cd07871 STKc_PCTAIRE3 Catalyti  92.2     0.1 2.2E-06   48.2   2.6   30   44-74    122-151 (288)
144 cd05153 HomoserineK_II Homoser  92.2   0.098 2.1E-06   48.8   2.6   34  208-244    91-124 (296)
145 cd07862 STKc_CDK6 Catalytic do  92.2    0.14 3.1E-06   46.8   3.6   31   44-75    129-159 (290)
146 PTZ00426 cAMP-dependent protei  92.2    0.15 3.2E-06   48.9   3.9   31   44-75    150-180 (340)
147 cd05600 STKc_Sid2p_Dbf2p Catal  92.1    0.14 3.1E-06   48.3   3.6   32   44-76    120-151 (333)
148 cd05597 STKc_DMPK_like Catalyt  92.1    0.17 3.8E-06   47.9   4.2   30   44-74    121-150 (331)
149 cd05593 STKc_PKB_gamma Catalyt  92.1    0.16 3.5E-06   48.2   3.9   31   44-75    114-144 (328)
150 cd05595 STKc_PKB_beta Catalyti  92.1    0.14   3E-06   48.4   3.5   30   44-74    114-143 (323)
151 cd05053 PTKc_FGFR Catalytic do  92.1    0.14 2.9E-06   47.0   3.3   31   44-75    151-181 (293)
152 cd05616 STKc_cPKC_beta Catalyt  92.1    0.15 3.3E-06   47.9   3.8   30   44-74    120-149 (323)
153 cd05629 STKc_NDR_like_fungal C  92.1    0.17 3.8E-06   48.7   4.2   30   44-74    120-149 (377)
154 cd05625 STKc_LATS1 Catalytic d  92.0    0.17 3.6E-06   49.0   4.0   30   44-74    120-149 (382)
155 PLN03225 Serine/threonine-prot  92.0   0.087 1.9E-06   54.8   2.2   31   44-74    274-304 (566)
156 cd05620 STKc_nPKC_delta Cataly  92.0    0.15 3.3E-06   48.0   3.6   30   44-74    115-144 (316)
157 KOG4250|consensus               92.0    0.18 3.9E-06   53.3   4.4   32   43-74    138-172 (732)
158 cd05623 STKc_MRCK_alpha Cataly  92.0    0.18 3.9E-06   47.7   4.2   30   44-74    121-150 (332)
159 cd05096 PTKc_DDR1 Catalytic do  92.0    0.17 3.7E-06   46.9   3.9   29   45-74    158-186 (304)
160 cd05071 PTKc_Src Catalytic dom  92.0    0.16 3.5E-06   46.0   3.6   31   44-75    121-151 (262)
161 cd06623 PKc_MAPKK_plant_like C  92.0    0.17 3.6E-06   45.2   3.7   52   23-75     98-149 (264)
162 cd07859 STKc_TDY_MAPK_plant Ca  91.9    0.15 3.3E-06   47.7   3.5   30   44-74    122-151 (338)
163 cd05039 PTKc_Csk_like Catalyti  91.9   0.091   2E-06   47.1   1.9   33   43-76    120-152 (256)
164 cd06627 STKc_Cdc7_like Catalyt  91.9    0.18 3.9E-06   44.6   3.8   52   23-76     98-149 (254)
165 cd05612 STKc_PRKX_like Catalyt  91.9   0.087 1.9E-06   48.8   1.8   30   44-74    120-149 (291)
166 cd05108 PTKc_EGFR Catalytic do  91.9    0.21 4.7E-06   46.6   4.4   31   44-75    128-158 (316)
167 KOG0608|consensus               91.8    0.19   4E-06   53.1   4.1   32   42-74    746-777 (1034)
168 PRK04750 ubiB putative ubiquin  91.8     0.1 2.2E-06   54.1   2.3   36   43-79    278-317 (537)
169 cd05582 STKc_RSK_N N-terminal   91.8    0.19 4.2E-06   47.1   4.0   31   44-75    117-147 (318)
170 cd05038 PTKc_Jak_rpt2 Catalyti  91.7    0.18 3.9E-06   45.6   3.6   33   44-77    128-160 (284)
171 PHA03212 serine/threonine kina  91.7    0.19 4.2E-06   49.3   4.1   30   44-74    201-230 (391)
172 cd05618 STKc_aPKC_iota Catalyt  91.7     0.2 4.3E-06   47.6   4.1   31   44-75    115-145 (329)
173 cd07869 STKc_PFTAIRE1 Catalyti  91.7   0.073 1.6E-06   49.4   1.1   30   44-74    122-151 (303)
174 cd07834 STKc_MAPK Catalytic do  91.7    0.18 3.8E-06   47.3   3.6   34   44-78    122-155 (330)
175 cd05617 STKc_aPKC_zeta Catalyt  91.7    0.19 4.1E-06   47.6   3.9   30   44-74    115-144 (327)
176 cd05084 PTKc_Fes Catalytic dom  91.7   0.096 2.1E-06   46.8   1.8   31   44-75    113-143 (252)
177 cd05060 PTKc_Syk_like Catalyti  91.6    0.24 5.1E-06   44.5   4.3   31   44-75    114-144 (257)
178 cd07872 STKc_PCTAIRE2 Catalyti  91.6   0.078 1.7E-06   49.4   1.2   31   44-75    123-153 (309)
179 KOG0592|consensus               91.6    0.22 4.8E-06   51.3   4.4   36   43-79    192-227 (604)
180 cd05040 PTKc_Ack_like Catalyti  91.5     0.2 4.4E-06   44.7   3.7   31   44-75    116-146 (257)
181 cd05034 PTKc_Src_like Catalyti  91.5    0.19 4.2E-06   45.0   3.6   31   44-75    122-152 (261)
182 cd05041 PTKc_Fes_like Catalyti  91.5    0.24 5.3E-06   44.1   4.2   31   44-75    112-142 (251)
183 cd06615 PKc_MEK Catalytic doma  91.5    0.21 4.6E-06   46.6   3.9   30   44-74    119-148 (308)
184 cd05599 STKc_NDR_like Catalyti  91.5     0.2 4.4E-06   47.8   3.9   31   44-75    120-150 (364)
185 cd05592 STKc_nPKC_theta_delta   91.5   0.091   2E-06   49.5   1.5   31   44-75    115-145 (316)
186 cd06656 STKc_PAK3 Catalytic do  91.5   0.074 1.6E-06   49.4   0.8   31   44-75    134-164 (297)
187 cd05091 PTKc_Ror2 Catalytic do  91.5    0.17 3.8E-06   46.1   3.3   31   44-75    143-173 (283)
188 PHA03209 serine/threonine kina  91.4    0.21 4.6E-06   48.0   4.0   31   44-75    176-206 (357)
189 KOG3087|consensus               91.4    0.33 7.2E-06   44.2   4.9   34   43-76    131-166 (229)
190 cd05580 STKc_PKA Catalytic dom  91.4    0.19 4.1E-06   46.3   3.5   31   44-75    120-150 (290)
191 cd07875 STKc_JNK1 Catalytic do  91.4   0.099 2.2E-06   50.1   1.7   31   44-75    145-175 (364)
192 cd05622 STKc_ROCK1 Catalytic d  91.4    0.11 2.5E-06   50.3   2.1   31   44-75    161-191 (371)
193 cd07878 STKc_p38beta_MAPK11 Ca  91.4    0.11 2.4E-06   49.2   2.0   31   44-75    137-167 (343)
194 cd05054 PTKc_VEGFR Catalytic d  91.3    0.24 5.3E-06   47.2   4.2   30   44-74    192-221 (337)
195 cd05102 PTKc_VEGFR3 Catalytic   91.3    0.14 3.1E-06   48.3   2.6   30   44-74    193-222 (338)
196 cd05631 STKc_GRK4 Catalytic do  91.3    0.11 2.4E-06   47.8   1.8   31   44-75    121-151 (285)
197 cd07868 STKc_CDK8 Catalytic do  91.3    0.19 4.2E-06   46.7   3.5   31   44-74    127-160 (317)
198 cd05626 STKc_LATS2 Catalytic d  91.3    0.22 4.7E-06   48.3   3.9   30   44-74    120-149 (381)
199 cd07876 STKc_JNK2 Catalytic do  91.3   0.088 1.9E-06   50.4   1.2   31   44-75    142-172 (359)
200 cd07832 STKc_CCRK Catalytic do  91.3     0.2 4.3E-06   45.5   3.5   32   44-76    118-149 (286)
201 KOG0588|consensus               91.3    0.12 2.6E-06   54.4   2.2   49   30-79    115-165 (786)
202 cd05109 PTKc_HER2 Catalytic do  91.3    0.12 2.6E-06   47.2   2.0   31   44-75    128-158 (279)
203 cd05062 PTKc_IGF-1R Catalytic   91.2    0.23 5.1E-06   45.1   3.9   31   44-75    138-168 (277)
204 cd05088 PTKc_Tie2 Catalytic do  91.2    0.19 4.1E-06   46.8   3.4   31   43-74    142-172 (303)
205 cd05085 PTKc_Fer Catalytic dom  91.2    0.13 2.7E-06   45.9   2.0   31   44-75    112-142 (250)
206 cd07853 STKc_NLK Catalytic dom  91.2    0.24 5.1E-06   47.7   4.0   31   44-75    122-152 (372)
207 cd05613 STKc_MSK1_N N-terminal  91.1    0.26 5.6E-06   45.2   4.1   31   44-75    124-154 (290)
208 cd07874 STKc_JNK3 Catalytic do  91.1    0.11 2.3E-06   49.7   1.5   31   44-75    138-168 (355)
209 cd05632 STKc_GRK5 Catalytic do  91.1    0.21 4.4E-06   46.1   3.4   31   44-75    121-151 (285)
210 smart00220 S_TKc Serine/Threon  91.1    0.18 3.9E-06   43.7   2.9   35   44-79    106-140 (244)
211 cd05113 PTKc_Btk_Bmx Catalytic  91.1    0.25 5.4E-06   44.6   3.8   31   44-75    119-149 (256)
212 cd05075 PTKc_Axl Catalytic dom  91.0    0.11 2.4E-06   46.9   1.5   31   44-75    131-161 (272)
213 cd05118 STKc_CMGC Catalytic do  91.0    0.29 6.3E-06   44.2   4.3   33   44-77    117-149 (283)
214 cd05148 PTKc_Srm_Brk Catalytic  91.0    0.23 5.1E-06   44.5   3.6   31   44-75    123-153 (261)
215 cd05080 PTKc_Tyk2_rpt2 Catalyt  91.0    0.15 3.3E-06   46.6   2.4   32   44-76    126-157 (283)
216 cd05094 PTKc_TrkC Catalytic do  91.0    0.25 5.4E-06   45.5   3.9   32   43-75    141-172 (291)
217 COG0661 AarF Predicted unusual  91.0    0.16 3.5E-06   52.4   2.8   33   43-76    283-315 (517)
218 cd05578 STKc_Yank1 Catalytic d  91.0    0.23 4.9E-06   44.6   3.5   32   44-76    119-150 (258)
219 cd05089 PTKc_Tie1 Catalytic do  91.0    0.23 4.9E-06   46.0   3.6   30   44-74    138-167 (297)
220 cd05155 APH_ChoK_like_1 Unchar  90.9    0.36 7.8E-06   43.7   4.8   39  207-245    70-109 (235)
221 cd05583 STKc_MSK_N N-terminal   90.9     0.2 4.3E-06   45.9   3.1   31   44-75    124-154 (288)
222 cd08219 STKc_Nek3 Catalytic do  90.9    0.29 6.3E-06   43.8   4.1   31   43-74    118-148 (255)
223 cd06644 STKc_STK10_LOK Catalyt  90.9    0.34 7.3E-06   44.5   4.6   31   43-74    128-158 (292)
224 cd05066 PTKc_EphR_A Catalytic   90.9    0.24 5.2E-06   44.8   3.5   31   44-75    125-155 (267)
225 cd07866 STKc_BUR1 Catalytic do  90.8    0.19   4E-06   46.2   2.9   31   44-75    134-164 (311)
226 cd05093 PTKc_TrkB Catalytic do  90.8    0.28 6.1E-06   45.0   4.1   31   44-75    139-169 (288)
227 TIGR02457 TreS_Cterm trehalose  90.8    0.36 7.9E-06   49.9   5.2   44   45-90    380-432 (528)
228 cd05037 PTK_Jak_rpt1 Pseudokin  90.8    0.32 6.8E-06   43.4   4.3   32   44-75    120-157 (259)
229 cd05042 PTKc_Aatyk Catalytic d  90.8    0.13 2.9E-06   46.5   1.8   30   44-74    119-148 (269)
230 cd05047 PTKc_Tie Catalytic dom  90.8    0.29 6.3E-06   44.4   4.1   30   44-74    131-160 (270)
231 cd05112 PTKc_Itk Catalytic dom  90.8    0.25 5.4E-06   44.1   3.5   30   44-74    119-148 (256)
232 cd05116 PTKc_Syk Catalytic dom  90.7    0.33 7.2E-06   43.6   4.4   31   44-75    114-144 (257)
233 cd05588 STKc_aPKC Catalytic do  90.7    0.11 2.5E-06   49.1   1.3   31   44-75    115-145 (329)
234 cd05123 STKc_AGC Catalytic dom  90.7     0.4 8.6E-06   42.5   4.8   32   44-76    112-143 (250)
235 cd05607 STKc_GRK7 Catalytic do  90.7    0.17 3.7E-06   46.4   2.4   31   44-75    114-144 (277)
236 cd06648 STKc_PAK_II Catalytic   90.7    0.25 5.4E-06   45.5   3.5   30   44-74    134-163 (285)
237 cd05589 STKc_PKN Catalytic dom  90.7    0.25 5.5E-06   46.5   3.7   31   44-75    120-150 (324)
238 PLN00009 cyclin-dependent kina  90.7    0.51 1.1E-05   43.3   5.6   30   45-74    122-151 (294)
239 cd05596 STKc_ROCK Catalytic do  90.6    0.13 2.9E-06   49.8   1.7   30   44-74    161-190 (370)
240 KOG0581|consensus               90.6    0.25 5.4E-06   48.5   3.6   36   43-79    197-232 (364)
241 cd07841 STKc_CDK7 Catalytic do  90.6     0.3 6.4E-06   44.9   4.0   51   23-75    101-151 (298)
242 PHA03210 serine/threonine kina  90.6    0.27 5.8E-06   50.0   4.0   30   44-74    286-315 (501)
243 cd05633 STKc_GRK3 Catalytic do  90.6    0.24 5.1E-06   45.6   3.3   30   44-74    116-145 (279)
244 cd05608 STKc_GRK1 Catalytic do  90.6    0.12 2.6E-06   47.5   1.3   30   44-74    116-145 (280)
245 cd05059 PTKc_Tec_like Catalyti  90.6    0.28 6.1E-06   44.0   3.7   30   45-75    120-149 (256)
246 COG3642 Mn2+-dependent serine/  90.6    0.26 5.6E-06   44.7   3.4   59  186-244    51-113 (204)
247 cd06625 STKc_MEKK3_like Cataly  90.5    0.16 3.4E-06   45.5   2.0   31   44-75    123-153 (263)
248 cd08220 STKc_Nek8 Catalytic do  90.5    0.26 5.5E-06   43.9   3.4   32   44-75    120-151 (256)
249 cd07857 STKc_MPK1 Catalytic do  90.5    0.23 4.9E-06   46.9   3.2   30   44-74    124-153 (332)
250 cd05111 PTK_HER3 Pseudokinase   90.5    0.38 8.3E-06   44.0   4.6   31   44-75    128-158 (279)
251 cd07873 STKc_PCTAIRE1 Catalyti  90.5    0.11 2.5E-06   48.0   1.1   31   44-75    123-153 (301)
252 cd05099 PTKc_FGFR4 Catalytic d  90.4    0.18 3.8E-06   47.2   2.3   31   44-75    153-183 (314)
253 PHA03207 serine/threonine kina  90.4     0.2 4.2E-06   48.9   2.7   30   44-74    204-233 (392)
254 cd05056 PTKc_FAK Catalytic dom  90.3    0.32   7E-06   44.0   3.9   31   44-75    126-156 (270)
255 cd05079 PTKc_Jak1_rpt2 Catalyt  90.3    0.16 3.5E-06   46.5   1.9   32   43-75    127-158 (284)
256 cd06624 STKc_ASK Catalytic dom  90.3    0.18 3.8E-06   45.6   2.1   31   44-74    127-157 (268)
257 cd05114 PTKc_Tec_Rlk Catalytic  90.3    0.29 6.2E-06   43.9   3.5   31   44-75    119-149 (256)
258 cd08221 STKc_Nek9 Catalytic do  90.3    0.27 5.9E-06   43.9   3.4   32   44-76    120-151 (256)
259 cd05057 PTKc_EGFR_like Catalyt  90.2    0.34 7.4E-06   44.1   4.0   32   44-76    128-159 (279)
260 cd05581 STKc_PDK1 Catalytic do  90.2    0.22 4.8E-06   44.8   2.7   32   43-75    120-151 (280)
261 cd05579 STKc_MAST_like Catalyt  90.1    0.28 6.1E-06   43.6   3.3   32   44-76    112-143 (265)
262 cd05033 PTKc_EphR Catalytic do  90.1    0.16 3.4E-06   45.9   1.7   32   44-76    125-156 (266)
263 cd06613 STKc_MAP4K3_like Catal  90.1    0.18 3.8E-06   45.1   2.0   31   44-75    120-150 (262)
264 cd07839 STKc_CDK5 Catalytic do  90.1    0.31 6.7E-06   44.3   3.6   30   44-74    118-147 (284)
265 cd08529 STKc_FA2-like Catalyti  90.1    0.35 7.5E-06   43.0   3.8   31   44-75    120-150 (256)
266 PTZ00284 protein kinase; Provi  90.0     0.3 6.6E-06   48.8   3.7   31   44-74    251-296 (467)
267 cd05615 STKc_cPKC_alpha Cataly  89.9    0.15 3.3E-06   48.1   1.5   30   44-74    120-149 (323)
268 cd05049 PTKc_Trk Catalytic dom  89.9    0.38 8.2E-06   43.6   4.0   30   44-74    141-170 (280)
269 cd05048 PTKc_Ror Catalytic Dom  89.9    0.34 7.4E-06   44.0   3.7   31   44-75    143-173 (283)
270 cd05095 PTKc_DDR2 Catalytic do  89.9    0.44 9.6E-06   43.9   4.5   30   44-74    149-178 (296)
271 cd06638 STKc_myosinIIIA Cataly  89.9    0.16 3.4E-06   46.3   1.5   31   44-75    143-173 (286)
272 cd05097 PTKc_DDR_like Catalyti  89.8    0.33 7.1E-06   44.8   3.6   31   44-75    148-178 (295)
273 cd07848 STKc_CDKL5 Catalytic d  89.8    0.17 3.6E-06   46.3   1.6   31   44-75    119-149 (287)
274 KOG0616|consensus               89.8    0.45 9.9E-06   46.0   4.5   45   26-75    149-193 (355)
275 cd07845 STKc_CDK10 Catalytic d  89.8    0.35 7.5E-06   44.9   3.7   30   45-75    128-157 (309)
276 cd08216 PK_STRAD Pseudokinase   89.7    0.39 8.5E-06   44.5   4.1   31   44-75    120-150 (314)
277 cd06652 STKc_MEKK2 Catalytic d  89.7    0.34 7.3E-06   43.7   3.5   31   44-75    125-155 (265)
278 PHA03390 pk1 serine/threonine-  89.7     0.5 1.1E-05   43.1   4.7   32   44-75    128-159 (267)
279 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  89.7    0.19 4.1E-06   45.9   1.8   31   44-75    127-157 (284)
280 cd07867 STKc_CDC2L6 Catalytic   89.7    0.39 8.4E-06   44.5   3.9   32   44-75    127-161 (317)
281 cd06641 STKc_MST3 Catalytic do  89.6    0.52 1.1E-05   42.9   4.7   32   43-75    119-150 (277)
282 cd06614 STKc_PAK Catalytic dom  89.6    0.39 8.4E-06   43.9   3.9   30   44-74    135-164 (286)
283 smart00221 STYKc Protein kinas  89.6    0.34 7.5E-06   41.7   3.4   32   45-77    118-149 (225)
284 cd05115 PTKc_Zap-70 Catalytic   89.6    0.42 9.1E-06   43.2   4.0   30   44-74    114-143 (257)
285 cd05035 PTKc_Axl_like Catalyti  89.6    0.21 4.5E-06   44.9   2.0   30   44-74    132-161 (273)
286 cd06654 STKc_PAK1 Catalytic do  89.6    0.25 5.4E-06   45.8   2.6   31   44-75    135-165 (296)
287 cd06655 STKc_PAK2 Catalytic do  89.5    0.26 5.6E-06   45.8   2.7   31   44-75    134-164 (296)
288 KOG1163|consensus               89.5    0.51 1.1E-05   44.6   4.5   38   43-83    129-168 (341)
289 cd05073 PTKc_Hck Catalytic dom  89.5    0.34 7.4E-06   43.6   3.4   30   44-74    121-150 (260)
290 cd05619 STKc_nPKC_theta Cataly  89.5    0.17 3.7E-06   47.7   1.4   31   44-75    115-145 (316)
291 cd08530 STKc_CNK2-like Catalyt  89.5    0.52 1.1E-05   41.8   4.5   33   43-76    121-153 (256)
292 cd05090 PTKc_Ror1 Catalytic do  89.5    0.45 9.7E-06   43.4   4.2   31   44-75    143-173 (283)
293 cd05044 PTKc_c-ros Catalytic d  89.4    0.37 8.1E-06   43.3   3.6   31   44-75    125-160 (269)
294 cd06608 STKc_myosinIII_like Ca  89.4    0.42 9.1E-06   42.8   3.9   32   44-76    132-163 (275)
295 cd08228 STKc_Nek6 Catalytic do  89.4     0.4 8.6E-06   43.1   3.7   32   43-75    124-155 (267)
296 cd06630 STKc_MEKK1 Catalytic d  89.4    0.37   8E-06   43.2   3.5   33   44-76    122-154 (268)
297 PHA03211 serine/threonine kina  89.4    0.39 8.4E-06   48.7   4.0   31   44-75    279-309 (461)
298 cd05576 STKc_RPK118_like Catal  89.4    0.32 6.9E-06   43.5   3.1   29   44-73    104-132 (237)
299 cd07837 STKc_CdkB_plant Cataly  89.3    0.58 1.3E-05   42.8   4.8   31   44-74    129-159 (295)
300 cd05098 PTKc_FGFR1 Catalytic d  89.3    0.27 5.9E-06   45.7   2.6   31   44-75    159-189 (307)
301 cd05609 STKc_MAST Catalytic do  89.2    0.21 4.5E-06   46.4   1.8   31   44-75    120-150 (305)
302 cd07870 STKc_PFTAIRE2 Catalyti  89.2     0.2 4.3E-06   46.0   1.6   30   44-74    122-151 (291)
303 cd05087 PTKc_Aatyk1_Aatyk3 Cat  89.2    0.53 1.2E-05   42.6   4.4   30   44-74    119-148 (269)
304 cd05074 PTKc_Tyro3 Catalytic d  89.2    0.45 9.8E-06   42.9   3.9   30   44-74    132-161 (273)
305 cd05050 PTKc_Musk Catalytic do  89.2    0.35 7.5E-06   44.3   3.2   30   44-74    149-178 (288)
306 cd05101 PTKc_FGFR2 Catalytic d  89.2    0.44 9.4E-06   44.1   3.9   30   44-74    156-185 (304)
307 cd05605 STKc_GRK4_like Catalyt  89.1     0.2 4.3E-06   46.1   1.6   31   44-75    121-151 (285)
308 cd05570 STKc_PKC Catalytic dom  89.1    0.33 7.2E-06   45.6   3.1   31   44-75    115-145 (318)
309 cd05072 PTKc_Lyn Catalytic dom  89.1    0.37 8.1E-06   43.2   3.3   31   44-75    122-152 (261)
310 cd05051 PTKc_DDR Catalytic dom  89.1    0.37 7.9E-06   44.1   3.3   30   44-74    149-178 (296)
311 cd05572 STKc_cGK_PKG Catalytic  89.1    0.41 8.9E-06   43.0   3.6   32   44-76    112-143 (262)
312 cd06637 STKc_TNIK Catalytic do  89.0    0.16 3.4E-06   45.8   0.8   30   45-75    131-160 (272)
313 cd05067 PTKc_Lck_Blk Catalytic  89.0    0.46   1E-05   42.7   3.8   32   44-76    121-152 (260)
314 cd07833 STKc_CDKL Catalytic do  89.0    0.58 1.3E-05   42.4   4.5   33   44-77    119-151 (288)
315 cd05032 PTKc_InsR_like Catalyt  88.9    0.43 9.2E-06   43.2   3.6   31   43-74    137-167 (277)
316 cd05106 PTKc_CSF-1R Catalytic   88.9    0.67 1.5E-05   45.0   5.2   30   44-74    231-260 (374)
317 cd05058 PTKc_Met_Ron Catalytic  88.9    0.23 4.9E-06   44.6   1.7   30   44-74    117-146 (262)
318 cd07850 STKc_JNK Catalytic dom  88.9    0.46   1E-05   45.3   3.9   31   44-75    137-167 (353)
319 KOG0598|consensus               88.9    0.34 7.4E-06   47.5   3.0   39   44-83    144-182 (357)
320 cd05606 STKc_beta_ARK Catalyti  88.9    0.42 9.2E-06   43.8   3.6   30   44-74    116-145 (278)
321 cd06629 STKc_MAPKKK_Bck1_like   88.8    0.71 1.5E-05   41.7   5.0   32   44-76    127-158 (272)
322 cd06639 STKc_myosinIIIB Cataly  88.8    0.43 9.3E-06   43.7   3.6   31   44-75    147-177 (291)
323 cd06610 STKc_OSR1_SPAK Catalyt  88.8     0.4 8.7E-06   42.8   3.3   32   43-75    120-151 (267)
324 cd06643 STKc_SLK Catalytic dom  88.8     0.3 6.5E-06   44.5   2.5   31   44-75    122-152 (282)
325 cd07880 STKc_p38gamma_MAPK12 C  88.8    0.42   9E-06   45.5   3.5   31   44-75    137-167 (343)
326 cd07843 STKc_CDC2L1 Catalytic   88.8     0.5 1.1E-05   43.3   4.0   29   45-74    126-154 (293)
327 cd08225 STKc_Nek5 Catalytic do  88.8    0.33 7.2E-06   43.1   2.7   32   44-75    120-151 (257)
328 cd07849 STKc_ERK1_2_like Catal  88.7    0.39 8.4E-06   45.4   3.2   30   45-75    126-155 (336)
329 cd07861 STKc_CDK1_euk Catalyti  88.7    0.35 7.7E-06   43.9   2.9   31   44-75    120-150 (285)
330 cd07838 STKc_CDK4_6_like Catal  88.6    0.66 1.4E-05   42.0   4.6   30   45-75    127-156 (287)
331 cd06635 STKc_TAO1 Catalytic do  88.6    0.29 6.3E-06   45.8   2.3   31   44-75    144-174 (317)
332 cd07846 STKc_CDKL2_3 Catalytic  88.6     0.4 8.7E-06   43.5   3.2   31   44-75    119-149 (286)
333 cd06619 PKc_MKK5 Catalytic dom  88.5    0.25 5.5E-06   45.1   1.8   30   44-74    114-143 (279)
334 cd06646 STKc_MAP4K5 Catalytic   88.5    0.21 4.6E-06   45.0   1.3   31   44-75    125-155 (267)
335 cd05086 PTKc_Aatyk2 Catalytic   88.5    0.31 6.8E-06   44.2   2.4   29   45-74    119-147 (268)
336 cd06631 STKc_YSK4 Catalytic do  88.4    0.55 1.2E-05   42.2   4.0   30   45-75    122-151 (265)
337 cd08229 STKc_Nek7 Catalytic do  88.4    0.23 5.1E-06   44.6   1.5   31   44-75    125-155 (267)
338 cd05630 STKc_GRK6 Catalytic do  88.4    0.26 5.6E-06   45.5   1.8   31   44-75    121-151 (285)
339 cd07847 STKc_CDKL1_4 Catalytic  88.3    0.51 1.1E-05   42.8   3.7   32   44-76    119-150 (286)
340 cd08224 STKc_Nek6_Nek7 Catalyt  88.3    0.29 6.2E-06   43.8   2.0   31   44-75    125-155 (267)
341 cd06657 STKc_PAK4 Catalytic do  88.2    0.38 8.1E-06   44.7   2.8   30   44-74    135-164 (292)
342 cd07836 STKc_Pho85 Catalytic d  88.2    0.44 9.6E-06   43.2   3.2   30   44-74    119-148 (284)
343 cd06658 STKc_PAK5 Catalytic do  88.2    0.51 1.1E-05   43.7   3.6   29   45-74    138-166 (292)
344 cd08218 STKc_Nek1 Catalytic do  88.2    0.57 1.2E-05   41.8   3.8   31   44-75    120-150 (256)
345 cd07844 STKc_PCTAIRE_like Cata  88.2    0.21 4.6E-06   45.7   1.1   30   44-74    122-151 (291)
346 cd06640 STKc_MST4 Catalytic do  88.1    0.55 1.2E-05   42.8   3.8   30   44-74    120-149 (277)
347 cd06612 STKc_MST1_2 Catalytic   88.1    0.31 6.7E-06   43.3   2.0   31   44-75    118-148 (256)
348 cd05100 PTKc_FGFR3 Catalytic d  88.1     0.3 6.6E-06   46.1   2.1   30   44-74    153-182 (334)
349 cd06645 STKc_MAP4K3 Catalytic   88.1    0.23   5E-06   44.8   1.2   29   45-74    126-154 (267)
350 cd05110 PTKc_HER4 Catalytic do  88.1     0.3 6.6E-06   45.3   2.0   31   44-75    128-158 (303)
351 cd07835 STKc_CDK1_like Catalyt  88.0    0.46   1E-05   43.2   3.2   30   44-74    118-147 (283)
352 cd05103 PTKc_VEGFR2 Catalytic   88.0     0.4 8.6E-06   45.7   2.9   32   43-75    197-228 (343)
353 cd06917 STKc_NAK1_like Catalyt  88.0    0.44 9.5E-06   43.2   3.0   31   44-75    120-150 (277)
354 PTZ00283 serine/threonine prot  88.0    0.29 6.2E-06   49.9   2.0   30   44-74    162-191 (496)
355 cd05611 STKc_Rim15_like Cataly  88.0    0.66 1.4E-05   41.6   4.1   31   44-75    116-146 (260)
356 cd06651 STKc_MEKK3 Catalytic d  87.9    0.56 1.2E-05   42.3   3.7   30   44-74    125-154 (266)
357 cd06659 STKc_PAK6 Catalytic do  87.8    0.54 1.2E-05   43.7   3.6   30   44-74    136-165 (297)
358 cd05610 STKc_MASTL Catalytic d  87.8     0.6 1.3E-05   49.4   4.3   30   45-75    124-153 (669)
359 cd05063 PTKc_EphR_A2 Catalytic  87.7    0.51 1.1E-05   42.5   3.2   30   44-74    126-155 (268)
360 cd05055 PTKc_PDGFR Catalytic d  87.7     0.3 6.4E-06   45.5   1.7   30   44-74    160-189 (302)
361 cd06606 STKc_MAPKKK Catalytic   87.6    0.38 8.3E-06   42.3   2.3   34   44-78    120-153 (260)
362 cd05061 PTKc_InsR Catalytic do  87.5     0.3 6.6E-06   44.8   1.7   30   44-74    138-167 (288)
363 cd06636 STKc_MAP4K4_6 Catalyti  87.5    0.27 5.9E-06   44.7   1.3   31   44-75    140-170 (282)
364 cd05045 PTKc_RET Catalytic dom  87.4     0.3 6.6E-06   44.8   1.6   30   44-74    146-175 (290)
365 cd06628 STKc_MAPKKK_Byr2_like   87.4    0.55 1.2E-05   42.2   3.2   30   44-74    125-154 (267)
366 cd07879 STKc_p38delta_MAPK13 C  87.3    0.29 6.2E-06   46.6   1.4   31   44-75    136-166 (342)
367 cd05092 PTKc_TrkA Catalytic do  87.3    0.51 1.1E-05   43.1   3.0   30   44-74    141-170 (280)
368 cd05577 STKc_GRK Catalytic dom  87.2    0.24 5.2E-06   45.1   0.8   30   44-74    114-143 (277)
369 cd07840 STKc_CDK9_like Catalyt  87.2    0.45 9.9E-06   42.9   2.6   32   44-76    119-150 (287)
370 cd07852 STKc_MAPK15 Catalytic   87.2    0.36 7.7E-06   45.6   2.0   30   44-74    126-155 (337)
371 cd05046 PTK_CCK4 Pseudokinase   87.2    0.85 1.9E-05   41.2   4.4   30   44-74    136-165 (275)
372 cd07865 STKc_CDK9 Catalytic do  87.2    0.51 1.1E-05   43.3   2.9   30   45-75    139-168 (310)
373 cd06607 STKc_TAO Catalytic dom  87.2    0.48   1E-05   44.0   2.8   32   44-76    134-165 (307)
374 cd06633 STKc_TAO3 Catalytic do  87.2    0.41   9E-06   44.8   2.4   31   44-75    140-170 (313)
375 cd07856 STKc_Sty1_Hog1 Catalyt  87.1     0.7 1.5E-05   43.7   4.0   31   44-75    127-157 (328)
376 KOG0198|consensus               87.0    0.84 1.8E-05   44.2   4.4   33   43-75    135-167 (313)
377 cd07855 STKc_ERK5 Catalytic do  87.0    0.69 1.5E-05   43.6   3.9   30   44-74    126-155 (334)
378 KOG0610|consensus               87.0    0.83 1.8E-05   45.9   4.4   45   27-76    185-229 (459)
379 TIGR00938 thrB_alt homoserine   87.0    0.67 1.5E-05   43.8   3.7   34  208-244   100-133 (307)
380 cd07830 STKc_MAK_like Catalyti  86.8    0.72 1.6E-05   41.8   3.7   30   44-74    118-147 (283)
381 KOG1006|consensus               86.8    0.22 4.8E-06   47.6   0.4   33   42-75    185-217 (361)
382 KOG1166|consensus               86.7    0.84 1.8E-05   50.4   4.7   30   44-73    813-848 (974)
383 cd06634 STKc_TAO2 Catalytic do  86.6    0.57 1.2E-05   43.7   3.0   31   44-75    134-164 (308)
384 KOG0612|consensus               86.6    0.67 1.4E-05   51.7   3.8   55   13-73    167-222 (1317)
385 cd06621 PKc_MAPKK_Pek1_like Ca  86.6    0.39 8.4E-06   44.1   1.8   31   44-75    124-154 (287)
386 KOG0600|consensus               86.6    0.74 1.6E-05   47.2   3.9   35   42-77    235-269 (560)
387 cd05065 PTKc_EphR_B Catalytic   86.6    0.44 9.5E-06   43.0   2.1   31   44-75    125-155 (269)
388 cd05104 PTKc_Kit Catalytic dom  86.6    0.48   1E-05   46.0   2.5   30   44-74    233-262 (375)
389 cd07842 STKc_CDK8_like Catalyt  86.5     0.6 1.3E-05   43.1   3.1   32   44-75    127-161 (316)
390 cd06632 STKc_MEKK1_plant Catal  86.5    0.34 7.4E-06   43.0   1.4   31   44-75    121-151 (258)
391 cd07864 STKc_CDK12 Catalytic d  86.5    0.59 1.3E-05   42.9   3.0   31   44-75    135-165 (302)
392 cd06626 STKc_MEKK4 Catalytic d  86.2    0.33 7.2E-06   43.3   1.2   31   44-75    118-148 (264)
393 cd06653 STKc_MEKK3_like_1 Cata  86.1    0.66 1.4E-05   41.8   3.1   31   44-75    125-155 (264)
394 cd06642 STKc_STK25-YSK1 Cataly  86.1    0.52 1.1E-05   42.8   2.4   31   44-75    120-150 (277)
395 cd07860 STKc_CDK2_3 Catalytic   85.9    0.98 2.1E-05   41.0   4.2   30   44-74    119-148 (284)
396 PRK13184 pknD serine/threonine  85.8    0.98 2.1E-05   49.8   4.7   32   44-76    132-163 (932)
397 PLN03224 probable serine/threo  85.8    0.79 1.7E-05   47.2   3.8   30   44-74    328-357 (507)
398 cd07851 STKc_p38 Catalytic dom  85.8    0.86 1.9E-05   43.3   3.8   31   44-75    137-167 (343)
399 PLN00181 protein SPA1-RELATED;  85.7       1 2.3E-05   48.4   4.8   31   43-74     98-128 (793)
400 KOG0659|consensus               85.7    0.48   1E-05   45.2   2.0   33   42-75    118-150 (318)
401 cd05105 PTKc_PDGFR_alpha Catal  85.6     1.2 2.7E-05   43.9   4.9   30   44-74    256-285 (400)
402 cd07858 STKc_TEY_MAPK_plant Ca  85.4    0.83 1.8E-05   43.2   3.5   32   44-76    127-158 (337)
403 KOG1164|consensus               85.3     0.4 8.7E-06   45.8   1.3   33   42-74    139-175 (322)
404 KOG1167|consensus               85.3       1 2.2E-05   45.1   4.0   34   42-75    149-182 (418)
405 cd07877 STKc_p38alpha_MAPK14 C  85.2    0.53 1.2E-05   44.9   2.1   31   44-75    139-169 (345)
406 cd06609 STKc_MST3_like Catalyt  85.1    0.83 1.8E-05   41.3   3.2   51   23-75     97-147 (274)
407 KOG0605|consensus               85.1    0.46   1E-05   48.8   1.6   32   42-74    258-289 (550)
408 cd06620 PKc_MAPKK_Byr1_like Ca  84.9    0.77 1.7E-05   41.9   2.9   29   45-74    124-152 (284)
409 KOG0578|consensus               84.9     1.4 3.1E-05   45.5   5.0   37   43-80    387-423 (550)
410 cd05036 PTKc_ALK_LTK Catalytic  84.9     1.4 3.1E-05   40.0   4.6   31   45-75    136-168 (277)
411 cd07854 STKc_MAPK4_6 Catalytic  84.7    0.86 1.9E-05   43.3   3.2   32   44-75    133-164 (342)
412 cd07831 STKc_MOK Catalytic dom  84.4    0.55 1.2E-05   42.4   1.7   29   44-74    119-147 (282)
413 KOG2345|consensus               84.4     2.2 4.7E-05   40.5   5.6   31   45-76    149-179 (302)
414 cd05077 PTK_Jak1_rpt1 Pseudoki  84.3     1.6 3.5E-05   39.5   4.8   32   43-74    123-160 (262)
415 cd05043 PTK_Ryk Pseudokinase d  84.1    0.57 1.2E-05   42.6   1.7   30   44-74    136-165 (280)
416 cd05078 PTK_Jak2_Jak3_rpt1 Pse  84.1     1.3 2.8E-05   39.9   3.9   32   43-74    118-156 (258)
417 cd07829 STKc_CDK_like Catalyti  83.9     1.6 3.4E-05   39.4   4.5   30   45-75    118-147 (282)
418 KOG0660|consensus               83.8    0.55 1.2E-05   46.1   1.5   37   42-79    142-178 (359)
419 cd06647 STKc_PAK_I Catalytic d  83.7    0.98 2.1E-05   41.8   3.1   30   44-74    134-163 (293)
420 PTZ00024 cyclin-dependent prot  83.5     1.1 2.3E-05   42.3   3.3   31   44-75    138-168 (335)
421 PF01636 APH:  Phosphotransfera  83.4    0.38 8.2E-06   42.0   0.2   58  187-244    43-110 (239)
422 cd06611 STKc_SLK_like Catalyti  83.3     1.4 2.9E-05   40.1   3.8   31   44-75    122-152 (280)
423 KOG1187|consensus               83.0     1.4   3E-05   43.4   4.0   41   36-78    189-229 (361)
424 KOG0596|consensus               82.6    0.92   2E-05   47.2   2.6   30   43-74    478-507 (677)
425 cd05107 PTKc_PDGFR_beta Cataly  82.3    0.99 2.2E-05   44.6   2.7   29   45-74    259-287 (401)
426 KOG0593|consensus               81.9    0.84 1.8E-05   44.4   1.9   30   44-74    120-149 (396)
427 cd08222 STKc_Nek11 Catalytic d  81.8     1.3 2.8E-05   39.6   3.1   31   43-75    124-154 (260)
428 KOG0615|consensus               81.7    0.73 1.6E-05   46.3   1.5   33   43-75    294-328 (475)
429 TIGR02906 spore_CotS spore coa  81.7     1.3 2.8E-05   41.3   3.2   34  208-244    72-105 (313)
430 KOG0595|consensus               81.7     2.5 5.4E-05   42.4   5.1   42   44-85    128-174 (429)
431 KOG1235|consensus               81.5     1.1 2.3E-05   46.7   2.6   31   43-73    319-352 (538)
432 cd05146 RIO3_euk RIO kinase fa  81.5     2.8 6.2E-05   37.8   5.1   58  186-243    78-145 (197)
433 KOG3021|consensus               81.1     1.8 3.9E-05   40.6   3.7   44   42-87    208-251 (313)
434 KOG0665|consensus               80.8    0.93   2E-05   44.2   1.8   37   42-79    135-171 (369)
435 COG1718 RIO1 Serine/threonine   80.5     1.1 2.3E-05   42.5   2.0   27   44-72    186-212 (268)
436 PHA02988 hypothetical protein;  80.2     1.6 3.4E-05   40.4   3.1   28   46-74    144-171 (283)
437 cd05064 PTKc_EphR_A10 Catalyti  79.8     1.8   4E-05   39.1   3.4   30   44-74    126-155 (266)
438 cd05120 APH_ChoK_like Aminogly  79.8     1.8   4E-05   34.3   3.1   54  190-243    47-106 (155)
439 COG5072 ALK1 Serine/threonine   79.5     1.7 3.7E-05   43.6   3.2   60   23-84    317-379 (488)
440 KOG0577|consensus               78.9    0.95 2.1E-05   47.6   1.3   36   43-79    144-179 (948)
441 TIGR03724 arch_bud32 Kae1-asso  78.8     1.5 3.3E-05   38.0   2.4   57  188-244    51-111 (199)
442 PF10009 DUF2252:  Uncharacteri  78.4     8.4 0.00018   38.4   7.8   49   41-89     40-91  (385)
443 PRK10271 thiK thiamine kinase;  78.4     5.2 0.00011   36.0   5.7   56  209-269     2-57  (188)
444 KOG0582|consensus               78.0     3.2 6.8E-05   42.3   4.6   27   44-71    145-171 (516)
445 KOG0670|consensus               77.9     1.6 3.4E-05   45.4   2.4   31   44-74    555-585 (752)
446 KOG0662|consensus               77.9     2.6 5.6E-05   38.4   3.6   27   47-74    123-149 (292)
447 KOG4717|consensus               77.6     2.3 4.9E-05   44.3   3.5   47   42-88    135-181 (864)
448 KOG0032|consensus               77.5     2.2 4.8E-05   42.3   3.4   40   43-82    153-195 (382)
449 cd08227 PK_STRAD_alpha Pseudok  77.4     3.5 7.5E-05   38.7   4.6   27   44-71    120-146 (327)
450 KOG1035|consensus               77.3     2.5 5.4E-05   47.6   4.0   32   43-75    715-746 (1351)
451 PF07714 Pkinase_Tyr:  Protein   75.3     5.2 0.00011   36.2   5.0   30   46-76    124-153 (259)
452 PRK05231 homoserine kinase; Pr  75.3     3.4 7.4E-05   38.9   3.9   34  208-244    99-132 (319)
453 KOG1989|consensus               74.7     3.6 7.7E-05   44.3   4.2   67   12-81    134-201 (738)
454 KOG0586|consensus               74.5     1.5 3.2E-05   45.8   1.3   45   42-91    172-216 (596)
455 KOG0661|consensus               74.2       3 6.5E-05   42.7   3.3   53   16-74    104-158 (538)
456 cd08226 PK_STRAD_beta Pseudoki  74.1       3 6.5E-05   39.2   3.2   28   44-72    120-147 (328)
457 KOG0663|consensus               73.6     2.1 4.6E-05   42.2   2.0   32   42-74    194-225 (419)
458 cd05076 PTK_Tyk2_rpt1 Pseudoki  73.6     4.9 0.00011   36.6   4.4   31   44-74    136-172 (274)
459 KOG0585|consensus               72.6     2.3 4.9E-05   43.6   2.0   32   44-76    229-260 (576)
460 KOG0192|consensus               72.4     5.6 0.00012   39.2   4.7   33   46-78    164-196 (362)
461 COG3281 Ble Uncharacterized pr  72.2     2.1 4.6E-05   42.3   1.6   44   44-89    284-336 (438)
462 KOG0664|consensus               71.7     2.4 5.2E-05   40.9   1.9   30   44-74    175-204 (449)
463 KOG0579|consensus               71.4       4 8.6E-05   43.6   3.5   32   44-76    149-180 (1187)
464 KOG3087|consensus               71.3     5.1 0.00011   36.7   3.7   59  186-244    62-134 (229)
465 COG0515 SPS1 Serine/threonine   70.6     2.5 5.3E-05   37.0   1.6   30   45-74    121-150 (384)
466 cd05169 PIKKc_TOR TOR (Target   70.0     5.4 0.00012   37.6   3.9   32   42-73    179-210 (280)
467 KOG2268|consensus               69.9     7.2 0.00016   38.8   4.7   27   44-71    221-247 (465)
468 KOG0604|consensus               68.8     5.3 0.00012   39.0   3.5   42   43-84    179-222 (400)
469 KOG0591|consensus               68.6     7.3 0.00016   37.8   4.3   31   43-74    146-176 (375)
470 cd00142 PI3Kc_like Phosphoinos  68.4     4.5 9.8E-05   36.8   2.9   39   42-80    126-164 (219)
471 KOG0607|consensus               68.2     7.5 0.00016   38.4   4.4   49   23-75    178-228 (463)
472 cd05172 PIKKc_DNA-PK DNA-depen  68.1     8.5 0.00018   35.6   4.7   35   42-76    134-168 (235)
473 PTZ00266 NIMA-related protein   68.0     5.5 0.00012   44.5   3.9   31   44-74    144-190 (1021)
474 COG0510 ycfN Thiamine kinase a  67.9     4.6 9.9E-05   38.1   2.9   39  202-244    59-98  (269)
475 cd05152 MPH2' Macrolide 2'-Pho  67.8     6.5 0.00014   37.0   3.9   47  198-244    71-130 (276)
476 KOG0671|consensus               67.8     9.4  0.0002   38.2   5.0   33   43-75    210-261 (415)
477 PRK10359 lipopolysaccharide co  67.7     6.2 0.00013   36.6   3.6   39  206-244   118-156 (232)
478 KOG4236|consensus               67.6     3.4 7.4E-05   43.1   2.0   32   44-75    683-716 (888)
479 cd05171 PIKKc_ATM Ataxia telan  67.5     5.1 0.00011   38.0   3.1   31   43-73    180-210 (279)
480 PRK10593 hypothetical protein;  67.3     6.5 0.00014   37.4   3.8   58  186-244    59-129 (297)
481 KOG1152|consensus               66.7     4.7  0.0001   42.5   2.8   33   42-75    687-719 (772)
482 PF14531 Kinase-like:  Kinase-l  66.4     6.9 0.00015   37.5   3.8   31   44-75    164-194 (288)
483 KOG0590|consensus               66.1     4.9 0.00011   42.3   3.0   39   42-81    437-475 (601)
484 KOG0695|consensus               64.6     5.8 0.00012   39.3   2.9   79    4-87    333-412 (593)
485 KOG0193|consensus               64.6     5.6 0.00012   41.9   3.0   35   44-79    507-541 (678)
486 KOG0666|consensus               64.0       5 0.00011   39.4   2.3   31   44-74    151-184 (438)
487 KOG0694|consensus               63.1     4.9 0.00011   42.7   2.3   60   23-87    470-529 (694)
488 cd05170 PIKKc_SMG1 Suppressor   63.0     5.7 0.00012   38.2   2.6   31   43-73    208-238 (307)
489 PF10707 YrbL-PhoP_reg:  PhoP r  61.6      16 0.00036   32.9   5.1   42   25-70    122-166 (199)
490 cd00892 PIKKc_ATR ATR (Ataxia   61.5     6.9 0.00015   36.3   2.7   35   42-76    137-171 (237)
491 smart00146 PI3Kc Phosphoinosit  61.5     6.6 0.00014   35.2   2.6   37   42-79     99-135 (202)
492 KOG0584|consensus               59.9      12 0.00025   39.6   4.2   52   23-74    142-194 (632)
493 cd05164 PIKKc Phosphoinositide  59.6     6.2 0.00013   36.1   2.1   35   42-76    129-163 (222)
494 KOG1027|consensus               58.9     9.3  0.0002   41.6   3.4   31   44-74    625-659 (903)
495 PRK14705 glycogen branching en  58.4      19 0.00042   41.1   6.0   49   42-90    329-390 (1224)
496 PF05445 Pox_ser-thr_kin:  Poxv  58.2     8.2 0.00018   38.5   2.7   20   41-60    295-314 (434)
497 cd05163 TRRAP TRansformation/t  57.5      10 0.00022   35.6   3.1   31   43-73    153-183 (253)
498 PHA03111 Ser/Thr kinase; Provi  57.5      17 0.00038   36.2   4.8   21   41-61    299-319 (444)
499 smart00090 RIO RIO-like kinase  56.6      18 0.00038   33.2   4.6   55  189-243   105-168 (237)
500 COG2112 Predicted Ser/Thr prot  56.5     6.8 0.00015   35.5   1.7   39   44-84    124-164 (201)

No 1  
>KOG4720|consensus
Probab=100.00  E-value=2.6e-46  Score=349.13  Aligned_cols=171  Identities=48%  Similarity=0.824  Sum_probs=165.5

Q ss_pred             chhhhhcCCCCHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhC
Q psy8745          12 SSRFQALFPGGVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAG   91 (317)
Q Consensus        12 ~~~~~~~~p~~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~   91 (317)
                      +++....+| ..+.|.+|+.||++.+...++|+|||||||.++|||+++..+.|.|||||||+||+.+|||||||||++|
T Consensus       217 ~kq~~~~~~-~~~~L~~Ei~~l~E~l~~L~sPVVFcHNDLL~~Niiy~~~~~~v~fIDYEYa~yNY~afDIgNHFnE~aG  295 (391)
T KOG4720|consen  217 NKQNLFDEP-SPEDLGEEISKLKEMLSMLKSPVVFCHNDLLCGNIIYDSEKGSVEFIDYEYAGYNYQAFDIGNHFNEYAG  295 (391)
T ss_pred             chhhcccCC-CHHHHHHHHHHHHHHHHhhCCCeEEeecchhhcceeeccccCcEEEEeecccccchhheehhhhHHhhcC
Confidence            677777888 8999999999999999999999999999999999999988899999999999999999999999999999


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHH
Q psy8745          92 VSPIDHSRYPGPEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQ  171 (317)
Q Consensus        92 ~~~~d~~~yp~~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~  171 (317)
                      .+++||+.||+.++|.+||+.||+.|+|.++++.|++.|+.+|+.|++++|+||++||++|++.|+|+|||+.||..|++
T Consensus       296 v~evDYSlyp~rE~Q~qwl~~YLq~~kg~evs~~eVe~lfvqvn~FalAsHlfWavWAllQA~~StIdFdylgYa~lRyn  375 (391)
T KOG4720|consen  296 VEEVDYSLYPTREEQLQWLRDYLQAYKGKEVSDTEVETLFVQVNQFALASHLFWAVWALLQAQNSTIDFDYLGYAFLRYN  375 (391)
T ss_pred             CCccchhcCCCHHHHHHHHHHHHhhccCccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCcccccchhhHHHHHH
Confidence            98999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhHhhhcCC
Q psy8745         172 GYVLKRDKYLGT  183 (317)
Q Consensus       172 ~y~~~k~el~~~  183 (317)
                      +|.+.|.+++++
T Consensus       376 eY~k~k~~~~sl  387 (391)
T KOG4720|consen  376 EYQKRKPEVLSL  387 (391)
T ss_pred             HhhccCcceeee
Confidence            999999998765


No 2  
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=100.00  E-value=3.5e-38  Score=302.97  Aligned_cols=163  Identities=36%  Similarity=0.668  Sum_probs=148.1

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPG  102 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~  102 (317)
                      ++.+.+++..+++.+...+.++||||||++++|||++++++.++||||||||+|+|+||||+|||||++++ ++|+.||+
T Consensus       161 ~~~l~~~~~~l~~~~~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lID~EYag~nd~~fDIa~~f~E~~~~~-~~~~~~p~  239 (330)
T PLN02421        161 FEELRDEIVELKEITDSLKAPVVFAHNDLLSGNLMLNEDEGKLYFIDFEYGSYSYRGYDIGNHFNEYAGFD-CDYSLYPS  239 (330)
T ss_pred             HHHHHHHHHHHHHHhccCCCCeEEEECCCCcccEEEeCCCCcEEEEcccccCCCccHHHHHHHHHHHcccc-cCcccCcC
Confidence            66788899999988888889999999999999999975457899999999999999999999999998864 78999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHhHhhhcC
Q psy8745         103 PEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQGYVLKRDKYLG  182 (317)
Q Consensus       103 ~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~~y~~~k~el~~  182 (317)
                      .++|..|++.|++.......+++++++++.+|+.|.+++|++|++||++|+..|+++|||+.||..||++|++.|+++.+
T Consensus       240 ~~~~~~fl~~Y~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~W~lWa~iq~~~s~i~fdf~~ya~~R~~~y~~~k~~~~~  319 (330)
T PLN02421        240 KEEQYHFFRHYLRPDDPEEVSDAELEELFVETNFYALASHLYWAIWAIVQAKMSPIDFDYLGYFFLRYKEYKRQKEKLLS  319 (330)
T ss_pred             HHHHHHHHHHhCCcccCCcchHHHHHHHHHHHHHHhhhhHHHHHHHHHHHhhcCCcCCCHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999975433446778899999999999999999999999999999999999999999999999999999977


Q ss_pred             CCCC
Q psy8745         183 TSPP  186 (317)
Q Consensus       183 ~e~~  186 (317)
                      +..+
T Consensus       320 ~~~~  323 (330)
T PLN02421        320 LVRS  323 (330)
T ss_pred             cchh
Confidence            7544


No 3  
>PTZ00296 choline kinase; Provisional
Probab=100.00  E-value=1.6e-36  Score=302.16  Aligned_cols=159  Identities=29%  Similarity=0.507  Sum_probs=139.0

Q ss_pred             CHHHHHHHHHHHHHHHh------cCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCC--
Q psy8745          22 GVSQLQSDWQYIETALS------KTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVS--   93 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~------~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~--   93 (317)
                      +++.+.+++.++...+.      ..+.++||||||++++|||.+  +++|+||||||||+|+|+||||+|||||++..  
T Consensus       256 ~~~~l~~e~~~l~~~l~~~~~l~~~~~~~VfCHNDl~~~NiL~~--~~~l~LIDfEYAg~ndpafDIAn~f~E~~~dy~~  333 (442)
T PTZ00296        256 DIHKYIKESEKFIKFMKVYSKSDNLANDIVFCHNDLQENNIINT--NKCLRLIDFEYSGYNFLATDIANFFIETTIDYSV  333 (442)
T ss_pred             hHHHHHHHHHHHHHHHHhhcccccccCCeeEEeCCCCccceeec--CCCEEEEeecccccccHHHHHHHHHHHHhhhcCC
Confidence            56778888999988875      456789999999999999985  35699999999999999999999999999622  


Q ss_pred             ------CCCCCCCCCHHHHHHHHHHHHHHhcCC---CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhc--CCCCCCH
Q psy8745          94 ------PIDHSRYPGPEFQLSWLRTYLEEYTGS---PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEH--SDIEFDF  162 (317)
Q Consensus        94 ------~~d~~~yp~~e~~~~fi~~YL~~y~~~---~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~--s~~~fDy  162 (317)
                            .++++.||+.++|..||+.||+.+.+.   ..++++++.|+.+|+.|.+++|++|++||++|+..  |.++|||
T Consensus       334 ~~~p~f~~d~~~yPs~e~q~~Fi~~Yl~~~~~~~~~~~~~~~v~~l~~ev~~f~l~shl~W~lWaiiqa~~~~s~idFDy  413 (442)
T PTZ00296        334 SHYPFFAIDKKKYISYENRKLFITAYLSNYLDKSLVVPNPKIIDQILEAVEVQALGAHLLWGFWSIIRGYQTKSYNEFDF  413 (442)
T ss_pred             CCCCccccCcccCcCHHHHHHHHHHHHHHhccCCCCCchHHHHHHHHHHHHHHhhhhHHHHHHHHHHhCCcccCCCCCCH
Confidence                  247889999999999999999987422   23456899999999999999999999999999974  5699999


Q ss_pred             HHHHHHHHHHHHHhHhhhcC
Q psy8745         163 FQYASSTYQGYVLKRDKYLG  182 (317)
Q Consensus       163 ~~Ya~~R~~~y~~~k~el~~  182 (317)
                      +.||..||++|++.|+.+++
T Consensus       414 ~~Ya~~R~~~Y~~~k~~~~~  433 (442)
T PTZ00296        414 FLYAKERFKMYDEQKEYLIS  433 (442)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999844


No 4  
>PLN02236 choline kinase
Probab=100.00  E-value=2e-35  Score=285.54  Aligned_cols=160  Identities=38%  Similarity=0.742  Sum_probs=145.0

Q ss_pred             CHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCC------CCC
Q psy8745          22 GVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGV------SPI   95 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~------~~~   95 (317)
                      +.+.+.+++++|++.+.....+.|+||||++++|||+++.++.+.+||||||++|+|+||||+||||+++.      ..+
T Consensus       178 ~~~~l~~~~~~L~~~~~~~~~~~~~cH~Dl~~~Nil~~~~~~~~~lID~Eya~~~~~~~Dia~~~~e~~~~y~~~~~~~~  257 (344)
T PLN02236        178 RLDSLEDEINLLEKELSGDDQEIGFCHNDLQYGNIMIDEETRAITIIDYEYASYNPVAYDIANHFCEMAADYHSETPHIL  257 (344)
T ss_pred             CHHHHHHHHHHHHHHhcccCCCceEEeCCCCcCcEEEeCCCCcEEEEeehhccccchHHHHHHHHHHHHHhhcCCCcccC
Confidence            35688889999998888778899999999999999998645679999999999999999999999998762      135


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHH
Q psy8745          96 DHSRYPGPEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQGYVL  175 (317)
Q Consensus        96 d~~~yp~~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~~y~~  175 (317)
                      |++.||+.+++..|++.|++.. |..+++.+++.++.+|+.|.+++|++|++||++|+..|+++|||+.||+.|++.|++
T Consensus       258 ~~~~~~~~~~~~~fi~~Yl~~~-g~~~~~~~~~~l~~~v~~~~~~~~l~W~lWa~iq~~~s~~~fdy~~Ya~~R~~~y~~  336 (344)
T PLN02236        258 DYSKYPGEEERRRFIRTYLSSS-GEEPSDEEVEQLLDDVEKYTLASHLFWGLWGIISGHVNKIDFDYMEYARQRFEQYWL  336 (344)
T ss_pred             chhhCcCHHHHHHHHHHHHhhc-CCCchHHHHHHHHHHHHHHhhHhHHHHHHHHHHhcccCCCCCCHHHHHHHHHHHHHH
Confidence            7788999999999999999875 567788899999999999999999999999999999999999999999999999999


Q ss_pred             hHhhhcC
Q psy8745         176 KRDKYLG  182 (317)
Q Consensus       176 ~k~el~~  182 (317)
                      +|+++++
T Consensus       337 ~k~~~~~  343 (344)
T PLN02236        337 RKPELLG  343 (344)
T ss_pred             HHHHhcc
Confidence            9999865


No 5  
>KOG2686|consensus
Probab=100.00  E-value=7.9e-35  Score=279.10  Aligned_cols=159  Identities=34%  Similarity=0.653  Sum_probs=142.0

Q ss_pred             CHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCC-C------
Q psy8745          22 GVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVS-P------   94 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~-~------   94 (317)
                      ....+..|+.++++..+..+.++||||||++.||||+.+..+.+++||||||+||+++||||||||||+.++ .      
T Consensus       190 ~~~~l~~e~~~~~~~~e~~~~~vvFcHNDlq~gNiL~~~~t~~Lv~IDfEYasyN~r~fDlanHf~E~~~DY~~~~~P~~  269 (366)
T KOG2686|consen  190 EIEDLLLELSLFRKWSELTKSPVVFCHNDLQYGNILLLNSTKELVLIDFEYASYNPRGFDLANHFCEWAADYHTPTPPGL  269 (366)
T ss_pred             hHHHHHHHHHHHHHHHhcCCCCeeeecccccccceeeecCCCceeEEeeccccCCchhhhHHHHHHHhhccccCCCCCee
Confidence            366788899999998866788999999999999999986677899999999999999999999999999843 1      


Q ss_pred             -CCCCCCCCHHHHHHHHHHHHHHhcCC--CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcC-CCCCCHHHHHHHHH
Q psy8745          95 -IDHSRYPGPEFQLSWLRTYLEEYTGS--PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHS-DIEFDFFQYASSTY  170 (317)
Q Consensus        95 -~d~~~yp~~e~~~~fi~~YL~~y~~~--~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s-~~~fDy~~Ya~~R~  170 (317)
                       ++-+.||++++++.|+..|+.+....  ...+.+++.|+++++.|++++|+||+||+++|+..+ .++|||+.||+.|+
T Consensus       270 ~~~~~~~p~~e~~~~F~~sYl~~~~~~~~~~~~~ev~~L~~e~~~~~p~shlfW~LWsi~q~~~~~~i~fdy~~y~r~rf  349 (366)
T KOG2686|consen  270 KINPDLYPGEEQRQRFIESYLDSAAVKRKEPREKEVEKLLKEIRFFTPASHLFWGLWSILQALVLHKIEFDYMEYARDRF  349 (366)
T ss_pred             ecchhhCCCcHHHHHHHHHHHHHhhccccCchHHHHHHHHHHHHHHhhhhHHHHHHHHHHHhhhccccccChHHHHHHHH
Confidence             12356999999999999999987522  556789999999999999999999999999999998 89999999999999


Q ss_pred             HHHHHhHhhh
Q psy8745         171 QGYVLKRDKY  180 (317)
Q Consensus       171 ~~y~~~k~el  180 (317)
                      ..|+..|+.+
T Consensus       350 ~~y~~~k~~L  359 (366)
T KOG2686|consen  350 AVYFHLKPRL  359 (366)
T ss_pred             HHHhccchhh
Confidence            9999999888


No 6  
>PTZ00384 choline kinase; Provisional
Probab=100.00  E-value=1.8e-32  Score=268.64  Aligned_cols=158  Identities=27%  Similarity=0.491  Sum_probs=133.8

Q ss_pred             CHHHHHHHHHHHHHHHhc-------CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCC
Q psy8745          22 GVSQLQSDWQYIETALSK-------TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSP   94 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~-------~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~   94 (317)
                      +...+.++++.+++.+..       ...++||||||++++|||.+  +++++|||||||++|+|+||||||||||++++.
T Consensus       198 ~~~~l~~~~~~~~~~L~~~l~~~~~~~~~~VfCHNDL~~gNIL~~--~~~l~lID~EYA~~n~~~fDLAn~f~E~~~~y~  275 (383)
T PTZ00384        198 DYNELVQNYELFKKILNNHLNTSNSITNSVLFCHNDLFFTNILDF--NQGIYFIDFDFAGFNYVGWEIANFFVKLYIVYD  275 (383)
T ss_pred             CHHHHHHHHHHHHHHHHHhhccccccccceeeeeccCCcccEEec--CCCEEEEEeccccCCchHhHHHHHHHHHhcccC
Confidence            566788888887766642       23469999999999999985  467999999999999999999999999998532


Q ss_pred             --------CCCCCCCCHHHHHHHHHHHHHHhcCCC--CCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcC----CCCC
Q psy8745          95 --------IDHSRYPGPEFQLSWLRTYLEEYTGSP--PSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHS----DIEF  160 (317)
Q Consensus        95 --------~d~~~yp~~e~~~~fi~~YL~~y~~~~--~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s----~~~f  160 (317)
                              .+++.||+.++|..|++.||+.+.+..  +++++++.|+.+|+.|++++|+||++||++|+..+    ..++
T Consensus       276 ~~~~~~~~~~~~~~ps~e~~~~fi~~Yl~~~~~~~~~~~~~~~~~l~~~v~~~~l~sh~~W~lW~iIq~~~~~~~~~~~~  355 (383)
T PTZ00384        276 PPTPPYFNSDDSLALSEEMKTIFVSVYLSQLLGKNVLPSDDLVKEFLQSLEIHTLGVNLFWTYWGIVMNDKPKNELSKPV  355 (383)
T ss_pred             CCCCCccccCCCCCCCHHHHHHHHHHHHHHhcCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCcccccCCc
Confidence                    245678999999999999999876433  46789999999999999999999999999999842    2378


Q ss_pred             CHHHHHHHHHHHHHHhHhhhc
Q psy8745         161 DFFQYASSTYQGYVLKRDKYL  181 (317)
Q Consensus       161 Dy~~Ya~~R~~~y~~~k~el~  181 (317)
                      ||+.||..|+++|++..+++.
T Consensus       356 ~f~~y~~~r~~~~~~~~~~~~  376 (383)
T PTZ00384        356 KFEAYAKFQYNLFKNNLRKLT  376 (383)
T ss_pred             hHHHHHHHHHHHHHHHHHHhc
Confidence            999999999999998877763


No 7  
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=99.94  E-value=2.1e-26  Score=216.59  Aligned_cols=112  Identities=42%  Similarity=0.791  Sum_probs=98.5

Q ss_pred             CCCeeeeecCCCCCCeeeeCC---CCeEEEEeeccccCCchhhhHHHHHHHhhCCC--------CCCCCCCCCHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDET---EDKVTFIDYEYAGVNYQAFDIANHFDEFAGVS--------PIDHSRYPGPEFQLSW  109 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~---~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~--------~~d~~~yp~~e~~~~f  109 (317)
                      ..+.|+||||++++|||++++   ++.+.|||||||++|+|+||||++|+|++...        .++++.||+.++|..|
T Consensus       176 ~~~~~lcH~Dl~~~Nil~~~~~~~~~~i~lIDwEya~~~~p~~DlA~~~~e~~~~~~~~~~~~~~~~~~~~p~~~~~~~f  255 (302)
T cd05156         176 GSPVVFCHNDLQEGNILLLNPSSETKKLVLIDFEYASYNYRGFDIANHFCEWMYDYHDPEPPFFKIHEDKYPTEEQRLNF  255 (302)
T ss_pred             CCCceEEecCCCcCeEEecCCCCCCCcEEEEeeCCCCCCCcHHHHHHHHHHHHhhcCCCCCCccccChhhCcCHHHHHHH
Confidence            478999999999999999753   36799999999999999999999999998521        2467789999999999


Q ss_pred             HHHHHHHhcC----CCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHH
Q psy8745         110 LRTYLEEYTG----SPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQ  152 (317)
Q Consensus       110 i~~YL~~y~~----~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq  152 (317)
                      ++.|++.+.+    .+.+..+++.++.+|..|.+++|++|++||++|
T Consensus       256 ~~~Yl~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~W~lW~~~q  302 (302)
T cd05156         256 ISAYLSESLKGKNSVEEREKEVKDLLEEVEIFTPASHLFWALWGIIQ  302 (302)
T ss_pred             HhccCchhcccccccCcHHHHHHHHHHHHHHHHhhhhHHHHHHHhcC
Confidence            9999998753    345678899999999999999999999999987


No 8  
>KOG4720|consensus
Probab=99.88  E-value=1.5e-23  Score=196.75  Aligned_cols=95  Identities=34%  Similarity=0.721  Sum_probs=86.2

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCC--CCCCcchHHHHHHHhhcc
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSN--MKTPKLWSTGKHMLSLIP  263 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~--~~~p~lw~~i~kwl~~~~  263 (317)
                      .++++|+++||||+|||+|+||+||+||+|+||.|++|++|+|.++|||+||++|+++++  .++|.||.+|.+|+++++
T Consensus       130 ~afk~L~a~G~ap~Ly~tF~NGLvyefi~g~tL~p~~mr~pki~~lIAr~mak~H~~~~~g~~pkp~lw~km~~f~~lv~  209 (391)
T KOG4720|consen  130 IAFKLLAAYGFAPKLYGTFNNGLVYEFIQGKTLEPEHMREPKIFRLIARRMAKIHSIVATGGNPKPPLWEKMRKFLQLVP  209 (391)
T ss_pred             HHHHHHHHcCcChhhhheecCceEEeeecCcccChhhccChHHHHHHHHHHHHhheeccCCCCCCCcHHHHHHHHHHhcC
Confidence            678999999999999999999999999999999999999999999999999999999987  478899999999999999


Q ss_pred             ccCCCchhhhhhhccccc
Q psy8745         264 RTYSNPDKQERYCSRAQS  281 (317)
Q Consensus       264 ~~f~d~~k~~~~~~~~~s  281 (317)
                      +.|.|+ ++++....++|
T Consensus       210 ~~f~de-~~kq~~~~~~~  226 (391)
T KOG4720|consen  210 TSFEDE-INKQNLFDEPS  226 (391)
T ss_pred             chhhcc-cchhhcccCCC
Confidence            999887 44444444444


No 9  
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=99.78  E-value=2.7e-18  Score=161.36  Aligned_cols=133  Identities=26%  Similarity=0.407  Sum_probs=105.5

Q ss_pred             CHHHHHHHHHHHHHHHhcCCCC-eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCC
Q psy8745          22 GVSQLQSDWQYIETALSKTKSP-VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRY  100 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~~~~~-~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~y  100 (317)
                      +...+.+.+..|+..+.....+ .|+||||++++|+|.++ .++++||||||||+|+|+||||+++.|+..         
T Consensus       130 ~~~~~~~~~~~l~~~l~~~~~~~~v~cH~Dl~~~N~l~t~-~~~l~LIDWEyAg~~D~~~DLA~~~~e~~~---------  199 (269)
T COG0510         130 DNHLLRKKLKELRRALEEVPKDDLVPCHNDLNPGNLLLTD-KGGLFLIDWEYAGLNDPAFDLAALLSEYIF---------  199 (269)
T ss_pred             hhHHHHHHHHHHHHHhhhcCCCceeeecCCCCccceEEcC-CCcEEEEecccCCCccHHHHHHHHHHHhcc---------
Confidence            5667788888888888888878 99999999999999975 589999999999999999999999999763         


Q ss_pred             CCHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHhHhhh
Q psy8745         101 PGPEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQGYVLKRDKY  180 (317)
Q Consensus       101 p~~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~~y~~~k~el  180 (317)
                       +..+.......|++.|.   . +.        |..+.+...+.|.+|+.+|....   .++..|+..|+.+..+..+.+
T Consensus       200 -~~~~~~~~~~~~~~~~~---~-~~--------~~~~~i~~~~~W~l~~~~~~~~~---~~~~~~~~k~~~~~~~~l~~~  263 (269)
T COG0510         200 -NHNELEDLYSAYLEKYG---F-EA--------VLIYKILQKFLWYLWTKLQEQIL---EDFGWYDKKRLNRAIDLLENL  263 (269)
T ss_pred             -chhHHHHHHHHHHHhCC---c-hh--------hHHHHHHHHhHHHHHHHHHHHhh---hhhhhhhHHHHHHHHHHHHHH
Confidence             23334556667777652   1 11        44567778899999999999986   588889988888765555444


No 10 
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.78  E-value=1.2e-19  Score=162.91  Aligned_cols=84  Identities=45%  Similarity=0.722  Sum_probs=65.5

Q ss_pred             CHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCC-------CC
Q psy8745          22 GVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGV-------SP   94 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~-------~~   94 (317)
                      .++.|.+++.++++.+...+.+.||||||++++|||++..+++++||||||||+|+|+||||++|+|+++.       ..
T Consensus       121 ~~~~l~~~~~~~~~~l~~~~~~~v~cHnDl~~~Nil~~~~~~~~~lIDfEya~~n~~~fDia~~f~e~~~~~~~~~~~~~  200 (211)
T PF01633_consen  121 DLEDLQEELEELEKLLEKSNSPLVFCHNDLNPGNILINNKDGEVKLIDFEYAGYNDRAFDIANFFCEWNFDYEQEEFFFK  200 (211)
T ss_dssp             HHHHHHHHHHHHHHHHHTSCGGEEEE-S--SGGGEEETSSSSCEEE--GTT-EEEEHHHHHHHHHHHTTEETTHSSTSTE
T ss_pred             CHHHHHHHHhhhhhhhhccCCCceEeeccCccccEEeccCCCeEEEecHHHHhhccchhhHHHHHHHHcCchhhhhhhhh
Confidence            57789999999999998888999999999999999994447899999999999999999999999999872       24


Q ss_pred             CCCCCCCCHHH
Q psy8745          95 IDHSRYPGPEF  105 (317)
Q Consensus        95 ~d~~~yp~~e~  105 (317)
                      ++++.||+.++
T Consensus       201 ~~~~~yp~~~~  211 (211)
T PF01633_consen  201 CDYSKYPTEEQ  211 (211)
T ss_dssp             E-GGGS--HHH
T ss_pred             hhHhhCCCccC
Confidence            67888998764


No 11 
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=99.75  E-value=1.1e-17  Score=154.26  Aligned_cols=111  Identities=19%  Similarity=0.301  Sum_probs=91.3

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcCC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTGS  120 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~  120 (317)
                      +.+.++||||++++|||+++  +++.|||||||++|+|+||||++++++            +.+++..|++.|.+...  
T Consensus       143 ~~~~~l~H~Dl~~~Nil~~~--~~~~lIDwE~a~~gdp~~DLa~~~~~~------------~~~~~~~~l~~Y~~~~~--  206 (256)
T TIGR02721       143 PLPLAPLHMDVHAYNLVVTP--QGLKLIDWEYASDGDIALELAAIIRAN------------DEEQQQDFVQRYCQRRR--  206 (256)
T ss_pred             CCCCeeecCCCCcCcEEEeC--CCCEEEeccccCcCCHHHHHHHHHHhC------------CHHHHHHHHHHHHHhhC--
Confidence            45789999999999999975  348999999999999999999999863            36888999999997631  


Q ss_pred             CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHH
Q psy8745         121 PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQ  171 (317)
Q Consensus       121 ~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~  171 (317)
                       ..  ..+.+..+++.|.++.+++|++|+.++...++ +-.|.+-|+....
T Consensus       207 -~~--~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~-~~~~~~~a~~~~~  253 (256)
T TIGR02721       207 -IY--SISVLWRQVKAWQPWVDYMAALWFELRWQQTG-DPQFLELAQELRH  253 (256)
T ss_pred             -Cc--cHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-cHHHHHHHHHHHH
Confidence             11  13567889999999999999999999998875 4567776666554


No 12 
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=99.74  E-value=5e-18  Score=153.65  Aligned_cols=88  Identities=53%  Similarity=0.933  Sum_probs=77.3

Q ss_pred             CHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCC
Q psy8745          22 GVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYP  101 (317)
Q Consensus        22 ~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp  101 (317)
                      ..+.+.+++.+|.+.+.....+.|+||||++++|||+++.++.+.|||||||++|+|+||||++++||+++ ++|+..||
T Consensus       148 ~~~~l~~~~~~l~~~l~~~~~~~~l~H~Dl~~~Nil~~~~~~~~~lIDwe~a~~~~~~~Dla~~~~e~~~~-~~~~~~~~  226 (235)
T cd05157         148 SFEQLRDEISWLKELLSALNSPIVFCHNDLLSGNIIYNEEKNSVKFIDYEYAGYNYRAFDIANHFNEWAGF-DCDYYLYP  226 (235)
T ss_pred             cHHHHHHHHHHHHHHhcccCCCEEEEcCCCCcCcEEEeCCCCCEEEEEcccCCcCchheeHHHHHHHHcCc-cCChhhCc
Confidence            56788888889988887777889999999999999998533679999999999999999999999999865 47788899


Q ss_pred             CHHHHHHHH
Q psy8745         102 GPEFQLSWL  110 (317)
Q Consensus       102 ~~e~~~~fi  110 (317)
                      +.++|+.|+
T Consensus       227 ~~~~~~~~~  235 (235)
T cd05157         227 PKEEQQAFI  235 (235)
T ss_pred             CHHHHHhhC
Confidence            999998885


No 13 
>KOG2686|consensus
Probab=99.74  E-value=5.1e-19  Score=170.36  Aligned_cols=84  Identities=30%  Similarity=0.465  Sum_probs=78.4

Q ss_pred             CCCCcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCC-CCC-cchHHHHHHHh
Q psy8745         183 TSPPSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNM-KTP-KLWSTGKHMLS  260 (317)
Q Consensus       183 ~e~~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~-~~p-~lw~~i~kwl~  260 (317)
                      +|.++|.+|+++|+||+|||+|+|||+|||||+|||+.+++++|++++.||++|+++|.+++|+ |+| .+|++|++|+.
T Consensus        91 ~Esv~fa~lSer~lGPkL~G~F~~GR~EefipSRtL~~~~i~~p~~S~~Ia~~~~~~H~~~~p~~ke~~~~~~~~~~wl~  170 (366)
T KOG2686|consen   91 TESVMFAILSERGLGPKLYGFFSGGRFEEFIPSRTLTLADIRDPEISKRIAAKLAEYHGIEVPGPKEPRSLWERYKKWLK  170 (366)
T ss_pred             hHHHHHHHHhhcCCCcceeeecCCccHhhhccccccchHhhcchhHHHHHHHHHHHhcCCcCCCCccHHHHHHHHHHHHh
Confidence            4458999999999999999999999999999999999999999999999999999999999984 888 79999999998


Q ss_pred             hccccC
Q psy8745         261 LIPRTY  266 (317)
Q Consensus       261 ~~~~~f  266 (317)
                      .+....
T Consensus       171 ~~~~~~  176 (366)
T KOG2686|consen  171 GAKKIK  176 (366)
T ss_pred             hhhhcC
Confidence            877653


No 14 
>PRK10271 thiK thiamine kinase; Provisional
Probab=99.59  E-value=6e-15  Score=131.85  Aligned_cols=117  Identities=21%  Similarity=0.273  Sum_probs=92.0

Q ss_pred             HHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHH
Q psy8745          30 WQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSW  109 (317)
Q Consensus        30 ~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~f  109 (317)
                      +..++......+.+.|+||||++++||+..+  +++.+||||||+.|+|++|||.++++             +.+++..|
T Consensus        63 ~~~~~~~~~~~~l~~~p~H~D~~~~N~~~~~--~~~~lIDwe~a~~gDp~~DLa~~~~~-------------~~~~~~~~  127 (188)
T PRK10271         63 LKRLRKAGEPRPLRLAPLHMDVHAGNLVHSA--SGLRLIDWEYAGDGDIALELAAVWVE-------------NTEQHRQL  127 (188)
T ss_pred             HHHHHhcccCCCCCeeeecCCCCCccEEEEC--CCEEEEeCCcccCCCHHHHHHHHHcC-------------CHHHHHHH
Confidence            3444444445677899999999999999975  55999999999999999999998763             35778889


Q ss_pred             HHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHH
Q psy8745         110 LRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASS  168 (317)
Q Consensus       110 i~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~  168 (317)
                      ++.|...   ...   +...+..+|+.|.+...++-.+|..++.+.++ |-.|+.-|..
T Consensus       128 l~~Y~~~---~~~---d~~~~~~~~~~W~p~~~~m~llWyev~~qq~~-d~~fl~~a~~  179 (188)
T PRK10271        128 VNDYATR---AKI---DAAQLWRQVRRWFPWVLMLKAGWFEYRWRQTG-DQQFIRLADD  179 (188)
T ss_pred             HHHHhCc---cCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-cHHHHHHHHH
Confidence            9988843   112   23567778999999999999999999999885 4567655543


No 15 
>PTZ00296 choline kinase; Provisional
Probab=99.42  E-value=9.9e-14  Score=138.85  Aligned_cols=80  Identities=16%  Similarity=0.344  Sum_probs=74.1

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC----C---CCCCcchHHHHHH
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS----N---MKTPKLWSTGKHM  258 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~----~---~~~p~lw~~i~kw  258 (317)
                      .++++|+++|+||++||+|+||+|++||+|+||++.++++|.+++.||+.|++||++..    +   +++|.+|.+|++|
T Consensus       161 ~v~~~ls~~gi~P~l~~~f~gg~I~efi~g~~l~~~dl~~~~~~~~iA~~L~~lH~~~~~~~~~~~f~~~p~~f~~i~~~  240 (442)
T PTZ00296        161 EVYKTMSKYRIAPQLLNTFSGGRIEEWLYGDPLRIDDLKNPSILIGIANVLGKFHTLSRKRHLPEHWDRTPCIFKMMEKW  240 (442)
T ss_pred             HHHHHHHHCCCCCceEEEeCCCEEEEeeCCccCCHHHcCCHHHHHHHHHHHHHHhcccccccCchhccCCCcHHHHHHHH
Confidence            67889999999999999999999999999999999999999999999999999999852    2   4789999999999


Q ss_pred             Hhhcccc
Q psy8745         259 LSLIPRT  265 (317)
Q Consensus       259 l~~~~~~  265 (317)
                      +..++..
T Consensus       241 ~~~~~~~  247 (442)
T PTZ00296        241 KNQLSKY  247 (442)
T ss_pred             HHHHHhh
Confidence            9998764


No 16 
>PTZ00384 choline kinase; Provisional
Probab=99.42  E-value=8.9e-14  Score=136.85  Aligned_cols=78  Identities=18%  Similarity=0.311  Sum_probs=71.5

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC---C---CCCCcchHHHHHHH
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS---N---MKTPKLWSTGKHML  259 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~---~---~~~p~lw~~i~kwl  259 (317)
                      +++++|+++|+||++||.|+||+|++||+|++|+.+++++|.+++.||++||+||.+..   |   ++.|.+|.+|.+|+
T Consensus       104 ~i~~~Ls~~glgP~l~~~f~~g~l~efIeGr~l~~~dl~~p~~~~~IA~~La~lH~~~~~~~p~~~~~~p~~~~~i~~w~  183 (383)
T PTZ00384        104 NIAKLLGDNNFGPKIIGRFGDFTIQEWVEGNTMGIDSLQNLSVLTGIASSLAKFHKRVTELVPKEWDRTPMFLTKISTWS  183 (383)
T ss_pred             HHHHHHHhCCCCCeEEEecCCEEEEEEeccccCChhHhcCHHHHHHHHHHHHHHhcccccCCCccccCcchHHHHHHHHH
Confidence            67889999999999999999999999999999999999999999999999999999753   2   36788999999999


Q ss_pred             hhcc
Q psy8745         260 SLIP  263 (317)
Q Consensus       260 ~~~~  263 (317)
                      ..+.
T Consensus       184 ~~~~  187 (383)
T PTZ00384        184 QHVE  187 (383)
T ss_pred             HHHH
Confidence            7654


No 17 
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=99.39  E-value=4e-12  Score=118.99  Aligned_cols=101  Identities=20%  Similarity=0.232  Sum_probs=73.1

Q ss_pred             CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcC
Q psy8745          40 TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTG  119 (317)
Q Consensus        40 ~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~  119 (317)
                      ...+.++||||++++|+|+++ ++.+.|||||+|+++++.+|||..+..|+.....+    .+.+....|++.|.+.   
T Consensus       171 ~~~~~~l~HgD~~~~Nil~~~-~~~~~iIDfe~a~~g~~~~Dla~~~~~~~~~~~~~----~~~~~~~~~l~gY~~~---  242 (296)
T cd05153         171 SDLPRGVIHADLFRDNVLFDG-DELSGVIDFYFACTDAFLYDLAITLNDWCFDEDGA----LDPERAQALLAGYQAV---  242 (296)
T ss_pred             hcCCCcCCccCcCcccEEEeC-CceEEEeehhhhcCchHHHHHHHHHHHHHhCccCC----CCHHHHHHHHHHHHhc---
Confidence            356789999999999999985 34457999999999999999999998776522111    2456677888888764   


Q ss_pred             CCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHH
Q psy8745         120 SPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQ  152 (317)
Q Consensus       120 ~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq  152 (317)
                      ++++++|++.|...    .++..+.+.+|.+.-
T Consensus       243 ~~ls~~e~~~l~~~----~~~~a~~~~~~~~~~  271 (296)
T cd05153         243 RPLTEAERAALPIM----LRGAALRFWLSRLYD  271 (296)
T ss_pred             CCCCHHHHHHHHHH----HHHHHHHHHHHHHHH
Confidence            56889998887643    333334445555543


No 18 
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=99.38  E-value=2.5e-13  Score=121.88  Aligned_cols=73  Identities=33%  Similarity=0.656  Sum_probs=63.1

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC--CCCCCcchHHHHHH
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS--NMKTPKLWSTGKHM  258 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~--~~~~p~lw~~i~kw  258 (317)
                      .++++|++.|+||++|+.|+||+|++||+|+||+++++++|.+...||+.||+||.+..  ..+.+.+|+.|++|
T Consensus        25 ~~~~~l~~~g~~p~~~~~~~~g~v~e~i~g~~l~~~~~~~~~~~~~iA~~l~~lH~~~~~~~~~~~~~~~~i~~~   99 (211)
T PF01633_consen   25 EALKLLSEAGLGPKIIYFFENGRVEEFIEGRTLSPEDFRNPEILKRIAKLLAKLHSIPISPNSKKPDLWDRIDKY   99 (211)
T ss_dssp             HHHHHHHHTTSSS-EEEEETTEEEEE--SSEE--CGGGGSHHHHHHHHHHHHHHHTHHHTTSSSS-HHHHHHHHH
T ss_pred             HHHHHHHHcCCCCeEEEEcCCCcEEEEecccccChhhccChHHHHHHHHHHHHHhhcccccccCcchHHHHhhhh
Confidence            55688999999999999999999999999999999999999999999999999999987  35778899999999


No 19 
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=99.37  E-value=5.9e-13  Score=128.23  Aligned_cols=89  Identities=27%  Similarity=0.589  Sum_probs=80.4

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCC-CCCcchHHHHHHHhhccc
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNM-KTPKLWSTGKHMLSLIPR  264 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~-~~p~lw~~i~kwl~~~~~  264 (317)
                      .+++.|++.|+||++++.|+||+|++||+|++|+++++++|.+...||+.|++||.+.++. +.|.+|..|++|++++.+
T Consensus        65 ~il~~l~~~gl~P~~l~~~~~G~i~~fi~g~~l~~~~l~~~~~~~~ia~~L~~lH~~~~~~~~~~~~~~~i~~y~~~~~~  144 (330)
T PLN02421         65 QAIKYLSAAGFGAKLLGVFGNGMIQSFINARTLTPSDMRKPKVAAEIAKELRRLHQVEIPGSKEPQLWNDIFKFYEKAST  144 (330)
T ss_pred             HHHHHHHhcCCCCceeEEeCCcEeehhhcCCCCChHHCCCHHHHHHHHHHHHHHhCCCCCCCCCCcHHHHHHHHHHHhhh
Confidence            4567899999999999999999999999999999999999999999999999999998774 678999999999999987


Q ss_pred             -cCCCchhhhh
Q psy8745         265 -TYSNPDKQER  274 (317)
Q Consensus       265 -~f~d~~k~~~  274 (317)
                       .|.++.+++.
T Consensus       145 ~~~~~~~~~~~  155 (330)
T PLN02421        145 VKFEDPEKQKK  155 (330)
T ss_pred             cccCcHHHhhh
Confidence             4777766554


No 20 
>PLN02236 choline kinase
Probab=99.34  E-value=8.5e-13  Score=127.93  Aligned_cols=81  Identities=25%  Similarity=0.464  Sum_probs=74.6

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCC-CCCcchHHHHHHHhhccc
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNM-KTPKLWSTGKHMLSLIPR  264 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~-~~p~lw~~i~kwl~~~~~  264 (317)
                      .+++.|++.|+||++||.|+||+|++|++|+||+++++++|.+...||+.|++||++.+++ +.|.+|.+|++|+..+..
T Consensus        88 ~~~~~l~~~gl~P~~~~~~~~g~v~efi~g~~l~~~~l~~~~~~~~ia~~L~~lH~~~~~~~~~~~~~~~i~~~~~~~~~  167 (344)
T PLN02236         88 RTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALIAAKLREFHSLDMPGPKNVLLWDRLRNWLKEAKN  167 (344)
T ss_pred             HHHHHHHHcCCCCceEEEECCceEEEeeCCCCCCHHHcCChHHHHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHh
Confidence            5667899999999999999999999999999999999999999999999999999998765 568999999999988765


Q ss_pred             cC
Q psy8745         265 TY  266 (317)
Q Consensus       265 ~f  266 (317)
                      ..
T Consensus       168 l~  169 (344)
T PLN02236        168 LC  169 (344)
T ss_pred             hc
Confidence            54


No 21 
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=99.26  E-value=1.3e-10  Score=109.20  Aligned_cols=100  Identities=21%  Similarity=0.274  Sum_probs=77.1

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcCC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTGS  120 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~  120 (317)
                      ..+.++||||++++||++++  +.+.+||||.++++++.+|||.++..++.. ..++    +.+....|++.|.+.   .
T Consensus       184 ~~~~~liHgD~~~~Nil~~~--~~i~lIDfd~~~~~~~~~Dla~~l~~~~~~-~~~~----d~~~~~~~l~gY~~~---~  253 (313)
T TIGR02906       184 KKIRGFCHQDYAYHNILLKD--NEVYVIDFDYCTIDLPVRDLRKLIIKLMKK-NGVW----DLEKAKEIIEAYSSI---N  253 (313)
T ss_pred             cCcCceEcCCCCcccEEEeC--CcEEEEECcccccCCcHHHHHHHHHHHHHh-ccCC----CHHHHHHHHHHhhcc---C
Confidence            45789999999999999975  679999999999999999999998876511 1112    234556777777764   5


Q ss_pred             CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhh
Q psy8745         121 PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAE  154 (317)
Q Consensus       121 ~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~  154 (317)
                      +++++|++.|+    .+.++++.||.+|--+...
T Consensus       254 ~L~~~e~~~l~----~~l~~p~~~~~~~~~y~~~  283 (313)
T TIGR02906       254 PLSKEEKEVLY----IDLAFPHKFWKIGKQYYYK  283 (313)
T ss_pred             CCCHHHHHHHH----HHHhChHHHHHHHHHHHhc
Confidence            78899988776    5688888888877655443


No 22 
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=99.26  E-value=3.7e-11  Score=114.13  Aligned_cols=101  Identities=21%  Similarity=0.306  Sum_probs=82.4

Q ss_pred             CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcC
Q psy8745          40 TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTG  119 (317)
Q Consensus        40 ~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~  119 (317)
                      ...+.++||+|+.++|+|+++ ++.+.+||||+|++++|.+|||+++...+..  .+    ++.+....|++.|-+.   
T Consensus       192 ~~~~~~lcHgD~~~~Nvl~~~-~~~~~iIDfd~~~~d~~~~DLa~~~~~~~~~--~~----~~~~~~~~~l~~Y~~~---  261 (309)
T TIGR02904       192 ESWRTVLVHGKLSLSHFLYDE-TRGGYFINFEKASFASPLTDLAAFFRRSFGT--YP----QPIDEMFEWFYTYEKT---  261 (309)
T ss_pred             hhcceeeeCCCCcHHhEEEcC-CCCEEEEEhhhcccCCcHHHHHHHHHHHHhh--CC----CChHHHHHHHHHHHhc---
Confidence            457889999999999999976 4679999999999999999999988875431  12    3346667788888876   


Q ss_pred             CCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhh
Q psy8745         120 SPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAE  154 (317)
Q Consensus       120 ~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~  154 (317)
                      ++++++|.+.|+    .+.++++-||-+|--+...
T Consensus       262 ~pL~~~E~~~l~----~~L~fP~~f~~~~~~yy~~  292 (309)
T TIGR02904       262 LPLTDEEIHLLT----SYLAYPGPFIRVIQNYTKQ  292 (309)
T ss_pred             CCCCHHHHHHHH----HHHhCCHHHHHHHHHHHhc
Confidence            678999988876    4688999999999877664


No 23 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=99.23  E-value=5.4e-11  Score=101.46  Aligned_cols=62  Identities=40%  Similarity=0.704  Sum_probs=54.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHH
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEE  116 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~  116 (317)
                      +.++||+|++++|||++  ++++.+||||+|++++|++|||.++.++.          .+.+++..|++.|-..
T Consensus       106 ~~~~~HgD~~~~Nil~~--~~~~~liDf~~a~~~~~~~Dla~~~~~~~----------~~~~~~~~~~~~y~~~  167 (170)
T cd05151         106 DLVPCHNDLLPGNFLLD--DGRLWLIDWEYAGMNDPLFDLANFFSEAK----------LSEDQEEELLEAYFGR  167 (170)
T ss_pred             CceeecCCCCcCcEEEE--CCeEEEEecccccCCChHHHHHHHHHhcC----------CCHHHHHHHHHHHhCC
Confidence            78999999999999997  46799999999999999999999988753          2467788899888764


No 24 
>PRK05231 homoserine kinase; Provisional
Probab=99.22  E-value=1.6e-10  Score=109.66  Aligned_cols=101  Identities=19%  Similarity=0.289  Sum_probs=71.0

Q ss_pred             HHHHHHHHHHHHhc---CCCCeeeeecCCCCCCeeeeCCCCeE-EEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCC
Q psy8745          26 LQSDWQYIETALSK---TKSPVVFCHNDLLLGNIIYDETEDKV-TFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYP  101 (317)
Q Consensus        26 L~~e~~~L~~~l~~---~~~~~v~CHnDl~~~NiL~~~~~~~l-~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp  101 (317)
                      +.++++.+.+.+..   ...|.++||||++++|||+++  +++ .+||||+|+++++.||||..++.|+......+    
T Consensus       166 l~~~~~~~~~~~~~~~~~~lp~~liHgD~~~~Nil~~~--~~~~~iIDf~~~~~~~~~~DlA~~~~~~~~~~~~~~----  239 (319)
T PRK05231        166 LEAELAAQLAFLASAAWPALPRGVIHADLFRDNVLFEG--DRLSGFIDFYFACNDKLLYDVAITLNDWCFEADGSL----  239 (319)
T ss_pred             HHHHHHHHHHhhhccccccCCcccCCCCCCCCcEEEEC--CceEEEEecccccCCchHHHHHHHHHHHHccCCCCc----
Confidence            34444444444442   236789999999999999974  455 69999999999999999999987775321111    


Q ss_pred             CHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhh
Q psy8745         102 GPEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQ  135 (317)
Q Consensus       102 ~~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~  135 (317)
                      +.+....|++.|-+.   ++++++|++.|..-++
T Consensus       240 ~~~~~~~~l~gY~~~---~~Ls~~E~~~l~~~l~  270 (319)
T PRK05231        240 DATKARALLAAYQSV---RPLTAAERAALPVMLR  270 (319)
T ss_pred             CHHHHHHHHHHHhhc---CCCCHHHHHHHHHHHH
Confidence            234556666666553   5789999888775433


No 25 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=99.18  E-value=5.7e-11  Score=108.79  Aligned_cols=71  Identities=18%  Similarity=0.177  Sum_probs=55.0

Q ss_pred             HHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHH
Q psy8745          34 ETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTY  113 (317)
Q Consensus        34 ~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~Y  113 (317)
                      .+.++....+.++||||++++|||+++ ++ +.+||||+|++|+|.+|||.++.-+..          ..+++..|+..|
T Consensus       143 ~~~l~~~~~~~~~~HgD~~~~Nii~~~-~~-~~iIDwe~a~~Gdp~~Dla~~~~~~~~----------~~~~~~~~~~~y  210 (226)
T TIGR02172       143 RAFIKEVPDTSTCLHGDFQIGNLITSG-KG-TYWIDLGDFGYGNPLFDLGLLFMFCHY----------LDDDKLQAIFHM  210 (226)
T ss_pred             HHHHHhCCCCCceEecCCCCCcEEEcC-CC-cEEEechhcCcCCHHHHHHHHHHhccC----------ChhHHHHHHHhc
Confidence            333434455667899999999999975 34 999999999999999999997664221          246788899888


Q ss_pred             HHH
Q psy8745         114 LEE  116 (317)
Q Consensus       114 L~~  116 (317)
                      +.+
T Consensus       211 ~~~  213 (226)
T TIGR02172       211 NAE  213 (226)
T ss_pred             CHH
Confidence            864


No 26 
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=99.14  E-value=3.8e-10  Score=106.95  Aligned_cols=86  Identities=17%  Similarity=0.297  Sum_probs=65.1

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcCC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTGS  120 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~  120 (317)
                      ..+.++||||++++|+++++ ++.+.+||||+|+++++.+|||..+..|+......    .+.+....|++.|.+.   .
T Consensus       184 ~~~~~l~HgD~~~~Nvl~~~-~~~~~vIDfd~~~~~~~~~DLA~~~~~~~~~~~~~----~~~~~~~~~l~gY~~~---~  255 (307)
T TIGR00938       184 DLPRGVIHADLFPDNVLFDG-DSVKGVIDFYFACTDARAYDLAITVNAWCFDADDH----FDADHAKALIKGYHQS---R  255 (307)
T ss_pred             cCCCccCCCCCCcCcEEEEC-CceEEEeecccccCcchHHHHHHHHHHHHcCCCCC----CCHHHHHHHHHHHHhc---C
Confidence            46789999999999999986 34457999999999999999999877665421111    1345667788888665   5


Q ss_pred             CCCHHHHHHHHHhh
Q psy8745         121 PPSPHQLATLHWQV  134 (317)
Q Consensus       121 ~~s~~ev~~l~~~v  134 (317)
                      +++++|++.|..-+
T Consensus       256 ~Ls~~e~~~l~~~~  269 (307)
T TIGR00938       256 PLTEEEKAAFPVLL  269 (307)
T ss_pred             CCCHHHHHHHHHHH
Confidence            78888888776443


No 27 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=99.07  E-value=2.9e-10  Score=100.42  Aligned_cols=61  Identities=21%  Similarity=0.329  Sum_probs=47.5

Q ss_pred             HHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCC-CCeEEEEeeccccCCchhhhHHHHHHHh
Q psy8745          28 SDWQYIETALSKTKSPVVFCHNDLLLGNIIYDET-EDKVTFIDYEYAGVNYQAFDIANHFDEF   89 (317)
Q Consensus        28 ~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~-~~~l~lIDfEya~~n~~~fDiAn~~~E~   89 (317)
                      +.+.++.+.+.. ..+.++||+|++++|||++++ ++.+.|||||++++++|++|||.++..|
T Consensus       159 ~~~~~~~~~~~~-~~~~~l~HgD~~~~Nil~~~~~~~~~~iID~e~~~~g~~~~Dla~~~~~~  220 (223)
T cd05154         159 RLLRWLEAHLPA-DSRPGLVHGDYRLGNVLFHPDEPRVVAVLDWELATLGDPLADLGWLLMYW  220 (223)
T ss_pred             HHHHHHHhhCCC-CCCcEEEECCCCcccEEEcCCCCcEEEEEeccccccCChHHHHHHHHHhc
Confidence            334444443332 257899999999999999763 3457899999999999999999998765


No 28 
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=99.05  E-value=6.2e-10  Score=98.35  Aligned_cols=75  Identities=36%  Similarity=0.592  Sum_probs=50.9

Q ss_pred             HHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHH
Q psy8745          30 WQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSW  109 (317)
Q Consensus        30 ~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~f  109 (317)
                      ++++.+.+.. ..+.++||+|++++|||+++++++|.|||||.+++++|.+|++.++..+..            +....+
T Consensus       153 ~~~~~~~~~~-~~~~~~~HgD~~~~Nil~~~~~~~i~iID~e~a~~~~~~~Dla~~~~~~~~------------~~~~~~  219 (239)
T PF01636_consen  153 LQELEALLPK-PLPPVLIHGDLHPGNILVDPSDGRIGIIDFEDAGWGDPAYDLARLLRHFGE------------DQDPEF  219 (239)
T ss_dssp             HHHHHHHHHC-CSCEEEE-SS-SGGGEEEESSTTEEEE--GTT-EEEETHHHHHHHHHHHTT------------HCHHHH
T ss_pred             HHHHHhhhcc-CCCcEEEEeccccccceeeeccceeEEEecccceECCHHHHHHHHHHHhcc------------cCCHHH
Confidence            4444444443 678999999999999999844577789999999999999999999854321            223445


Q ss_pred             HHHHHHHh
Q psy8745         110 LRTYLEEY  117 (317)
Q Consensus       110 i~~YL~~y  117 (317)
                      .+.|+++|
T Consensus       220 ~~~~~~~~  227 (239)
T PF01636_consen  220 RRAYLEAY  227 (239)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHh
Confidence            66666666


No 29 
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=99.02  E-value=1e-09  Score=100.14  Aligned_cols=65  Identities=29%  Similarity=0.383  Sum_probs=48.9

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTY  113 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~Y  113 (317)
                      ..+.|+||+|++++|||+++ ++.+.|||||+|++++|.+|||..+.....       ...+.+.+..|++.|
T Consensus       160 ~~~~~l~HgD~~~~Nil~~~-~~~~~iIDwe~a~~gdp~~Dla~~~~~~~~-------~~~~~~~~~~f~~~Y  224 (244)
T cd05150         160 EEDLVVTHGDACLPNIIVDP-GKFSGFIDLGRLGVADRYQDLALAVRSLRE-------NLGGEEYAARFLDRY  224 (244)
T ss_pred             cCceEEECCCCCCccEEEeC-CcEEEEEEccccccccHHHHHHHHHHHhhh-------hcCChHHHHHHHHHc
Confidence            45789999999999999986 344669999999999999999998754211       111345556666665


No 30 
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=98.99  E-value=2.2e-09  Score=95.93  Aligned_cols=65  Identities=22%  Similarity=0.291  Sum_probs=50.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCC-C---eEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETE-D---KVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEY  117 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~-~---~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y  117 (317)
                      ...|+||||++++|+|+..++ +   .+.+|||+++++++|++||+.++....           +.+.+....+.+++.|
T Consensus       118 ~~~vl~HgD~~~~N~~~~~~~~~~~~~~~liDfq~~~~g~p~~Dl~~~l~~~~-----------~~~~r~~~~~~ll~~Y  186 (196)
T smart00587      118 EFNVLNHGDLWANNIMFKYDDEGKPEDVALIDFQLSHYGSPAEDLHYFLLTSL-----------SVEIRREHFDELLKFY  186 (196)
T ss_pred             CceEEeeCCCCccceeeccCCCCCccceEEEecccCCcCChHHHHHHHHHhCC-----------CHHHHHHHHHHHHHHH
Confidence            468999999999999996432 2   699999999999999999999987532           2445555555556555


No 31 
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=98.92  E-value=1.6e-09  Score=97.96  Aligned_cols=82  Identities=38%  Similarity=0.835  Sum_probs=72.6

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCC-------CCCcchHHHHHH
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNM-------KTPKLWSTGKHM  258 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~-------~~p~lw~~i~kw  258 (317)
                      ..+..|++.|++|++++.+.+|++++||+|++++..++.++.+...+|+.||+||.+..+.       +.|.+|+.+.+|
T Consensus        47 ~~~~~l~~~gl~P~v~~~~~~~~l~e~i~G~~l~~~~~~~~~~~~~la~~l~~lH~~~~~~~~~~~~~~~~~~~~~i~~~  126 (235)
T cd05157          47 RIHKLLSKHGLAPKLYATFQNGLIYEFIPGRTLEPEDLRNPKIYRLIARELAKLHSIKPPEAISSPGTPKPILWPTIRKW  126 (235)
T ss_pred             HHHHHHHhCCCCCeEEEEeCCcEEEEeeCCCcCCHHHccChHHHHHHHHHHHHHhcccccccccccCCCCCcHHHHHHHH
Confidence            4567888999999999999999999999999999999999999999999999999998652       456799999999


Q ss_pred             HhhccccCC
Q psy8745         259 LSLIPRTYS  267 (317)
Q Consensus       259 l~~~~~~f~  267 (317)
                      +..++....
T Consensus       127 ~~~~~~~~~  135 (235)
T cd05157         127 INLVPTEFK  135 (235)
T ss_pred             HHHhHHhhc
Confidence            988776543


No 32 
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=98.91  E-value=3.3e-08  Score=95.77  Aligned_cols=105  Identities=22%  Similarity=0.354  Sum_probs=75.4

Q ss_pred             eeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcCCCCCHH
Q psy8745          46 FCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTGSPPSPH  125 (317)
Q Consensus        46 ~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~~~s~~  125 (317)
                      +||||++++|+++++...-+.+|||+.|++++..||||..++.|..    |..  -.......|++.|-+.   ++++++
T Consensus       199 iIH~D~~~~NVl~d~~~~~~g~iDFdDa~~~~~i~DlAi~l~~~~~----d~~--~~~~~~~a~l~GY~~v---~pl~~~  269 (331)
T COG2334         199 IIHGDLHPDNVLFDDDTDVSGFIDFDDAGYGWFIYDLAIALNAWNG----DEA--DPRAAIAAFLEGYEEV---RPLTAA  269 (331)
T ss_pred             eeecCCCccceeEcCCCCeeeEEEccccccchHHHHHHHHHHHhhc----CCC--CcHHHHHHHHHHHHhc---CCCCHH
Confidence            9999999999999863223679999999999999999999987621    111  1245566777777765   578999


Q ss_pred             HHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHH
Q psy8745         126 QLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFF  163 (317)
Q Consensus       126 ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~  163 (317)
                      |++.+..    +..+..+.-..|..+.....+..+++.
T Consensus       270 El~~Lp~----l~r~~a~~~~~~~~~~~~~~p~~~~~~  303 (331)
T COG2334         270 ELELLPD----LRRLRALRLWAWRLIRWLLPPAGRLWL  303 (331)
T ss_pred             HHHHHHH----HHHHHHHHHHHHHhhhhhcCCCCcchh
Confidence            8887753    344455666778777777664444443


No 33 
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=98.85  E-value=1e-08  Score=101.70  Aligned_cols=61  Identities=23%  Similarity=0.329  Sum_probs=49.2

Q ss_pred             HHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhh
Q psy8745          26 LQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFA   90 (317)
Q Consensus        26 L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~   90 (317)
                      |..++..|...+.+  .+.++||||++++|||+.+  +.+.+||||+|.+|+|+||||+++.++.
T Consensus       207 L~~~~~~L~~~~~~--~~~~l~HgDl~~gni~~~~--~~~~viD~E~a~~G~~~~Dlg~~lanl~  267 (401)
T PRK09550        207 LKLEVAKLKHKFLT--KAEALLHGDLHTGSIFVTE--EETKVIDPEFAFYGPIGFDIGTFIANLL  267 (401)
T ss_pred             HHHHHHHHHHHHhc--CCCceeeccCCcccEEeeC--CCcEEEeccccccCChHHHHHHHHHHHH
Confidence            45555566554443  4678999999999999974  5699999999999999999999988753


No 34 
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=98.85  E-value=2.7e-09  Score=100.48  Aligned_cols=81  Identities=31%  Similarity=0.546  Sum_probs=72.2

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCC------CCCcchHHHHHHH
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNM------KTPKLWSTGKHML  259 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~------~~p~lw~~i~kwl  259 (317)
                      ..+..|++.|++|++++.|++|+|++||+|++++..++.+|.+...||+.|++||++..+.      ..|.+|..+.+|+
T Consensus        52 ~~~~~l~~~g~~P~~~~~~~~~~v~e~i~G~~l~~~~~~~~~~~~~ia~~L~~lH~~~~~~~~~~~~~~~~~~~~~~~~~  131 (302)
T cd05156          52 VVFARLSERNLGPKLYGIFPNGRIEEFIPSRTLTTEELRDPDISAEIARRMAKLHSIVVPLSPEERDLTPAIWKLLKQWL  131 (302)
T ss_pred             HHHHHHHhCCCCCceEEEeCCCchhheeCCCcCCHhHcCCcHHHHHHHHHHHHhhCCCCCCCCCcCcccchHHHHHHHHH
Confidence            4567899999999999999999999999999999999999999999999999999987642      4577999999999


Q ss_pred             hhccccC
Q psy8745         260 SLIPRTY  266 (317)
Q Consensus       260 ~~~~~~f  266 (317)
                      ...+...
T Consensus       132 ~~~~~~~  138 (302)
T cd05156         132 DLAETVI  138 (302)
T ss_pred             HHhhhhh
Confidence            8877653


No 35 
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=98.80  E-value=1.5e-08  Score=92.34  Aligned_cols=59  Identities=24%  Similarity=0.425  Sum_probs=47.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeE-EEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHH
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKV-TFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYL  114 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l-~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL  114 (317)
                      .+.++||+|++++|||+++  +++ .+|||++|++++|++|||.....+            +...+..|++.|.
T Consensus       162 ~~~~l~HGD~~~~Nvlv~~--~~i~giIDw~~a~~gDp~~Dla~~~~~~------------~~~~~~~~~~~y~  221 (235)
T cd05155         162 GPPVWFHGDLAPGNLLVQD--GRLSAVIDFGCLGVGDPACDLAIAWTLL------------DEDSRAAFRAALG  221 (235)
T ss_pred             CCceEEeCCCCCCcEEEEC--CCEEEEEeCcccCcCChHHHHHHHHhcC------------CHHHHHHHHHHcC
Confidence            6789999999999999974  455 599999999999999999764421            2355677777776


No 36 
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=98.77  E-value=6.8e-08  Score=91.09  Aligned_cols=63  Identities=29%  Similarity=0.362  Sum_probs=50.4

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeE-EEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKV-TFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEE  116 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l-~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~  116 (317)
                      ..+.++||+|++++|||+++ ++++ .+||||.|+.++|++|||..+.-            -+.+....|++.|-.+
T Consensus       182 ~~~~~lvHGD~~~~Nilv~~-~~~~~gviDWe~a~iGDPa~Dla~~~~~------------~~~~~~~~~~~~Y~~~  245 (276)
T cd05152         182 PRHTVLVHGDLHPGHILIDE-DARVTGLIDWTEAKVGDPARDFVLHYRI------------FGEAGLERLIDAYEAA  245 (276)
T ss_pred             CCCCeeEeCCCCCCcEEEeC-CCCEEEEECcHhcccCCHHHHHHHHHHh------------cChHHHHHHHHHHHHc
Confidence            45679999999999999975 3555 49999999999999999976441            1346677888888865


No 37 
>PRK11768 serine/threonine protein kinase; Provisional
Probab=98.76  E-value=7.8e-08  Score=92.48  Aligned_cols=119  Identities=15%  Similarity=0.119  Sum_probs=73.0

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhcCC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYTGS  120 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~  120 (317)
                      ..+.++||+|++++|||++  + .+.|||||.|+++++.+||+..+....        . ...+....|++.|-+.   +
T Consensus       193 ~~~~~liHgD~h~~NvL~~--d-~~~iIDFDd~~~g~~i~DLa~~l~~~~--------~-~~~~~~~~~l~GY~~~---r  257 (325)
T PRK11768        193 DVRLLRLHGDCHPGNILWR--D-GPHFVDLDDARMGPAVQDLWMLLSGDR--------A-EQLMQLETLLEGYEEF---C  257 (325)
T ss_pred             CCCccceecCCCchhcccc--C-CcEEEeCCCCCCCCHHHHHHHHhccCc--------c-hhHHHHHHHHHHhhcc---C
Confidence            4678999999999999994  2 588999999999999999998764210        0 1134455566666553   5


Q ss_pred             CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcC--C---CCCCHHHHHHHHHHHHHHhHh
Q psy8745         121 PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHS--D---IEFDFFQYASSTYQGYVLKRD  178 (317)
Q Consensus       121 ~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s--~---~~fDy~~Ya~~R~~~y~~~k~  178 (317)
                      +++++|++.+. -+....++...   .|..-+-...  +   ..|.=-.|....+....++..
T Consensus       258 ~l~~~e~~~l~-~l~~lR~~~~~---~W~~~r~~d~~~~~~f~~~~~~~~w~~~~~~~~~~~~  316 (325)
T PRK11768        258 EFDPRELALIE-PLRALRLIHYS---AWLARRWDDPAFPKAFPWFGTEDYWEQQILELREQLA  316 (325)
T ss_pred             CCCHHHHHHHH-HHHHHHHHHHH---HHHhhcCCCcchhhcCCCCCCchHHHHHHHHHHHHHH
Confidence            67887766543 22333443333   3333222210  1   244555666666655444433


No 38 
>PRK12396 5-methylribose kinase; Reviewed
Probab=98.72  E-value=4.6e-08  Score=96.83  Aligned_cols=62  Identities=21%  Similarity=0.339  Sum_probs=50.3

Q ss_pred             HHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhh
Q psy8745          25 QLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFA   90 (317)
Q Consensus        25 ~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~   90 (317)
                      .|+.|+..|+..+.+  ....++|+||++|||++++  +.+++||.|+|.|||++||||+++....
T Consensus       210 ~Lk~ev~~Lk~~F~~--~~~aLlHGDlHtGSI~v~~--~~~kvIDpEFAfyGP~gFDiG~~lanll  271 (409)
T PRK12396        210 ELRLEVAKLKFSFMT--NAQALIHGDLHTGSVFVKN--DSTKVIDPEFAFYGPMGYDIGNVMANLM  271 (409)
T ss_pred             HHHHHHHHHHHHHHh--cchhhccCcCCCCCEEecC--CceEEEcccccccCCcHHHHHHHHHHHH
Confidence            345556666655444  5689999999999999974  6799999999999999999999887643


No 39 
>PF02958 EcKinase:  Ecdysteroid kinase;  InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=98.71  E-value=4.2e-08  Score=91.98  Aligned_cols=68  Identities=25%  Similarity=0.417  Sum_probs=52.5

Q ss_pred             cCCCCeeeeecCCCCCCeeeeCCC----CeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHH
Q psy8745          39 KTKSPVVFCHNDLLLGNIIYDETE----DKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYL  114 (317)
Q Consensus        39 ~~~~~~v~CHnDl~~~NiL~~~~~----~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL  114 (317)
                      ......|+||+|++.+|||+..++    .++.+|||+++++++|+.||+.++....           +.+.+....+.+|
T Consensus       210 ~~~~~~vl~HGD~w~nNilf~~~~~g~~~~~~liDfQ~~~~g~p~~Dl~~fl~~s~-----------~~~~r~~~~~~ll  278 (294)
T PF02958_consen  210 SKEPFNVLCHGDFWTNNILFKYDDDGKPIDVVLIDFQLARYGSPAIDLAYFLYTSL-----------DPELRREHEDELL  278 (294)
T ss_pred             ccCCceEEEcCccCHHhEeEccccccccccceeeccccccCCCcHhHHHHHHHHCC-----------CHHHHHHHHHHHH
Confidence            345678999999999999995432    2699999999999999999999987532           3455555555555


Q ss_pred             HHh
Q psy8745         115 EEY  117 (317)
Q Consensus       115 ~~y  117 (317)
                      +.|
T Consensus       279 ~~Y  281 (294)
T PF02958_consen  279 RHY  281 (294)
T ss_pred             HHH
Confidence            555


No 40 
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=98.67  E-value=8.8e-08  Score=93.80  Aligned_cols=46  Identities=30%  Similarity=0.408  Sum_probs=41.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEF   89 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~   89 (317)
                      ....+|||||+++||++++  +.+.+||||+|.+|+++||||.++.+.
T Consensus       190 ~~~~llHGDl~~gNi~~~~--~~~~~iD~e~~~~G~~~~Dlg~~ianL  235 (370)
T TIGR01767       190 SAETLLHGDLHSGSIFVSE--HETKVIDPEFAFYGPIGFDIGQFIANL  235 (370)
T ss_pred             CcceeeeccCCcccEEEcC--CCCEEEcCcccccCchHhhHHHHHHHH
Confidence            4679999999999999964  568999999999999999999998764


No 41 
>PLN02876 acyl-CoA dehydrogenase
Probab=98.57  E-value=4.3e-07  Score=97.58  Aligned_cols=114  Identities=16%  Similarity=0.237  Sum_probs=73.2

Q ss_pred             HHHHHHHHHHHHHhcCCC---CeeeeecCCCCCCeeeeCCCCeE-EEEeeccccCCchhhhHHHHHHHhhCC---CCC--
Q psy8745          25 QLQSDWQYIETALSKTKS---PVVFCHNDLLLGNIIYDETEDKV-TFIDYEYAGVNYQAFDIANHFDEFAGV---SPI--   95 (317)
Q Consensus        25 ~L~~e~~~L~~~l~~~~~---~~v~CHnDl~~~NiL~~~~~~~l-~lIDfEya~~n~~~fDiAn~~~E~~~~---~~~--   95 (317)
                      .+.+-+.||...+.....   +.++||+|++++|+|++.++++| .|||||+|+.++|.+|||.++.-|...   ...  
T Consensus       203 ~~~~l~~wL~~~~P~~~~~~~~~~LvHGD~~~~Nvl~~~~~~~v~aVLDWE~a~~GdPl~DLa~~~~~~~~~~~~~~~~~  282 (822)
T PLN02876        203 KMLELIDWLRENIPAEDSTGAGTGIVHGDFRIDNLVFHPTEDRVIGILDWELSTLGNQMCDVAYSCLPYIVDINLDNQQV  282 (822)
T ss_pred             hHHHHHHHHHhcCCCccccCCCcceEecCcccccEEEcCCCCeEEEEEeeeccccCChHHHHHHHhhhccccccCCcccc
Confidence            344445677665544322   57999999999999997544555 599999999999999999987755431   000  


Q ss_pred             ----CC----CCCCCHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHH
Q psy8745          96 ----DH----SRYPGPEFQLSWLRTYLEEYTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWG  149 (317)
Q Consensus        96 ----d~----~~yp~~e~~~~fi~~YL~~y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWa  149 (317)
                          ..    ..+|+   +.++++.|.+.- |.++....       +..|..++.|-|++-.
T Consensus       283 ~~~~~~~~~~~G~p~---~~e~~~~Y~~~~-g~~~~~~~-------~~~~~~~~~~r~a~I~  333 (822)
T PLN02876        283 GKGFEFTGIPEGIPS---LPEYLAEYCSAS-GKPWPAAN-------WKFYVAFSLFRGASIY  333 (822)
T ss_pred             ccccccCcCCCCCCC---HHHHHHHHHHHh-CCCCCCcc-------cHHHHHHHHHHHHHHH
Confidence                01    13455   567888998864 44332121       3345666666655544


No 42 
>PRK06149 hypothetical protein; Provisional
Probab=98.56  E-value=1e-06  Score=96.35  Aligned_cols=178  Identities=15%  Similarity=0.065  Sum_probs=111.7

Q ss_pred             CCCeeeeecCCCCCCeeeeCCC-Ce---EEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETE-DK---VTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEE  116 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~-~~---l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~  116 (317)
                      ..+..+||||++..||+++++. +.   ..||||+.++++++.+|||-.+..++....      ++......|++.|-+.
T Consensus       205 ~L~~g~IH~Dl~~~Nilv~~~~~~~~~v~giIDFgD~~~~~~i~DLAial~~~~~~~~------~dp~~~~~~l~GY~sv  278 (972)
T PRK06149        205 ALPLQAVHLDITDDNVVGSRDADGRWQPDGVIDFGDLVRTWRVADLAVTCASLLHHAG------GDPFSILPAVRAYHAV  278 (972)
T ss_pred             hCcccccCCCCCcccEEEcCCCCCCcceeEEEEcccchhhhHHHHHHHHHHHHhcccC------CCHHHHHHHHHHHHhc
Confidence            4688999999999999997532 22   359999999999999999998876653111      1223345677777665


Q ss_pred             hcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHhHhhhcCCCCCcc--hhhhhc
Q psy8745         117 YTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQGYVLKRDKYLGTSPPSP--QILHRA  194 (317)
Q Consensus       117 y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~~y~~~k~el~~~e~~~~--~~L~~~  194 (317)
                         ++++++|++.|+.-    ..+-...-..|+..|+...+.+    .|........++..+.+.++.+..+  .+...-
T Consensus       279 ---rpLt~~E~~~L~~l----i~~R~~~~~~~~~~~~~~~p~n----~Y~~~~~~~~w~~l~~~~~~~~~~~~~~~~~a~  347 (972)
T PRK06149        279 ---RPLSEAELKALWPL----VVARAAVLVASSEQQLAVDPDN----AYVRDNLAHEWEIFDVATSVPFALMEAAILAAL  347 (972)
T ss_pred             ---CCCCHHHHHHHHHH----HHHHHHHHHHHHHHHhhhCCCC----hhhhhccHHHHHHHHHHHhCCHHHHHHHHHHHc
Confidence               57899999887632    3333333445666666655433    5777777777777777766544322  333334


Q ss_pred             CCCCceEEEecCceEEEeec------Ccc------------CCCCCCCCcccHHHHHHHHHhhcc
Q psy8745         195 GLAPRLYAEFDNGLVYQYVR------GVT------------ITPDSIREPHIHPLVARNMARLHK  241 (317)
Q Consensus       195 ~~gp~l~g~F~nG~~e~fi~------g~t------------L~~~~l~~~~i~~~IA~~la~~H~  241 (317)
                      |+.+.=      .++..|-|      +..            ++...+.++.....++.++++-+.
T Consensus       348 g~~~~~------~~~~~~~~~~~~~~~~~~~~~dls~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  406 (972)
T PRK06149        348 GFDPPP------PDLSGWAPLLPGLDPASVALVDLSVLSPHFSAGNWEQPGIDWRLLASAAAAGG  406 (972)
T ss_pred             CCCCCc------chhhhhhhhcccccCCcceeccccccccccccCCCCCCChhhHHHHHHHhcCC
Confidence            443322      33333332      222            234455566666677777777554


No 43 
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=98.54  E-value=1.6e-07  Score=86.54  Aligned_cols=79  Identities=22%  Similarity=0.145  Sum_probs=67.9

Q ss_pred             CcchhhhhcCCCCceEEEecCceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCCCCCcchHHHHHHHhhccc
Q psy8745         186 PSPQILHRAGLAPRLYAEFDNGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNMKTPKLWSTGKHMLSLIPR  264 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~~~p~lw~~i~kwl~~~~~  264 (317)
                      ..++.|++.|++|++++.+++|+|++||+|++++..++.++.....+|+.|+++|++..++....++..+.+|...+..
T Consensus        43 ~~l~~l~~~g~~P~~i~~~~~~~v~e~i~G~~~~~~~~~~~~~~~~la~~l~~lH~~~~~~~~~~~~~~~~~~~~~l~~  121 (256)
T TIGR02721        43 QILQALSALGLAPKPILVNEHWLLVEWLEGEVITLDQFVALDLLLELAALLHQLHSQPRFGYPLSLKARIAHYWLQIDP  121 (256)
T ss_pred             HHHHHHHhcCCCCceEEEeCCEEEEEeccCcccccccccCchhHHHHHHHHHHHhCCCCCCCCCCHHHHHHHHHHhccc
Confidence            4456788899999999999999999999999999999999999999999999999987765444567788888766654


No 44 
>PRK06148 hypothetical protein; Provisional
Probab=98.54  E-value=8e-07  Score=97.53  Aligned_cols=129  Identities=14%  Similarity=0.059  Sum_probs=86.9

Q ss_pred             CCCeeeeecCCCCCCeeeeCCC-CeEE-EEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhc
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETE-DKVT-FIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYT  118 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~-~~l~-lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~  118 (317)
                      ..|..+||||+++.|||++++. +++. ||||+.++++++.+|||..+.-++...   .   ...+....|++.|-+.  
T Consensus       200 ~Lp~~vIHgDln~~NiLv~~~~~~~isGiIDFgDa~~~~~v~DLAialay~~~~~---~---~p~~~~~a~laGY~sv--  271 (1013)
T PRK06148        200 ALPAQVIHNDANDYNILVDADDGERISGLIDFGDAVHAPRICEVAIAAAYAILDH---P---DPIGAAAALVAGYHAV--  271 (1013)
T ss_pred             cCCcceECCCCCcccEEEcCCCCcceEEEEECcccccccHHHHHHHHHHHHhcCC---C---ChHHHHHHHHHHHhhc--
Confidence            4678899999999999997632 2566 999999999999999999875333211   0   1123455788888876  


Q ss_pred             CCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHhHhhhcCCCCC
Q psy8745         119 GSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDFFQYASSTYQGYVLKRDKYLGTSPP  186 (317)
Q Consensus       119 ~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy~~Ya~~R~~~y~~~k~el~~~e~~  186 (317)
                       ++++++|++.|+.    +..+-...-.+|+..++...+.+    .|...-....+...+.+.++.+.
T Consensus       272 -~pLt~~E~~~L~~----li~~R~~~s~~~~~~~~~~~P~n----~Y~~~~~~~~w~~l~~~~~~~~~  330 (1013)
T PRK06148        272 -YPLQAQELDLLFD----LIRMRLAVSVTNSASRREQTPDN----PYLAISEAPAWRLLERLDAMNPR  330 (1013)
T ss_pred             -CCCCHHHHHHHHH----HHHHHHHHHHHHHHHhhhcCCCC----hhhhhccHHHHHHHHHHHhCCHH
Confidence             5789999888763    23333334446666666665544    46555555566666666555553


No 45 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=98.43  E-value=8.3e-07  Score=72.16  Aligned_cols=45  Identities=42%  Similarity=0.673  Sum_probs=41.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHh
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEF   89 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~   89 (317)
                      .++||+|++++||++++ .+.+.+|||+.+.++++.+|++.+++-+
T Consensus       108 ~~i~H~Dl~~~Nil~~~-~~~~~l~Df~~~~~~~~~~d~~~~~~~~  152 (155)
T cd05120         108 LVLCHGDLHPGNILVDD-GKILGIIDWEYAGYGPPAFDLAAALLFN  152 (155)
T ss_pred             eEEEecCCCcceEEEEC-CcEEEEEecccccCCChHHHHHHHHHHh
Confidence            68999999999999986 6889999999999999999999998754


No 46 
>PLN02756 S-methyl-5-thioribose kinase
Probab=98.38  E-value=1.3e-06  Score=86.99  Aligned_cols=60  Identities=22%  Similarity=0.349  Sum_probs=48.9

Q ss_pred             HHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHH
Q psy8745          25 QLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDE   88 (317)
Q Consensus        25 ~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E   88 (317)
                      .|+.++..|+..+.+  ....++|+||++|||++++  ++..+||-|+|-|||++||||.++..
T Consensus       213 ~L~~~v~~Lk~~f~~--~~~~L~HGDl~~g~i~~~~--~~~~~id~ef~~~g~~~~d~g~~~~~  272 (418)
T PLN02756        213 ILKLEIAELKSMFCE--RAQALVHGDLHTGSVMVTP--DSTQVIDPEFAFYGPMGFDIGAFLGN  272 (418)
T ss_pred             HHHHHHHHHHHHHHh--cccceeecCCCCCcEEEcC--CCceEecchhhccCchHHhHHHHHhh
Confidence            455666666655444  4579999999999999975  56999999999999999999997664


No 47 
>PF07914 DUF1679:  Protein of unknown function (DUF1679);  InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO). 
Probab=98.38  E-value=2.8e-06  Score=84.74  Aligned_cols=82  Identities=26%  Similarity=0.270  Sum_probs=61.6

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCC---eEE-EEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETED---KVT-FIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEE  116 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~---~l~-lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~  116 (317)
                      +.+.|+||+||+..|||++.+++   .+. +|||..+..+.|+.||+..++-.+           +.+.|+.--+.+|+.
T Consensus       265 G~~~VL~HGDLw~~NiLw~k~~~g~~~l~AIIDwQ~vh~G~~~eDl~Rll~~~l-----------S~edRR~~~~~lL~~  333 (414)
T PF07914_consen  265 GIKPVLVHGDLWSSNILWDKDSDGKLKLKAIIDWQCVHRGSPAEDLARLLVSCL-----------SGEDRREHTEELLEY  333 (414)
T ss_pred             CCCcceecCCccHHheeeecCCchhHHHHHHHHHHHhhcCchHHHHHHHHHhcC-----------CHHHHHHHHHHHHHH
Confidence            55889999999999999986443   344 999999999999999999988543           355666655666655


Q ss_pred             hc-----------CCCCCHHHHHHHHHh
Q psy8745         117 YT-----------GSPPSPHQLATLHWQ  133 (317)
Q Consensus       117 y~-----------~~~~s~~ev~~l~~~  133 (317)
                      |.           ..+.|-+++...|..
T Consensus       334 Yy~~f~~~l~~~~~~PfT~eqL~~sY~l  361 (414)
T PF07914_consen  334 YYDTFTEALEDGGKAPFTLEQLKDSYRL  361 (414)
T ss_pred             HHHHHHHHHhccCCCCccHHHHHHHHHH
Confidence            53           245666777776653


No 48 
>PRK10593 hypothetical protein; Provisional
Probab=98.35  E-value=1.4e-06  Score=82.92  Aligned_cols=70  Identities=14%  Similarity=0.293  Sum_probs=51.5

Q ss_pred             HHHHHhcCCCCeeeeecCCCCCCeeeeCCCCe-EEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHH
Q psy8745          33 IETALSKTKSPVVFCHNDLLLGNIIYDETEDK-VTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLR  111 (317)
Q Consensus        33 L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~-l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~  111 (317)
                      +.+.|.....+.++||+|++++|+|++...+. ..+||+.-+.|+++-+||+..+.  .+             ....|++
T Consensus       182 l~~~L~~~~~~psLlHGDlw~gNvl~~~~~~~i~~liDPa~~~~g~rE~DLa~~~~--~~-------------f~~~f~~  246 (297)
T PRK10593        182 LPALFEGFNDNCVLVHGNFTLRSMLKDPRSDQLLAMLNPGLMLWAPREYELFRLMD--NG-------------LAEQLLW  246 (297)
T ss_pred             chhhhccCCCCCeeEeCCCCcccEEECCCCCceEEEECchHhCCCCHHHhHHHhhc--CC-------------ccHHHHH
Confidence            33444444456799999999999999753344 78999999999999999987641  11             1236788


Q ss_pred             HHHHHh
Q psy8745         112 TYLEEY  117 (317)
Q Consensus       112 ~YL~~y  117 (317)
                      .|.+.+
T Consensus       247 ~Y~~~~  252 (297)
T PRK10593        247 RYLQKA  252 (297)
T ss_pred             HHHHhC
Confidence            888875


No 49 
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=98.22  E-value=3.8e-06  Score=81.16  Aligned_cols=61  Identities=23%  Similarity=0.269  Sum_probs=51.0

Q ss_pred             HHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHH
Q psy8745          25 QLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHF   86 (317)
Q Consensus        25 ~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~   86 (317)
                      .+...+.|++........+.++.|+|++++|||+++ ++.+-|||||.++.++|..|++.++
T Consensus       179 ~~~~~~~Wl~~~~p~~~~~~~lvHGD~~~gNlii~~-~~~~gVlDwe~~~lGDP~~Dl~~~~  239 (321)
T COG3173         179 LADRLIKWLEANRPPWAGPPVLVHGDYRPGNLIIDP-GRPTGVLDWELATLGDPLEDLAIIC  239 (321)
T ss_pred             hHHHHHHHHHhcCCCcCCCceeeeCCcccCCEEEeC-CCeeEEEeccccccCCcHHHHHHHH
Confidence            344446777776555678899999999999999986 4558899999999999999999986


No 50 
>TIGR02905 spore_yutH spore coat protein YutH. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria.
Probab=98.19  E-value=6.4e-06  Score=78.93  Aligned_cols=96  Identities=14%  Similarity=0.139  Sum_probs=72.2

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhh-CCCCCCCCCCCCHHHHHHHHHHHHHHhcCC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFA-GVSPIDHSRYPGPEFQLSWLRTYLEEYTGS  120 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~-~~~~~d~~~yp~~e~~~~fi~~YL~~y~~~  120 (317)
                      ...++||+|+..+|+| .  ++++.+|+||++ +++|..||++++...+ ....  +    +-+.-..+|+.|-+.   .
T Consensus       187 ~~~~lCH~d~~~hn~l-~--~~~~~~i~~d~~-~D~~~~DL~~firk~~~k~~~--~----~~~~~~~~l~~Y~~~---~  253 (313)
T TIGR02905       187 DSGTICHERFGETTWL-E--RGGLIKPPTEWV-YDHPARDLAEWIRERYMGEIR--Q----NQRAIASFLQEYEQA---A  253 (313)
T ss_pred             ccCccccCccCccccc-c--CCCeEecccccc-cccchhHHHHHHHHHHHHhcc--c----cHHHHHHHHHHhhhc---C
Confidence            4569999999999987 3  477999999955 9999999999999854 2111  1    134556677777765   5


Q ss_pred             CCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhh
Q psy8745         121 PPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAE  154 (317)
Q Consensus       121 ~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~  154 (317)
                      +++++|.+.|+    .+.++++-||-+=--+...
T Consensus       254 pL~~~e~~~l~----~~L~FP~~fwk~~~~Yy~~  283 (313)
T TIGR02905       254 PLTPFSWRLMY----ARLLFPLHYFETIENYYIA  283 (313)
T ss_pred             CCCHHHHHHHH----HHHcCcHHHHHHHHHHHhC
Confidence            78999999887    4688999998876555543


No 51 
>COG3178 Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only]
Probab=97.82  E-value=0.00014  Score=69.68  Aligned_cols=106  Identities=22%  Similarity=0.345  Sum_probs=71.5

Q ss_pred             CCCeeeeecCCCCCCeeeeCC---CCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHh
Q psy8745          41 KSPVVFCHNDLLLGNIIYDET---EDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEY  117 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~---~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y  117 (317)
                      ..+.|+||+|.++-|||+...   .+++-+|||.-|.++|.+||++..+... ..+   +    +++.....+..|+.+.
T Consensus       197 ~~~~vlvhRDfh~~NLmw~~~~~g~~rvGvlDFQDA~iGP~aYDvasL~~DA-rvt---~----~pe~~~~~l~rY~~~r  268 (351)
T COG3178         197 AQPKVLVHRDFHSRNLMWTADRAGADRVGVLDFQDALIGPIAYDVASLLRDA-RVT---W----SPERELALLDRYWAAR  268 (351)
T ss_pred             cCCceeeeccccCccceecCCccCCCCCceeehhhhhcCcchhhHHHHHhhc-ccc---C----CHHHHHHHHHHHHHhh
Confidence            578999999999999999642   2489999999999999999999988752 211   2    3677788999999886


Q ss_pred             c--CCCCCHHHHHHHHHhhhhhhhhhHH-HHHHHHHHHhhcCC
Q psy8745         118 T--GSPPSPHQLATLHWQVQQFSPVAHC-FWTIWGLVQAEHSD  157 (317)
Q Consensus       118 ~--~~~~s~~ev~~l~~~v~~~~l~shl-~W~lWaliq~~~s~  157 (317)
                      .  |.+.++   ..++.....+..--|+ .=++|+-+-...++
T Consensus       269 ~~~g~p~d~---~~Flra~~~MgaQR~~KvlGIFaRL~~RDGK  308 (351)
T COG3178         269 RAAGLPFDE---AAFLRAYAWMGAQRHLKVLGIFARLYYRDGK  308 (351)
T ss_pred             hhcCCCcCH---HHHHHHHHHHHHHHHhHHHHHhhhhhhccCC
Confidence            4  222222   3333222222222222 34677766666554


No 52 
>COG4857 Predicted kinase [General function prediction only]
Probab=97.76  E-value=9.3e-05  Score=70.52  Aligned_cols=59  Identities=27%  Similarity=0.317  Sum_probs=46.8

Q ss_pred             HHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHH
Q psy8745          26 LQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDE   88 (317)
Q Consensus        26 L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E   88 (317)
                      |+-|+..|+..+..  ....+||+||+.|.|++++  ....+||=|+|.|||-+||||+++..
T Consensus       212 lkvea~kLk~~F~~--~aetLiHGDLHsGSIfvte--~etkvIDPEFaFYGPmafDiG~~iaN  270 (408)
T COG4857         212 LKVEAQKLKHKFMA--YAETLIHGDLHSGSIFVTE--KETKVIDPEFAFYGPMAFDIGMLIAN  270 (408)
T ss_pred             hhhhHHHHHHHHHH--HhHHHhccccccCcEEeec--CcceeeCccccccCcchhhHHHHHHH
Confidence            44445555554433  3457999999999999975  66899999999999999999998875


No 53 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=97.70  E-value=0.00013  Score=64.39  Aligned_cols=83  Identities=20%  Similarity=0.247  Sum_probs=53.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCC--HHHHHHHHHHHHHHhcCCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPG--PEFQLSWLRTYLEEYTGSP  121 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~--~e~~~~fi~~YL~~y~~~~  121 (317)
                      ..++|+|++|+|||++  ++.+.+|||+.+....+.+|.+.-+..+...  . ...+|.  .+....|+..|...+   .
T Consensus       114 ~~i~H~Dl~p~Nil~~--~~~~~liDf~~a~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~~~~f~~gY~~~~---~  185 (211)
T PRK14879        114 AGIIHGDLTTSNMILS--GGKIYLIDFGLAEFSKDLEDRAVDLHVLLRS--L-ESTHPDWAEELFEAFLEGYREVM---G  185 (211)
T ss_pred             CCcccCCCCcccEEEE--CCCEEEEECCcccCCCcHHhhhccHHHHHHH--h-hccCcchHHHHHHHHHHHHHHhh---c
Confidence            4689999999999997  4789999999999999998887644332210  0 001232  244556677776643   2


Q ss_pred             CCHHHHHHHHHhh
Q psy8745         122 PSPHQLATLHWQV  134 (317)
Q Consensus       122 ~s~~ev~~l~~~v  134 (317)
                      .+.+++...+..+
T Consensus       186 ~~~~~~~~~~~~i  198 (211)
T PRK14879        186 EKAEEVLERVKEI  198 (211)
T ss_pred             ccHHHHHHHHHHH
Confidence            3445555444443


No 54 
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=97.67  E-value=0.0001  Score=64.61  Aligned_cols=41  Identities=29%  Similarity=0.369  Sum_probs=36.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHH
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHF   86 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~   86 (317)
                      ..++|+|++++||+++  ++++.+|||+.+....+..|.+.-+
T Consensus       109 ~gi~H~Dl~~~Nil~~--~~~~~liDfg~a~~~~~~~~~~~~~  149 (199)
T TIGR03724       109 AGIVHGDLTTSNIIVR--DDKLYLIDFGLGKYSDEIEDKAVDL  149 (199)
T ss_pred             CCeecCCCCcceEEEE--CCcEEEEECCCCcCCCcHHhhhchH
Confidence            4689999999999997  5789999999999999998887544


No 55 
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=97.44  E-value=0.00047  Score=61.98  Aligned_cols=64  Identities=22%  Similarity=0.225  Sum_probs=44.3

Q ss_pred             CeeeeecCCCCCCeeeeCCC--CeEEEEeeccccCCc-----hhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHH
Q psy8745          43 PVVFCHNDLLLGNIIYDETE--DKVTFIDYEYAGVNY-----QAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTY  113 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~--~~l~lIDfEya~~n~-----~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~Y  113 (317)
                      ...++|+||+++|||++.++  .++++||+|-+....     +.-||+.+......   .    .-+.++...|++.|
T Consensus       136 ~~gi~H~Dl~~~NILv~~~~~~~~~~lIDld~~~~~~~~~~~~~~dL~~L~rs~~~---~----~~~~~d~~~fl~~Y  206 (206)
T PF06293_consen  136 DAGIYHGDLNPSNILVDPDDGQYRFYLIDLDRMRFRPSSRRWRAKDLARLLRSLLR---S----GWSERDRQRFLRGY  206 (206)
T ss_pred             HCcCCCCCCCcccEEEeCCCCceeEEEEcchhceeCCCChHHHHHhHHHHHHhccc---c----CCCHHHHHHHHhhC
Confidence            46899999999999998632  269999999988877     45566665443211   1    12456666777665


No 56 
>PF03881 Fructosamin_kin:  Fructosamine kinase;  InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=97.37  E-value=0.00031  Score=66.95  Aligned_cols=75  Identities=17%  Similarity=0.282  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHH
Q psy8745          28 SDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQL  107 (317)
Q Consensus        28 ~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~  107 (317)
                      +-++.+.+.+.....+.+++|+||+.||++.+. ++..+|||=- |-|+++-+|||..  +.  +     ..+     -.
T Consensus       172 ~l~~~~~~~l~~~~~~PsLlHGDLW~GN~~~~~-~g~p~l~DPa-~yygh~E~DLam~--~l--f-----ggf-----~~  235 (288)
T PF03881_consen  172 RLVERLPSLLPGREPKPSLLHGDLWSGNVGFDA-DGEPVLFDPA-CYYGHREVDLAMT--RL--F-----GGF-----PD  235 (288)
T ss_dssp             HHHHHHHHCCTTS----EEE-SS-SGGGEEEET-TE-EEE-S----EEE-CHHHHHHH--CC--C-----STT-----HH
T ss_pred             HHHHHHHHHhcCCCCCceeeEcCccccceeecC-CCCceeeccc-cccCchHhhhhhh--hh--h-----CCC-----CH
Confidence            333445555554556779999999999999987 4779999987 8899999999963  11  1     111     24


Q ss_pred             HHHHHHHHHhc
Q psy8745         108 SWLRTYLEEYT  118 (317)
Q Consensus       108 ~fi~~YL~~y~  118 (317)
                      .|++.|.+.+.
T Consensus       236 ~f~~~Y~~~~P  246 (288)
T PF03881_consen  236 EFYDAYQEHYP  246 (288)
T ss_dssp             HHHHHHHHHS-
T ss_pred             HHHHHHHhcCC
Confidence            68899998863


No 57 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=97.30  E-value=0.00036  Score=59.14  Aligned_cols=59  Identities=19%  Similarity=0.396  Sum_probs=51.3

Q ss_pred             CcchhhhhcCCCCceEEEec--CceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         186 PSPQILHRAGLAPRLYAEFD--NGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~--nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      ..+..|+..++.|++++.+.  +++|.+||+|+++...+..++.+...+|+.|+++|....
T Consensus        44 ~~l~~l~~~~~~P~~~~~~~~~~~lv~e~i~G~~l~~~~~~~~~~~~~l~~~l~~LH~~~~  104 (170)
T cd05151          44 ENSKLAAEAGIGPKLYYFDPETGVLITEFIEGSELLTEDFSDPENLEKIAKLLKKLHSSPL  104 (170)
T ss_pred             HHHHHHHHhCCCCceEEEeCCCCeEEEEecCCCccccccccCHHHHHHHHHHHHHHhCCCC
Confidence            34456777789999999998  899999999999987777888899999999999998764


No 58 
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=97.09  E-value=0.003  Score=57.01  Aligned_cols=68  Identities=24%  Similarity=0.335  Sum_probs=47.8

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHH----HHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHHhc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIAN----HFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEEYT  118 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn----~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~y~  118 (317)
                      ...+||+||.++||++.+  ++++||||-.+..+.-.-|.|-    ++...      .-+++..++....|++.|.+.+.
T Consensus       110 ~~givHGDLTtsNiIl~~--~~i~~IDfGLg~~s~~~Ed~aVDl~Vleral------~sth~~~e~l~~~f~~gY~~~~~  181 (204)
T COG3642         110 KAGIVHGDLTTSNIILSG--GRIYFIDFGLGEFSDEVEDKAVDLHVLERAL------ESTHEKAEELFAAFLEGYREEFG  181 (204)
T ss_pred             hcCeecCCCccceEEEeC--CcEEEEECCcccccccHHhhhchHHHHHHHH------HhccccHHHHHHHHHHHHHHHhc
Confidence            368999999999999974  5699999999988866555553    33321      11223345666778888887764


No 59 
>PF04655 APH_6_hur:  Aminoglycoside/hydroxyurea antibiotic resistance kinase;  InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=97.09  E-value=0.004  Score=58.37  Aligned_cols=53  Identities=25%  Similarity=0.198  Sum_probs=42.5

Q ss_pred             HHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHh
Q psy8745          35 TALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEF   89 (317)
Q Consensus        35 ~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~   89 (317)
                      +.|-....+.++.|+||+.+|||... ......||=.-.- ++|+||++++|++.
T Consensus       151 ~~Ll~~~~~~~lLHGDLH~~NIL~~~-~~~WlaIDPkgl~-Gdp~yd~a~~l~n~  203 (253)
T PF04655_consen  151 RELLASPGEEVLLHGDLHHGNILAAG-RRGWLAIDPKGLV-GDPAYDLAPLLRNP  203 (253)
T ss_pred             HHHhcCCCcceeeccccchHhhhccC-CCCceEeCCcccc-cccccCHHHHHhCc
Confidence            33434556789999999999999865 4678899987665 99999999998853


No 60 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=96.88  E-value=0.0013  Score=67.32  Aligned_cols=41  Identities=24%  Similarity=0.314  Sum_probs=36.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHH
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHF   86 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~   86 (317)
                      ..++|+|++|.|||++  ++.+++|||+.|...++..|++..+
T Consensus       447 ~giiHrDlkp~NILl~--~~~~~liDFGla~~~~~~~d~a~~l  487 (535)
T PRK09605        447 AGIVHGDLTTSNFIVR--DDRLYLIDFGLGKYSDLIEDKAVDL  487 (535)
T ss_pred             CCCccCCCChHHEEEE--CCcEEEEeCcccccCCchHhhhhhH
Confidence            4689999999999994  5789999999999999999998855


No 61 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=96.75  E-value=0.0016  Score=59.61  Aligned_cols=78  Identities=15%  Similarity=0.310  Sum_probs=59.0

Q ss_pred             CcchhhhhcCC-CCceEEEecC----ceEEEeecCcc-----CCCCCCCCcccHHHHHHHHHhhcccCCCC-CCCcchHH
Q psy8745         186 PSPQILHRAGL-APRLYAEFDN----GLVYQYVRGVT-----ITPDSIREPHIHPLVARNMARLHKVHSNM-KTPKLWST  254 (317)
Q Consensus       186 ~~~~~L~~~~~-gp~l~g~F~n----G~~e~fi~g~t-----L~~~~l~~~~i~~~IA~~la~~H~~~~~~-~~p~lw~~  254 (317)
                      ..+..|...|+ .|+.++.-..    |++.++|+|.+     +.......+.+...+|+.|+++|.+.++. ..|..+..
T Consensus        44 ~~l~~l~~~glpvP~~~~~~~~~~~~glv~e~i~G~~~~~~~~~~~~~~~~~l~~~la~~l~~lH~~~~~~~~l~~~~~~  123 (226)
T TIGR02172        44 DASRKVFSLGIPTPHPFDLVEDGGRLGLIYELIVGKRSFSRIISDNPSRLEEIAKIFAEMAKKLHSTKCDTSTFQSYKEK  123 (226)
T ss_pred             HHHHHHHHcCCCCCceEEEEecCCeeeeeeeecCCccchhhhhcCCHHHHHHHHHHHHHHHHHHhCCCCCCCcHHHHHHH
Confidence            55567888999 7999988766    99999999985     33333334568899999999999986653 45567888


Q ss_pred             HHHHHhhcc
Q psy8745         255 GKHMLSLIP  263 (317)
Q Consensus       255 i~kwl~~~~  263 (317)
                      ++++++...
T Consensus       124 ~~~~l~~~~  132 (226)
T TIGR02172       124 IRKFIEEKD  132 (226)
T ss_pred             HHHHHHhcc
Confidence            888886544


No 62 
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=96.72  E-value=0.0083  Score=56.63  Aligned_cols=66  Identities=20%  Similarity=0.256  Sum_probs=47.0

Q ss_pred             CeeeeecCCCCCCeeeeC------CCCeEEEEeeccccC------CchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHH
Q psy8745          43 PVVFCHNDLLLGNIIYDE------TEDKVTFIDYEYAGV------NYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWL  110 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~------~~~~l~lIDfEya~~------n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi  110 (317)
                      ...++|+||+++|||++.      .+..++|||+|-+..      ..+.-|++.+......   .    .-+......|+
T Consensus       156 ~~Gi~HgDL~~~NiLl~~~~~~~~~~~~~~LIDl~r~~~~~~~~~~~r~~dL~~L~~s~~~---~----~ls~~d~~~fl  228 (268)
T PRK15123        156 AAGINHRDCYICHFLLHLPFPGREEDLKLSVIDLHRAQIRARVPRRWRDKDLAGLYFSAMD---I----GLTQRDILRFL  228 (268)
T ss_pred             HCcCccCCCChhhEEEeccccCCCCCceEEEEECCcccccCCCChHHHHHHHHHHHHHhcc---c----CCCHHHHHHHH
Confidence            468999999999999974      145799999998732      3556888887654321   1    12466677788


Q ss_pred             HHHHH
Q psy8745         111 RTYLE  115 (317)
Q Consensus       111 ~~YL~  115 (317)
                      ..|..
T Consensus       229 ~~Y~~  233 (268)
T PRK15123        229 RVYFG  233 (268)
T ss_pred             HHHhC
Confidence            87775


No 63 
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=96.59  E-value=0.012  Score=54.29  Aligned_cols=34  Identities=26%  Similarity=0.384  Sum_probs=29.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      ..++|+|++|+|||++. ++.++||||+.+....+
T Consensus       161 ~GI~HrDlkp~NILv~~-~~~v~LIDfg~~~~~~~  194 (239)
T PRK01723        161 AGVYHADLNAHNILLDP-DGKFWLIDFDRGELRTP  194 (239)
T ss_pred             CCCCCCCCCchhEEEcC-CCCEEEEECCCcccCCC
Confidence            46899999999999976 56899999998887654


No 64 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=96.59  E-value=0.0063  Score=55.90  Aligned_cols=35  Identities=26%  Similarity=0.305  Sum_probs=29.2

Q ss_pred             CeeeeecCC-CCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          43 PVVFCHNDL-LLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        43 ~~v~CHnDl-~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      ...++|+|| .++|||+++ ++.++||||..|....+
T Consensus       109 ~~GIvHrDL~kp~NILv~~-~g~i~LIDFG~A~~~~~  144 (218)
T PRK12274        109 RCGVAHNDLAKEANWLVQE-DGSPAVIDFQLAVRGNP  144 (218)
T ss_pred             HCcCccCCCCCcceEEEcC-CCCEEEEECCCceecCC
Confidence            347999999 799999975 57899999999886554


No 65 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=96.35  E-value=0.0042  Score=54.79  Aligned_cols=31  Identities=32%  Similarity=0.296  Sum_probs=27.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|+||+++  +++++||||..|..-
T Consensus       137 ~givHrDlkP~NIll~--~~~~~liDFG~a~~~  167 (190)
T cd05145         137 AGLVHGDLSEYNILYH--DGKPYIIDVSQAVEL  167 (190)
T ss_pred             CCEecCCCChhhEEEE--CCCEEEEEcccceec
Confidence            5899999999999997  478999999988753


No 66 
>PRK09902 hypothetical protein; Provisional
Probab=96.31  E-value=0.016  Score=53.15  Aligned_cols=63  Identities=16%  Similarity=0.026  Sum_probs=46.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCe--EEEEeeccccCCc-----hhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHH
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDK--VTFIDYEYAGVNY-----QAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLE  115 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~--l~lIDfEya~~n~-----~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~  115 (317)
                      ...++|+|+++.||+++. +++  +.|||||=+....     ..-||+.+.....+         .++.++..|+..|+.
T Consensus       146 ~~Gv~Hgdly~khIll~~-~g~~~v~lIDlEk~r~~l~~~~~~~~Dl~~l~r~~~~---------~s~~~~~~~~~~y~~  215 (216)
T PRK09902        146 SVNRQHGCCYVRHIYVKT-EGKAEAGFLDLEKSRRRLRRDKAINHDFRQLEKYLEP---------IPKADWEQVKAYYYA  215 (216)
T ss_pred             HCCCcCCCCCHhheeecC-CCCeeEEEEEhhccchhhhhhhhhHhHHHHHHHhccC---------CCHHHHHHHHHHHhc
Confidence            468999999999999974 345  9999999876544     46688776543111         246778888888873


No 67 
>COG3570 StrB Streptomycin 6-kinase [Defense mechanisms]
Probab=96.28  E-value=0.015  Score=53.49  Aligned_cols=47  Identities=30%  Similarity=0.319  Sum_probs=38.2

Q ss_pred             CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHH
Q psy8745          40 TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDE   88 (317)
Q Consensus        40 ~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E   88 (317)
                      ....+++.|+||+.+|||-.+ .....+||=--. ++.++||.||.||+
T Consensus       157 ~p~di~pLHGDlHH~Nild~~-~rGWlvIDPkgl-~Gdrg~D~ANlf~N  203 (274)
T COG3570         157 TPRDIRPLHGDLHHGNILDGD-RRGWLVIDPKGL-IGDRGFDYANLFCN  203 (274)
T ss_pred             CccccccCcccccccccccCC-cCceEEEccccc-cCccccchHhhhcC
Confidence            355789999999999998754 346889997554 48999999999985


No 68 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=96.09  E-value=0.0048  Score=54.84  Aligned_cols=29  Identities=28%  Similarity=0.391  Sum_probs=25.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|+|||+++  +.++||||-.|.
T Consensus       137 ~giiHrDlkP~NIli~~--~~v~LiDFG~a~  165 (190)
T cd05147         137 CRLVHADLSEYNLLYHD--GKLYIIDVSQSV  165 (190)
T ss_pred             CCcccCCCCHHHEEEEC--CcEEEEEccccc
Confidence            46999999999999973  789999998765


No 69 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=95.96  E-value=0.007  Score=52.29  Aligned_cols=29  Identities=38%  Similarity=0.371  Sum_probs=25.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|+||+++  ++.+.+|||..|.
T Consensus       134 ~~ivH~Dl~p~Nili~--~~~~~liDfg~a~  162 (187)
T cd05119         134 AGLVHGDLSEYNILVD--DGKVYIIDVPQAV  162 (187)
T ss_pred             cCcCcCCCChhhEEEE--CCcEEEEECcccc
Confidence            5689999999999998  5789999998775


No 70 
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=95.80  E-value=0.0098  Score=54.05  Aligned_cols=60  Identities=17%  Similarity=0.117  Sum_probs=48.6

Q ss_pred             CcchhhhhcCCCCceEEEecC----ceEEEeecCccCCCCC--CCCcccHHHHHHHHHhhcccCCC
Q psy8745         186 PSPQILHRAGLAPRLYAEFDN----GLVYQYVRGVTITPDS--IREPHIHPLVARNMARLHKVHSN  245 (317)
Q Consensus       186 ~~~~~L~~~~~gp~l~g~F~n----G~~e~fi~g~tL~~~~--l~~~~i~~~IA~~la~~H~~~~~  245 (317)
                      ..+..|++....|++++...+    +.|++||+|++|+...  ...+.+...+|+.|+++|.+..+
T Consensus        43 ~~l~~l~~~~~vP~v~~~~~~~~~~~lv~e~i~G~~l~~~~~~~~~~~~~~~l~~~l~~lH~i~~~  108 (244)
T cd05150          43 ERLRWLAGKLPVPEVIDYGSDDGRAWLLTSAVPGVPAAALWEELEPERLVDALAEALRRLHALPVA  108 (244)
T ss_pred             HHHHHHHhcCCCCeEEEEEecCCccEEEEEeeCCccHhHhhcccCHHHHHHHHHHHHHHHhcCCcc
Confidence            445667777889999999874    7999999999998654  44557888999999999998653


No 71 
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=95.74  E-value=0.028  Score=52.62  Aligned_cols=81  Identities=17%  Similarity=0.251  Sum_probs=57.7

Q ss_pred             hcCCCCHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhCCCCCC
Q psy8745          17 ALFPGGVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAGVSPID   96 (317)
Q Consensus        17 ~~~p~~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~~~~~d   96 (317)
                      ..|+ +++.+..   .+.+.|+.......+.|+||+.+|.++.. +| .+++|= -|-+++|-+|||..  |+-      
T Consensus       164 ~~f~-did~~~~---~v~elL~~hqpqPsLlHGDLW~gN~a~~~-~G-Pv~fDP-A~y~GDrE~Dlam~--elF------  228 (286)
T COG3001         164 LTFG-DIDAIVE---KIQELLADHQPQPSLLHGDLWSGNCAFGK-DG-PVIFDP-ACYWGDRECDLAML--ELF------  228 (286)
T ss_pred             CCcc-CHHHHHH---HHHHHHhcCCCCcceeecccccccccccC-CC-Ceeecc-ccccCCcccceehh--hhh------
Confidence            4677 7766554   55666777777789999999999999865 34 777775 35568999999974  221      


Q ss_pred             CCCCCCHHHHHHHHHHHHHHhc
Q psy8745          97 HSRYPGPEFQLSWLRTYLEEYT  118 (317)
Q Consensus        97 ~~~yp~~e~~~~fi~~YL~~y~  118 (317)
                       ..||     .+|.+.|.+.+.
T Consensus       229 -ggfp-----~efy~gY~sv~P  244 (286)
T COG3001         229 -GGFP-----PEFYDGYQSVSP  244 (286)
T ss_pred             -cCCc-----HHHHHhhhccCC
Confidence             1233     457889988764


No 72 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=95.72  E-value=0.017  Score=50.97  Aligned_cols=30  Identities=30%  Similarity=0.378  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|+||++++ ++.+.||||..|+
T Consensus       144 ~gi~H~Dl~p~Nill~~-~~~~~liDfg~~~  173 (198)
T cd05144         144 HGIIHGDLSEFNILVDD-DEKIYIIDWPQMV  173 (198)
T ss_pred             CCCCcCCCCcccEEEcC-CCcEEEEECCccc
Confidence            57999999999999986 6789999998774


No 73 
>smart00090 RIO RIO-like kinase.
Probab=95.71  E-value=0.02  Score=52.80  Aligned_cols=28  Identities=32%  Similarity=0.364  Sum_probs=25.2

Q ss_pred             eeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          46 FCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        46 ~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      +||+|++|+||+++  +++++||||..|..
T Consensus       170 iiH~Dikp~NIli~--~~~i~LiDFg~a~~  197 (237)
T smart00090      170 LVHGDLSEYNILVH--DGKVVIIDVSQSVE  197 (237)
T ss_pred             EEeCCCChhhEEEE--CCCEEEEEChhhhc
Confidence            89999999999997  47899999988873


No 74 
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=95.58  E-value=0.02  Score=51.33  Aligned_cols=29  Identities=38%  Similarity=0.428  Sum_probs=22.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+.|+||.+.|||+++  +++++|||+-|-
T Consensus       126 ~givHGDLs~~NIlv~~--~~~~iIDf~qav  154 (188)
T PF01163_consen  126 AGIVHGDLSEYNILVDD--GKVYIIDFGQAV  154 (188)
T ss_dssp             TTEEESS-STTSEEEET--TCEEE--GTTEE
T ss_pred             cCceecCCChhhEEeec--ceEEEEecCcce
Confidence            58999999999999985  589999997554


No 75 
>KOG0668|consensus
Probab=95.29  E-value=0.011  Score=55.18  Aligned_cols=41  Identities=20%  Similarity=0.263  Sum_probs=35.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhH
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDI   82 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDi   82 (317)
                      ...++.|+|++|+|+|+|....++.||||-.|-+..|+-|.
T Consensus       149 HS~GImHRDVKPhNvmIdh~~rkLrlIDWGLAEFYHp~~eY  189 (338)
T KOG0668|consen  149 HSMGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEY  189 (338)
T ss_pred             HhcCcccccCCcceeeechhhceeeeeecchHhhcCCCcee
Confidence            45789999999999999877788999999888877777654


No 76 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=95.24  E-value=0.04  Score=48.23  Aligned_cols=79  Identities=16%  Similarity=0.154  Sum_probs=57.2

Q ss_pred             cchhhhhcCC-CCceEEEecC-------ceEEEeecCccCCCCCC---CC----cccHHHHHHHHHhhcccCCCC-----
Q psy8745         187 SPQILHRAGL-APRLYAEFDN-------GLVYQYVRGVTITPDSI---RE----PHIHPLVARNMARLHKVHSNM-----  246 (317)
Q Consensus       187 ~~~~L~~~~~-gp~l~g~F~n-------G~~e~fi~g~tL~~~~l---~~----~~i~~~IA~~la~~H~~~~~~-----  246 (317)
                      .++.|+..|+ .|++++...+       ..+.+|++|.++....+   .+    ..+...||+.|+++|....+.     
T Consensus        48 ~~~~l~~~~~~vp~~~~~~~~~~~~~~~~~v~e~i~G~~l~~~~~~~~~~~~~~~~i~~~i~~~l~~lH~~~~~~~~~~~  127 (223)
T cd05154          48 VLRALAGTGVPVPKVLALCEDPSVLGTPFYVMERVDGRVLRDRLLRPELSPEERRALARALADTLAALHSVDPAAVGLGD  127 (223)
T ss_pred             HHHHhhCCCCCCCCEEEECCCCCccCCceEEEEEeCCEecCCCCCCCCCCHHHHHHHHHHHHHHHHHHhCCChhhcCCcc
Confidence            3456667677 8888888876       58999999999988664   22    256789999999999986531     


Q ss_pred             -C--CCcchHHHHHHHhhcccc
Q psy8745         247 -K--TPKLWSTGKHMLSLIPRT  265 (317)
Q Consensus       247 -~--~p~lw~~i~kwl~~~~~~  265 (317)
                       .  ...+...+.+|...+...
T Consensus       128 ~~~~~~~~~~~~~~~~~~~~~~  149 (223)
T cd05154         128 LGRPGGYLERQVARWRRQYDAS  149 (223)
T ss_pred             cCCCCchHHHHHHHHHHHHHhh
Confidence             1  123677788887766543


No 77 
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=95.12  E-value=0.015  Score=52.51  Aligned_cols=28  Identities=32%  Similarity=0.465  Sum_probs=24.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ..++|+||.+.|||+.  +++++||||.-|
T Consensus       144 ~glVHGDLs~~NIL~~--~~~v~iIDF~qa  171 (197)
T cd05146         144 CNLVHADLSEYNMLWH--DGKVWFIDVSQS  171 (197)
T ss_pred             CCeecCCCCHHHEEEE--CCcEEEEECCCc
Confidence            4899999999999997  378999999743


No 78 
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=94.87  E-value=0.019  Score=53.30  Aligned_cols=38  Identities=21%  Similarity=0.172  Sum_probs=28.3

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC--chhhhH
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN--YQAFDI   82 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n--~~~fDi   82 (317)
                      ...++|+|++|+|||+++ .+ +.||||-.+...  ..+.|+
T Consensus       153 ~~gi~H~Dikp~Nili~~-~g-i~liDfg~~~~~~e~~a~d~  192 (232)
T PRK10359        153 QHGMVSGDPHKGNFIVSK-NG-LRIIDLSGKRCTAQRKAKDR  192 (232)
T ss_pred             HcCCccCCCChHHEEEeC-CC-EEEEECCCcccccchhhHHH
Confidence            458999999999999976 45 999998655543  334444


No 79 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=94.80  E-value=0.033  Score=46.73  Aligned_cols=57  Identities=19%  Similarity=0.166  Sum_probs=38.4

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhh
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAF   80 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~f   80 (317)
                      .+.+...+..+.+.+.... ...++|+|++++||+++...+.+.++||+++......-
T Consensus        91 ~~~~~~~~~~l~~~l~~lh-~~~~~H~dl~~~ni~~~~~~~~~~l~d~~~~~~~~~~~  147 (215)
T cd00180          91 EDEILRILLQILEGLEYLH-SNGIIHRDLKPENILLDSDNGKVKLADFGLSKLLTSDK  147 (215)
T ss_pred             HHHHHHHHHHHHHHHHHHH-hCCeeccCCCHhhEEEeCCCCcEEEecCCceEEccCCc
Confidence            4444444444444443222 23899999999999997534789999999998665543


No 80 
>PF06176 WaaY:  Lipopolysaccharide core biosynthesis protein (WaaY);  InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=94.73  E-value=0.045  Score=50.65  Aligned_cols=30  Identities=23%  Similarity=0.335  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+-|+|++|+|+++.+  ++|.+||+.-..+
T Consensus       154 ~G~~HGD~hpgNFlv~~--~~i~iID~~~k~~  183 (229)
T PF06176_consen  154 HGFYHGDPHPGNFLVSN--NGIRIIDTQGKRM  183 (229)
T ss_pred             cCCccCCCCcCcEEEEC--CcEEEEECccccc
Confidence            58899999999999974  6799999977654


No 81 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=94.66  E-value=0.046  Score=51.54  Aligned_cols=30  Identities=20%  Similarity=0.385  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+++ ++.+.|+||..|.
T Consensus       115 ~~ivHrDikp~NIll~~-~~~~kL~Dfg~~~  144 (325)
T cd05594         115 KNVVYRDLKLENLMLDK-DGHIKITDFGLCK  144 (325)
T ss_pred             CCEEecCCCCCeEEECC-CCCEEEecCCCCe
Confidence            57899999999999986 6789999998765


No 82 
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis]
Probab=94.55  E-value=0.14  Score=47.82  Aligned_cols=64  Identities=27%  Similarity=0.285  Sum_probs=46.7

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEE-EEeeccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHH
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVT-FIDYEYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYL  114 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~-lIDfEya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL  114 (317)
                      ...|+||+|----|+|.++  .+.. +||+.-+|.+++..||+........ |      .+.......|+..|.
T Consensus       183 edLVv~HGDACLPN~i~d~--~rf~GfIDlGrlGVaDRh~DLala~~s~~~-n------l~g~~~~~~fl~~Yg  247 (266)
T COG3231         183 EDLVVTHGDACLPNFILDG--WRFSGFIDLGRLGVADRHQDLALATWSLRF-N------LGGDVWDDPFLDAYG  247 (266)
T ss_pred             hhceeecCcccCcceEecC--CceEEeeecCcccchHHHHhHHHHHHHHHh-c------cCcchhhHHHHHHhC
Confidence            4689999999999999975  3555 9999999999999999976543221 1      234444455555555


No 83 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=94.53  E-value=0.025  Score=56.92  Aligned_cols=34  Identities=29%  Similarity=0.398  Sum_probs=29.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      ..++|+|++|+||++++ ++++++|||-.++.-++
T Consensus       276 ~g~~H~D~hPgNilv~~-~g~i~liDfG~~~~l~~  309 (437)
T TIGR01982       276 DGFFHADLHPGNIFVLK-DGKIIALDFGIVGRLSE  309 (437)
T ss_pred             CCceeCCCCcccEEECC-CCcEEEEeCCCeeECCH
Confidence            46899999999999976 57899999999876554


No 84 
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=94.32  E-value=0.051  Score=48.80  Aligned_cols=51  Identities=16%  Similarity=0.197  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...+...+..+...+.....+..++|+|++++||++++ .+.+.|+||..+.
T Consensus        99 ~~~~~~~~~~l~~~l~~lH~~~~i~H~dl~~~ni~~~~-~~~~~l~d~g~~~  149 (265)
T cd06605          99 ERILGKIAVAVLKGLTYLHEKHKIIHRDVKPSNILVNS-RGQIKLCDFGVSG  149 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCCeecCCCCHHHEEECC-CCCEEEeecccch
Confidence            44444444444444433333468999999999999986 6789999998764


No 85 
>KOG0583|consensus
Probab=94.20  E-value=0.025  Score=55.79  Aligned_cols=35  Identities=23%  Similarity=0.373  Sum_probs=30.5

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ...++|+||++.|||++++++++.++||.++...+
T Consensus       138 ~~gi~HRDLK~ENilld~~~~~~Kl~DFG~s~~~~  172 (370)
T KOG0583|consen  138 SRGIVHRDLKPENILLDGNEGNLKLSDFGLSAISP  172 (370)
T ss_pred             hCCEeeCCCCHHHEEecCCCCCEEEeccccccccC
Confidence            45889999999999998744899999999998765


No 86 
>COG2187 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=94.11  E-value=0.46  Score=45.69  Aligned_cols=115  Identities=21%  Similarity=0.234  Sum_probs=67.9

Q ss_pred             CCCeeeeecCCCCCCeeeeCCCCeEEEEee----ccccCCchhhhHHHHHHHhhCCCCCCCCCCCCHHHHHHHHHHHHHH
Q psy8745          41 KSPVVFCHNDLLLGNIIYDETEDKVTFIDY----EYAGVNYQAFDIANHFDEFAGVSPIDHSRYPGPEFQLSWLRTYLEE  116 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~~~~l~lIDf----Eya~~n~~~fDiAn~~~E~~~~~~~d~~~yp~~e~~~~fi~~YL~~  116 (317)
                      ...++=||+||+.+||.+-  ++++.|.|+    |--.+.+..+|+|-..-.      .++..  -.+.-..|++.|+..
T Consensus       206 ~g~IRecHGDLhl~ni~l~--dg~~~LFDCIEFNd~fr~iDv~~D~AFl~MD------Le~~g--r~dla~~~ln~Yl~~  275 (337)
T COG2187         206 EGFIRECHGDLHLRNICLW--DGEPALFDCIEFNDPFRFIDVLYDLAFLAMD------LEFRG--RKDLARRFLNTYLEE  275 (337)
T ss_pred             cCCceecccchhhcceeee--cCcceEEEEeecCCcchHHHHHHHHHHHHhh------HhhcC--ChHHHHHHHHHHHHH
Confidence            4678999999999999875  367888886    345566778888865432      12222  234556788888876


Q ss_pred             hcCCCCCHHHHHHHHHhhhhhhhhhHHHHHHHHHHHhhcCCCCCCH-------HHHHHHHHHHHHHhHhhh
Q psy8745         117 YTGSPPSPHQLATLHWQVQQFSPVAHCFWTIWGLVQAEHSDIEFDF-------FQYASSTYQGYVLKRDKY  180 (317)
Q Consensus       117 y~~~~~s~~ev~~l~~~v~~~~l~shl~W~lWaliq~~~s~~~fDy-------~~Ya~~R~~~y~~~k~el  180 (317)
                      -.  +....++-             .+|=+.-|.+.+++..--+|.       -.=|..+...|+.+....
T Consensus       276 tg--D~~gl~lL-------------pfyla~rA~VRakV~sf~ldd~~~~a~~k~~a~~~A~~y~~LA~~y  331 (337)
T COG2187         276 TG--DWDGLELL-------------PFYLAYRAYVRAKVTSFLLDDPNLTAAEKEEAAATARRYFKLARQY  331 (337)
T ss_pred             hC--CccHHHHh-------------HHHHHHHHHHHHheeEEeccCCCchhhhhHHHHHHhhHHHHHHHHH
Confidence            41  22222222             245566677777765433333       223444555565554443


No 87 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=94.09  E-value=0.026  Score=50.37  Aligned_cols=30  Identities=30%  Similarity=0.447  Sum_probs=27.0

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|++|.||++++ ++.+.|+||..+..
T Consensus       118 ~i~H~dikp~NIl~~~-~~~~~l~Dfg~~~~  147 (260)
T PF00069_consen  118 GIVHRDIKPENILLDE-NGEVKLIDFGSSVK  147 (260)
T ss_dssp             TEEESSBSGGGEEEST-TSEEEESSGTTTEE
T ss_pred             cccccccccccccccc-cccccccccccccc
Confidence            7899999999999985 78899999999864


No 88 
>KOG0983|consensus
Probab=94.04  E-value=0.06  Score=51.56  Aligned_cols=60  Identities=25%  Similarity=0.278  Sum_probs=40.4

Q ss_pred             chhhhhcCCCCHHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          12 SSRFQALFPGGVSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        12 ~~~~~~~~p~~~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      -++...++|  .-.|-.-.-.+.+.|.-.+....+.|+|++|.|||+|+ .|+|.|-||--+|
T Consensus       181 lkrik~piP--E~ilGk~tva~v~AL~YLKeKH~viHRDvKPSNILlDe-~GniKlCDFGIsG  240 (391)
T KOG0983|consen  181 LKRIKGPIP--ERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDE-RGNIKLCDFGISG  240 (391)
T ss_pred             HHHhcCCch--HHhhhhhHHHHHHHHHHHHHhcceeecccCccceEEcc-CCCEEeecccccc
Confidence            356667777  11222222233334444445678999999999999987 6899999997776


No 89 
>KOG0984|consensus
Probab=93.77  E-value=0.044  Score=50.60  Aligned_cols=44  Identities=23%  Similarity=0.322  Sum_probs=34.0

Q ss_pred             HHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          31 QYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        31 ~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      -.+-..+.-.....-+.|+|++|+|||+|. .|+|.+-||--+|+
T Consensus       155 ~Svv~al~~L~~kL~vIHRDvKPsNiLIn~-~GqVKiCDFGIsG~  198 (282)
T KOG0984|consen  155 VSVVHALEFLHSKLSVIHRDVKPSNILINY-DGQVKICDFGISGY  198 (282)
T ss_pred             HHHHHHHHHHHHHhhhhhccCCcceEEEcc-CCcEEEccccccee
Confidence            333344444445677899999999999986 79999999988885


No 90 
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=93.74  E-value=0.092  Score=46.04  Aligned_cols=53  Identities=19%  Similarity=0.221  Sum_probs=35.8

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ...+..-+..+...+.... ...++|+|++|.||++++ ++.+.|+||..+....
T Consensus        97 ~~~~~~i~~~i~~~l~~lh-~~~i~h~dl~p~ni~i~~-~~~~~l~d~~~~~~~~  149 (253)
T cd05122          97 ESQIAYVCKELLKGLEYLH-SNGIIHRDIKAANILLTS-DGEVKLIDFGLSAQLS  149 (253)
T ss_pred             HHHHHHHHHHHHHHHHHhh-cCCEecCCCCHHHEEEcc-CCeEEEeecccccccc
Confidence            4444444444444443322 256899999999999986 6889999998876543


No 91 
>KOG0667|consensus
Probab=93.60  E-value=0.073  Score=55.32  Aligned_cols=36  Identities=22%  Similarity=0.357  Sum_probs=28.8

Q ss_pred             CeeeeecCCCCCCeeeeC-CCCeEEEEeeccccCCch
Q psy8745          43 PVVFCHNDLLLGNIIYDE-TEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~-~~~~l~lIDfEya~~n~~   78 (317)
                      ...+.|+||+|.|||+.+ +..+|.||||--|++-..
T Consensus       307 ~l~IIHcDLKPENILL~~~~r~~vKVIDFGSSc~~~q  343 (586)
T KOG0667|consen  307 ELGIIHCDLKPENILLKDPKRSRIKVIDFGSSCFESQ  343 (586)
T ss_pred             hCCeeeccCChhheeeccCCcCceeEEecccccccCC
Confidence            578999999999999853 345799999988775443


No 92 
>KOG0658|consensus
Probab=93.56  E-value=0.042  Score=53.81  Aligned_cols=31  Identities=23%  Similarity=0.395  Sum_probs=27.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+||+|++|.|+|+|.+.+.+.+=||--|.
T Consensus       144 ~~IcHRDIKPqNlLvD~~tg~LKicDFGSAK  174 (364)
T KOG0658|consen  144 HGICHRDIKPQNLLVDPDTGVLKICDFGSAK  174 (364)
T ss_pred             cCcccCCCChheEEEcCCCCeEEeccCCcce
Confidence            7899999999999999877889999997664


No 93 
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=93.55  E-value=0.1  Score=47.07  Aligned_cols=32  Identities=38%  Similarity=0.504  Sum_probs=27.5

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|+++.||++++ ++.+.++||..+..
T Consensus       132 ~~~i~H~dl~~~nil~~~-~~~~~l~dfg~~~~  163 (269)
T cd08528         132 EKRIVHRDLTPNNIMLGE-DDKVTITDFGLAKQ  163 (269)
T ss_pred             CCceeecCCCHHHEEECC-CCcEEEecccceee
Confidence            346899999999999976 67899999998864


No 94 
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=93.51  E-value=0.1  Score=49.92  Aligned_cols=29  Identities=28%  Similarity=0.346  Sum_probs=25.3

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEY   72 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEy   72 (317)
                      ...+.|+|+.+-|||+++ +|++++|||-=
T Consensus       220 ~~GiVHGDlSefNIlV~~-dg~~~vIDwPQ  248 (304)
T COG0478         220 RRGIVHGDLSEFNILVTE-DGDIVVIDWPQ  248 (304)
T ss_pred             HcCccccCCchheEEEec-CCCEEEEeCcc
Confidence            468999999999999986 67899999943


No 95 
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=93.43  E-value=0.11  Score=46.44  Aligned_cols=31  Identities=23%  Similarity=0.233  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||..+..
T Consensus       121 ~~i~H~di~p~nil~~~-~~~~~l~df~~~~~  151 (257)
T cd08223         121 KHILHRDLKTQNVFLTR-TNIIKVGDLGIARV  151 (257)
T ss_pred             CCeeccCCCchhEEEec-CCcEEEecccceEE
Confidence            46899999999999976 67899999998754


No 96 
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=93.36  E-value=0.082  Score=46.72  Aligned_cols=32  Identities=22%  Similarity=0.229  Sum_probs=27.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+...
T Consensus       122 ~~~~H~dl~~~nil~~~-~~~~~l~d~~~~~~~  153 (258)
T cd08215         122 RKILHRDIKPQNIFLTS-NGLVKLGDFGISKVL  153 (258)
T ss_pred             CCEecccCChHHeEEcC-CCcEEECCccceeec
Confidence            37899999999999986 688999999888653


No 97 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=93.35  E-value=0.089  Score=49.62  Aligned_cols=31  Identities=23%  Similarity=0.353  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.|||+++ ++.+.|+||..+..
T Consensus       115 ~givH~Dlkp~NIll~~-~~~~kL~DfG~~~~  145 (325)
T cd05604         115 INIVYRDLKPENILLDS-QGHVVLTDFGLCKE  145 (325)
T ss_pred             CCeeecCCCHHHeEECC-CCCEEEeecCCccc
Confidence            46899999999999976 67899999998753


No 98 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=93.32  E-value=0.094  Score=47.30  Aligned_cols=31  Identities=23%  Similarity=0.383  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++++||++++ ++.+.|+||..+..
T Consensus       121 ~~i~H~dl~~~Nill~~-~~~~~l~dfg~~~~  151 (260)
T cd05069         121 MNYIHRDLRAANILVGD-NLVCKIADFGLARL  151 (260)
T ss_pred             CCEeecccCcceEEEcC-CCeEEECCCccceE
Confidence            35899999999999976 67899999998864


No 99 
>KOG0599|consensus
Probab=93.32  E-value=0.076  Score=50.85  Aligned_cols=41  Identities=20%  Similarity=0.255  Sum_probs=35.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHH
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANH   85 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~   85 (317)
                      .-+.|+||+|.|||.++ +.+|.+-||-+|+--.|+--|-+.
T Consensus       142 ~~IVHRDLKpENILldd-n~~i~isDFGFa~~l~~GekLrel  182 (411)
T KOG0599|consen  142 RNIVHRDLKPENILLDD-NMNIKISDFGFACQLEPGEKLREL  182 (411)
T ss_pred             hhhhhcccChhheeecc-ccceEEeccceeeccCCchhHHHh
Confidence            35789999999999987 678999999999999988777654


No 100
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=93.24  E-value=0.095  Score=47.20  Aligned_cols=32  Identities=25%  Similarity=0.372  Sum_probs=27.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+...
T Consensus       122 ~~i~H~dl~p~Nil~~~-~~~~~l~dfg~~~~~  153 (261)
T cd05068         122 QNYIHRDLAARNVLVGE-NNICKVADFGLARVI  153 (261)
T ss_pred             CCeeeccCCcceEEEcC-CCCEEECCcceEEEc
Confidence            46899999999999986 678999999887643


No 101
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=93.23  E-value=0.11  Score=49.17  Aligned_cols=29  Identities=21%  Similarity=0.469  Sum_probs=25.7

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|++|.||++++ ++.+.|+||..+.
T Consensus       124 ~ivH~dlkp~Nil~~~-~~~~kl~Dfg~~~  152 (331)
T cd06649         124 QIMHRDVKPSNILVNS-RGEIKLCDFGVSG  152 (331)
T ss_pred             CEEcCCCChhhEEEcC-CCcEEEccCcccc
Confidence            5899999999999976 6789999998775


No 102
>KOG0603|consensus
Probab=93.23  E-value=0.1  Score=54.23  Aligned_cols=36  Identities=19%  Similarity=0.285  Sum_probs=31.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ..+.|+||+|+|||++++.+.|.++||-++....+-
T Consensus       434 ~gvvhRDLkp~NIL~~~~~g~lrltyFG~a~~~~~~  469 (612)
T KOG0603|consen  434 QGVVHRDLKPGNILLDGSAGHLRLTYFGFWSELERS  469 (612)
T ss_pred             cCeeecCCChhheeecCCCCcEEEEEechhhhCchh
Confidence            788999999999999534688999999988877666


No 103
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=93.18  E-value=0.13  Score=45.59  Aligned_cols=32  Identities=25%  Similarity=0.239  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++++||++++ .+.+.++||.++...
T Consensus       122 ~~~~h~dl~~~nil~~~-~~~~~l~dfg~~~~~  153 (258)
T smart00219      122 KNFIHRDLAARNCLVGE-NLVVKISDFGLSRDL  153 (258)
T ss_pred             CCeeecccccceEEEcc-CCeEEEcccCCceec
Confidence            46799999999999986 578999999988654


No 104
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=93.18  E-value=0.1  Score=46.43  Aligned_cols=33  Identities=27%  Similarity=0.352  Sum_probs=28.9

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++|+|+++.||++++ .+.+.++||..+..-
T Consensus       128 ~~~i~h~dl~p~nili~~-~~~~kl~d~g~~~~~  160 (265)
T cd08217         128 GNTVLHRDLKPANIFLDA-NNNVKLGDFGLAKIL  160 (265)
T ss_pred             cCcceecCCCHHHEEEec-CCCEEEecccccccc
Confidence            678899999999999986 688999999887753


No 105
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=93.16  E-value=0.1  Score=49.17  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||++.|||++. ++.+.|+||..+.
T Consensus       124 ~~ivHrDlkp~Nili~~-~~~~kl~DfG~~~  153 (332)
T cd05614         124 LGIVYRDIKLENILLDS-EGHVVLTDFGLSK  153 (332)
T ss_pred             CCcEecCCCHHHeEECC-CCCEEEeeCcCCc
Confidence            45899999999999976 6789999998765


No 106
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=93.16  E-value=0.072  Score=50.38  Aligned_cols=31  Identities=23%  Similarity=0.463  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.|+||..+..
T Consensus       120 ~giiH~Dlkp~NIll~~-~~~~kL~Dfg~~~~  150 (350)
T cd05573         120 LGFIHRDIKPDNILIDA-DGHIKLADFGLCKK  150 (350)
T ss_pred             CCeeccCCCHHHeEECC-CCCEEeecCCCCcc
Confidence            57899999999999986 67899999988764


No 107
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=93.12  E-value=0.1  Score=47.67  Aligned_cols=30  Identities=20%  Similarity=0.396  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. ++.+.++||..+.
T Consensus       122 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~  151 (286)
T cd06622         122 HNIIHRDVKPTNVLVNG-NGQVKLCDFGVSG  151 (286)
T ss_pred             CCEeeCCCCHHHEEECC-CCCEEEeecCCcc
Confidence            46899999999999986 6789999998875


No 108
>KOG0594|consensus
Probab=93.12  E-value=0.055  Score=52.47  Aligned_cols=32  Identities=19%  Similarity=0.267  Sum_probs=28.0

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ....+.|+||+|.|||+++ .|.+.++||--|.
T Consensus       137 H~~~IlHRDLKPQNlLi~~-~G~lKlaDFGlAr  168 (323)
T KOG0594|consen  137 HSHGILHRDLKPQNLLISS-SGVLKLADFGLAR  168 (323)
T ss_pred             HhCCeecccCCcceEEECC-CCcEeeeccchHH
Confidence            4467899999999999987 7899999997776


No 109
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=93.09  E-value=0.081  Score=48.29  Aligned_cols=31  Identities=26%  Similarity=0.402  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||.++..
T Consensus       127 ~~ivH~dikp~Nili~~-~~~~kl~dfg~~~~  157 (288)
T cd07863         127 NCIVHRDLKPENILVTS-GGQVKLADFGLARI  157 (288)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEECccCcccc
Confidence            35899999999999976 67899999987753


No 110
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=93.06  E-value=0.099  Score=49.33  Aligned_cols=31  Identities=19%  Similarity=0.305  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||++. ++.+.|+||..+..
T Consensus       115 ~~ivHrDlkp~Nili~~-~~~~kl~Dfg~a~~  145 (330)
T cd05586         115 YDIVYRDLKPENILLDA-TGHIALCDFGLSKA  145 (330)
T ss_pred             CCeEeccCCHHHeEECC-CCCEEEecCCcCcC
Confidence            35899999999999976 67899999998764


No 111
>PRK09188 serine/threonine protein kinase; Provisional
Probab=93.03  E-value=0.066  Score=52.83  Aligned_cols=35  Identities=26%  Similarity=0.355  Sum_probs=29.2

Q ss_pred             eeeeecCC-CCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          44 VVFCHNDL-LLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        44 ~v~CHnDl-~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ..++|+|+ +|+|||++. ++.++||||..|..-.+.
T Consensus       130 ~gIiHrDL~KP~NILv~~-~~~ikLiDFGlA~~~~~~  165 (365)
T PRK09188        130 AGITHNDLAKPQNWLMGP-DGEAAVIDFQLASVFRRR  165 (365)
T ss_pred             CCCeeCCCCCcceEEEcC-CCCEEEEECccceecccC
Confidence            57899999 899999975 578999999998865443


No 112
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=93.01  E-value=0.11  Score=48.64  Aligned_cols=31  Identities=19%  Similarity=0.306  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. .+.+.++||..+..
T Consensus       112 ~~i~HrDlkp~Nili~~-~~~~kl~Dfg~~~~  142 (312)
T cd05585         112 FNVIYRDLKPENILLDY-QGHIALCDFGLCKL  142 (312)
T ss_pred             CCeEeCCCCHHHeEECC-CCcEEEEECccccc
Confidence            45899999999999976 67899999998764


No 113
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=92.98  E-value=0.096  Score=47.89  Aligned_cols=30  Identities=23%  Similarity=0.516  Sum_probs=25.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.++||..+.
T Consensus       127 ~~i~H~dlkp~Nil~~~-~~~~kl~dfg~~~  156 (288)
T cd06616         127 LKIIHRDVKPSNILLDR-NGNIKLCDFGISG  156 (288)
T ss_pred             CCeeccCCCHHHEEEcc-CCcEEEeecchhH
Confidence            46899999999999976 5789999997654


No 114
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=92.94  E-value=0.12  Score=45.78  Aligned_cols=33  Identities=27%  Similarity=0.353  Sum_probs=28.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ..++|+|+.|.||++++ ++.+.++||..+....
T Consensus       124 ~~i~H~di~p~nili~~-~~~~~l~dfg~~~~~~  156 (262)
T cd00192         124 KKFVHRDLAARNCLVGE-DLVVKISDFGLSRDVY  156 (262)
T ss_pred             CCcccCccCcceEEECC-CCcEEEcccccccccc
Confidence            56899999999999986 5889999998887544


No 115
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=92.93  E-value=0.11  Score=48.71  Aligned_cols=31  Identities=23%  Similarity=0.327  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.|+||..+..
T Consensus       115 ~~ivH~Dlkp~NIll~~-~~~~kl~Dfg~~~~  145 (321)
T cd05603         115 LNIIYRDLKPENILLDS-QGHVVLTDFGLCKE  145 (321)
T ss_pred             CCeEeccCCHHHeEECC-CCCEEEccCCCCcc
Confidence            46899999999999986 67899999988763


No 116
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=92.89  E-value=0.13  Score=46.24  Aligned_cols=31  Identities=23%  Similarity=0.380  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ ++.+.++||.++..
T Consensus       121 ~~i~H~dlkp~nil~~~-~~~~kl~dfg~~~~  151 (256)
T cd05082         121 NNFVHRDLAARNVLVSE-DNVAKVSDFGLTKE  151 (256)
T ss_pred             CCEeccccchheEEEcC-CCcEEecCCcccee
Confidence            46899999999999976 67899999987753


No 117
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=92.85  E-value=0.13  Score=48.81  Aligned_cols=29  Identities=21%  Similarity=0.466  Sum_probs=25.3

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+||+|.||++++ .+.+.|+||..+.
T Consensus       124 ~ivH~dlkp~Nili~~-~~~~kL~Dfg~~~  152 (333)
T cd06650         124 KIMHRDVKPSNILVNS-RGEIKLCDFGVSG  152 (333)
T ss_pred             CEEecCCChhhEEEcC-CCCEEEeeCCcch
Confidence            5899999999999976 5789999998764


No 118
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=92.84  E-value=0.12  Score=48.68  Aligned_cols=31  Identities=19%  Similarity=0.363  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.|+||..|..
T Consensus       114 ~~ivHrDlkp~NIll~~-~~~~kl~DfG~a~~  144 (323)
T cd05571         114 CDVVYRDLKLENLMLDK-DGHIKITDFGLCKE  144 (323)
T ss_pred             CCeEeCCCCHHHEEECC-CCCEEEeeCCCCcc
Confidence            46899999999999976 67899999987753


No 119
>PHA02882 putative serine/threonine kinase; Provisional
Probab=92.83  E-value=0.064  Score=49.82  Aligned_cols=30  Identities=30%  Similarity=0.412  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||++. .+.+.|+||..|.
T Consensus       145 ~~iiHrDiKp~Nill~~-~~~~~l~DFGla~  174 (294)
T PHA02882        145 HGISHGDIKPENIMVDG-NNRGYIIDYGIAS  174 (294)
T ss_pred             CCeecCCCCHHHEEEcC-CCcEEEEEcCCce
Confidence            46899999999999976 6789999998775


No 120
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=92.80  E-value=0.055  Score=51.87  Aligned_cols=30  Identities=23%  Similarity=0.468  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. ++.+.|+||..|.
T Consensus       120 ~givHrDLkp~NIli~~-~~~vkL~DfG~~~  149 (360)
T cd05627         120 LGFIHRDIKPDNLLLDA-KGHVKLSDFGLCT  149 (360)
T ss_pred             CCeEccCCCHHHEEECC-CCCEEEeeccCCc
Confidence            46899999999999976 6889999998875


No 121
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=92.77  E-value=0.12  Score=49.04  Aligned_cols=31  Identities=23%  Similarity=0.329  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+..
T Consensus       137 ~~ivH~dlkp~NIll~~-~~~~kl~Dfg~~~~  167 (329)
T PTZ00263        137 KDIIYRDLKPENLLLDN-KGHVKVTDFGFAKK  167 (329)
T ss_pred             CCeeecCCCHHHEEECC-CCCEEEeeccCceE
Confidence            45899999999999986 67899999988763


No 122
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=92.74  E-value=0.058  Score=50.82  Aligned_cols=30  Identities=20%  Similarity=0.458  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.||+++. .+.+.|+||..|.
T Consensus       121 ~~i~H~Dlkp~NIll~~-~~~~kL~Dfg~a~  150 (330)
T cd05601         121 MGYVHRDIKPENVLIDR-TGHIKLADFGSAA  150 (330)
T ss_pred             CCeEcccCchHheEECC-CCCEEeccCCCCe
Confidence            46899999999999986 6889999998775


No 123
>PRK10345 hypothetical protein; Provisional
Probab=92.71  E-value=0.23  Score=45.12  Aligned_cols=45  Identities=16%  Similarity=0.045  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeC---CCCeEEEEeecccc
Q psy8745          26 LQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDE---TEDKVTFIDYEYAG   74 (317)
Q Consensus        26 L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~---~~~~l~lIDfEya~   74 (317)
                      +.+.+..+.+.+..    ..++|+|++|.|||++.   .+..++|||+=.+.
T Consensus       110 ~~~~L~~l~~yLh~----~~IvhrDlKp~NILl~~~~~~~~~~~LiDg~G~~  157 (210)
T PRK10345        110 LRQLLKKLKRYLLD----NRIVTMELKPQNILCQRISESEVIPVVCDNIGES  157 (210)
T ss_pred             HHHHHHHHHHHHHH----CCEeecCCCHHHEEEeccCCCCCcEEEEECCCCc
Confidence            44444444444433    45789999999999963   23479999964444


No 124
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=92.69  E-value=0.11  Score=49.00  Aligned_cols=30  Identities=20%  Similarity=0.368  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       115 ~giiHrDlkp~Nili~~-~~~~kl~DfG~a~  144 (325)
T cd05602         115 LNIVYRDLKPENILLDS-QGHIVLTDFGLCK  144 (325)
T ss_pred             CCeEecCCCHHHeEECC-CCCEEEccCCCCc
Confidence            46899999999999976 6789999998775


No 125
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=92.68  E-value=0.059  Score=52.34  Aligned_cols=31  Identities=16%  Similarity=0.317  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||+++ .+.+.|+||..|..
T Consensus       161 ~~IvHrDLKp~NILl~~-~~~~kL~DFG~a~~  191 (370)
T cd05621         161 MGLIHRDVKPDNMLLDK-HGHLKLADFGTCMK  191 (370)
T ss_pred             CCeEecCCCHHHEEECC-CCCEEEEeccccee
Confidence            46899999999999986 68899999998763


No 126
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=92.67  E-value=0.14  Score=46.57  Aligned_cols=31  Identities=19%  Similarity=0.453  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||+++. .+.+.++||..+..
T Consensus       123 ~~i~h~dlkp~nil~~~-~~~~kl~dfg~~~~  153 (283)
T cd06617         123 LSVIHRDVKPSNVLINR-NGQVKLCDFGISGY  153 (283)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEeecccccc
Confidence            36899999999999976 67899999987763


No 127
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=92.64  E-value=0.13  Score=48.42  Aligned_cols=30  Identities=27%  Similarity=0.352  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. ++.+.|+||..|.
T Consensus       115 ~~ivHrDikp~Nill~~-~~~~kL~Dfg~~~  144 (321)
T cd05591         115 HGVIYRDLKLDNILLDA-EGHCKLADFGMCK  144 (321)
T ss_pred             CCeeccCCCHHHeEECC-CCCEEEeecccce
Confidence            35899999999999986 6789999998765


No 128
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=92.59  E-value=0.064  Score=48.14  Aligned_cols=32  Identities=28%  Similarity=0.393  Sum_probs=27.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|+||+++. ++.+.|+||..+...
T Consensus       119 ~~~~H~dl~p~nili~~-~~~~kl~Dfg~~~~~  150 (254)
T cd05083         119 KKLVHRDLAARNILVSE-DGVAKVSDFGLARVG  150 (254)
T ss_pred             CCeeccccCcceEEEcC-CCcEEECCCccceec
Confidence            46899999999999976 578999999987654


No 129
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=92.53  E-value=0.064  Score=51.57  Aligned_cols=31  Identities=23%  Similarity=0.419  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||++. .+.+.|+||..|..
T Consensus       120 ~givHrDlKp~NILi~~-~~~vkL~DFGla~~  150 (363)
T cd05628         120 LGFIHRDIKPDNLLLDS-KGHVKLSDFGLCTG  150 (363)
T ss_pred             CCeEecCCCHHHeEECC-CCCEEEeeccCccc
Confidence            46899999999999986 67899999998764


No 130
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=92.53  E-value=0.12  Score=48.98  Aligned_cols=30  Identities=17%  Similarity=0.398  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. .+.+.|+||..|.
T Consensus       121 ~~iiHrDlkp~Nill~~-~~~~kl~DfG~a~  150 (331)
T cd05624         121 LHYVHRDIKPDNVLLDM-NGHIRLADFGSCL  150 (331)
T ss_pred             CCeeeccCchHHEEEcC-CCCEEEEecccee
Confidence            46899999999999976 6789999998764


No 131
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=92.51  E-value=0.13  Score=48.45  Aligned_cols=30  Identities=23%  Similarity=0.309  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       119 ~~ivH~dlkp~Nil~~~-~~~~kl~Dfg~~~  148 (323)
T cd05584         119 QGIIYRDLKPENILLDA-QGHVKLTDFGLCK  148 (323)
T ss_pred             CCeecCCCCHHHeEECC-CCCEEEeeCcCCe
Confidence            45899999999999976 6789999998765


No 132
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=92.49  E-value=0.12  Score=46.42  Aligned_cols=31  Identities=23%  Similarity=0.355  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++++||++++ ++.+.++||..+..
T Consensus       121 ~~i~H~di~p~Nili~~-~~~~~l~dfg~~~~  151 (260)
T cd05070         121 MNYIHRDLRSANILVGD-GLVCKIADFGLARL  151 (260)
T ss_pred             CCcccCCCccceEEEeC-CceEEeCCceeeee
Confidence            35899999999999986 57899999998864


No 133
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=92.49  E-value=0.14  Score=48.24  Aligned_cols=30  Identities=23%  Similarity=0.359  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+++ ++.+.|+||..+.
T Consensus       115 ~givH~dikp~NIll~~-~~~~kl~Dfg~~~  144 (323)
T cd05575         115 LNIIYRDLKPENILLDS-QGHVVLTDFGLCK  144 (323)
T ss_pred             CCeEeCCCCHHHeEECC-CCcEEEeccCCCc
Confidence            46899999999999976 6789999998765


No 134
>PTZ00036 glycogen synthase kinase; Provisional
Probab=92.46  E-value=0.15  Score=50.99  Aligned_cols=31  Identities=26%  Similarity=0.490  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+||+||+|.|||++.+.+.+.|+||..|.
T Consensus       189 ~~IiHrDLKp~NILl~~~~~~vkL~DFGla~  219 (440)
T PTZ00036        189 KFICHRDLKPQNLLIDPNTHTLKLCDFGSAK  219 (440)
T ss_pred             CCEecCCcCHHHEEEcCCCCceeeeccccch
Confidence            4699999999999998644569999998875


No 135
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=92.44  E-value=0.12  Score=47.74  Aligned_cols=29  Identities=28%  Similarity=0.476  Sum_probs=25.5

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .+||+|+.+.||++++ ++.+.|+||..+.
T Consensus       135 ~i~H~dl~p~nill~~-~~~~kL~dfg~~~  163 (296)
T cd06618         135 GVIHRDVKPSNILLDA-SGNVKLCDFGISG  163 (296)
T ss_pred             CEecCCCcHHHEEEcC-CCCEEECccccch
Confidence            5899999999999976 6789999998764


No 136
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=92.43  E-value=0.14  Score=48.96  Aligned_cols=31  Identities=16%  Similarity=0.367  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.|||+++ ++.+.|+||..+..
T Consensus       187 ~~ivHrDlkp~NIll~~-~~~~kL~DfG~~~~  217 (353)
T PLN00034        187 RHIVHRDIKPSNLLINS-AKNVKIADFGVSRI  217 (353)
T ss_pred             CCEeecCCCHHHEEEcC-CCCEEEccccccee
Confidence            46899999999999986 67899999987653


No 137
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=92.43  E-value=0.16  Score=45.93  Aligned_cols=31  Identities=26%  Similarity=0.373  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||.++..
T Consensus       123 ~~i~H~dlkp~nil~~~-~~~~kl~df~~~~~  153 (263)
T cd05052         123 KNFIHRDLAARNCLVGE-NHLVKVADFGLSRL  153 (263)
T ss_pred             CCEeecccCcceEEEcC-CCcEEeCCCccccc
Confidence            46899999999999976 67899999998753


No 138
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=92.41  E-value=0.15  Score=48.14  Aligned_cols=30  Identities=23%  Similarity=0.376  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+++ ++.+.|+||..+.
T Consensus       120 ~~ivH~dlkp~Nill~~-~~~~kL~Dfg~~~  149 (324)
T cd05587         120 KGIIYRDLKLDNVMLDA-EGHIKIADFGMCK  149 (324)
T ss_pred             CCeEecCCCHHHeEEcC-CCCEEEeecCcce
Confidence            46899999999999986 6789999998765


No 139
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=92.41  E-value=0.14  Score=49.33  Aligned_cols=30  Identities=23%  Similarity=0.502  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. ++.+.|+||..|.
T Consensus       120 ~~ivHrDlkp~Nill~~-~~~ikL~DFG~a~  149 (376)
T cd05598         120 MGFIHRDIKPDNILIDR-DGHIKLTDFGLCT  149 (376)
T ss_pred             CCeEeCCCCHHHEEECC-CCCEEEEeCCCCc
Confidence            45899999999999986 6789999998874


No 140
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=92.39  E-value=0.15  Score=48.16  Aligned_cols=31  Identities=23%  Similarity=0.328  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.|+||..+..
T Consensus       115 ~~ivH~dlkp~NIli~~-~~~~kL~DfG~~~~  145 (320)
T cd05590         115 KGIIYRDLKLDNVLLDH-EGHCKLADFGMCKE  145 (320)
T ss_pred             CCeEeCCCCHHHeEECC-CCcEEEeeCCCCee
Confidence            46899999999999976 67899999987653


No 141
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=92.26  E-value=0.17  Score=47.03  Aligned_cols=33  Identities=18%  Similarity=0.288  Sum_probs=28.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ..++|+|+++.||+++. ++.+.|+||+.+....
T Consensus       122 ~~i~H~dlkp~Nili~~-~~~~~l~dfg~~~~~~  154 (316)
T cd05574         122 LGIVYRDLKPENILLHE-SGHIMLSDFDLSKQSD  154 (316)
T ss_pred             CCeeccCCChHHeEEcC-CCCEEEeecchhhccc
Confidence            35899999999999986 5789999999887543


No 142
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=92.23  E-value=0.19  Score=50.69  Aligned_cols=31  Identities=19%  Similarity=0.268  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||+++ .+.+.|+||..|..
T Consensus       188 ~~ivHrDlkp~NIll~~-~~~~kL~DFgla~~  218 (478)
T PTZ00267        188 RKMMHRDLKSANIFLMP-TGIIKLGDFGFSKQ  218 (478)
T ss_pred             CCEEECCcCHHhEEECC-CCcEEEEeCcCcee
Confidence            46899999999999986 67899999998763


No 143
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=92.23  E-value=0.1  Score=48.20  Aligned_cols=30  Identities=23%  Similarity=0.400  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       122 ~~ivH~dlkp~Nil~~~-~~~~kl~DfG~~~  151 (288)
T cd07871         122 RKILHRDLKPQNLLINE-KGELKLADFGLAR  151 (288)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEECcCccee
Confidence            46899999999999976 5789999998775


No 144
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=92.23  E-value=0.098  Score=48.80  Aligned_cols=34  Identities=18%  Similarity=0.294  Sum_probs=28.8

Q ss_pred             eEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         208 LVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       208 ~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      .+.+|++|++++.   .++.....+|+.||+||....
T Consensus        91 ~l~~~i~G~~~~~---~~~~~~~~lg~~La~lH~~~~  124 (296)
T cd05153          91 ALVEFLAGEHLTR---PTAAHCRQIGEALARLHLAAQ  124 (296)
T ss_pred             EEEEeCCCCCCCC---CCHHHHHHHHHHHHHHHHHhc
Confidence            5789999998876   467889999999999998753


No 145
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=92.20  E-value=0.14  Score=46.83  Aligned_cols=31  Identities=23%  Similarity=0.379  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       129 ~~iiH~dlkp~Nil~~~-~~~~kl~Dfg~~~~  159 (290)
T cd07862         129 HRVVHRDLKPQNILVTS-SGQIKLADFGLARI  159 (290)
T ss_pred             CCeeeCCCCHHHEEEcC-CCCEEEccccceEe
Confidence            45899999999999976 67899999988753


No 146
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=92.20  E-value=0.15  Score=48.90  Aligned_cols=31  Identities=23%  Similarity=0.431  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||++. ++.+.|+||..+..
T Consensus       150 ~~ivHrDLkp~NILl~~-~~~ikL~DFG~a~~  180 (340)
T PTZ00426        150 LNIVYRDLKPENLLLDK-DGFIKMTDFGFAKV  180 (340)
T ss_pred             CCeEccCCCHHHEEECC-CCCEEEecCCCCee
Confidence            46899999999999976 67899999988764


No 147
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=92.14  E-value=0.14  Score=48.27  Aligned_cols=32  Identities=19%  Similarity=0.338  Sum_probs=27.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+||+|.||++++ .+.+.|+||..+...
T Consensus       120 ~~ivH~dlkp~Nil~~~-~~~~kL~Dfg~a~~~  151 (333)
T cd05600         120 LGYIHRDLKPENFLIDA-SGHIKLTDFGLSKGI  151 (333)
T ss_pred             CCccccCCCHHHEEECC-CCCEEEEeCcCCccc
Confidence            35899999999999976 678999999888643


No 148
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=92.13  E-value=0.17  Score=47.90  Aligned_cols=30  Identities=17%  Similarity=0.419  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||++.|||++. ++.+.|+||..+.
T Consensus       121 ~~ivH~dlkp~Nill~~-~~~~kl~Dfg~~~  150 (331)
T cd05597         121 LGYVHRDIKPDNVLLDK-NGHIRLADFGSCL  150 (331)
T ss_pred             CCeEECCCCHHHEEECC-CCCEEEEECCcee
Confidence            45789999999999976 6789999998764


No 149
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=92.11  E-value=0.16  Score=48.15  Aligned_cols=31  Identities=19%  Similarity=0.350  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.|||+++ ++.+.|+||..+..
T Consensus       114 ~~ivHrDikp~NIll~~-~~~~kL~DfG~~~~  144 (328)
T cd05593         114 GKIVYRDLKLENLMLDK-DGHIKITDFGLCKE  144 (328)
T ss_pred             CCeEecccCHHHeEECC-CCcEEEecCcCCcc
Confidence            46899999999999986 67899999988763


No 150
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=92.10  E-value=0.14  Score=48.40  Aligned_cols=30  Identities=17%  Similarity=0.360  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       114 ~~ivH~Dlkp~NIll~~-~~~~kL~Dfg~~~  143 (323)
T cd05595         114 RDVVYRDIKLENLMLDK-DGHIKITDFGLCK  143 (323)
T ss_pred             CCeEecCCCHHHEEEcC-CCCEEecccHHhc
Confidence            46899999999999986 6789999998765


No 151
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=92.10  E-value=0.14  Score=47.02  Aligned_cols=31  Identities=23%  Similarity=0.317  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||.++..
T Consensus       151 ~~ivH~dlkp~Nil~~~-~~~~kL~Dfg~~~~  181 (293)
T cd05053         151 KKCIHRDLAARNVLVTE-DHVMKIADFGLARD  181 (293)
T ss_pred             CCccccccceeeEEEcC-CCeEEeCccccccc
Confidence            46899999999999976 67899999988763


No 152
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=92.09  E-value=0.15  Score=47.94  Aligned_cols=30  Identities=23%  Similarity=0.378  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+++ ++.+.|+||..+.
T Consensus       120 ~~ivHrDlkp~Nill~~-~~~~kL~DfG~~~  149 (323)
T cd05616         120 KGIIYRDLKLDNVMLDS-EGHIKIADFGMCK  149 (323)
T ss_pred             CCEEecCCCHHHeEECC-CCcEEEccCCCce
Confidence            46899999999999986 6789999998775


No 153
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=92.08  E-value=0.17  Score=48.73  Aligned_cols=30  Identities=23%  Similarity=0.459  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. ++.+.++||..+.
T Consensus       120 ~givHrDlkp~NIll~~-~~~~kl~DfGla~  149 (377)
T cd05629         120 LGFIHRDIKPDNILIDR-GGHIKLSDFGLST  149 (377)
T ss_pred             CCeeccCCCHHHEEECC-CCCEEEeeccccc
Confidence            46999999999999976 6789999998875


No 154
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=92.04  E-value=0.17  Score=48.97  Aligned_cols=30  Identities=23%  Similarity=0.502  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. ++.+.|+||..|.
T Consensus       120 ~~ivHrDlKp~NILl~~-~g~~kL~DFGla~  149 (382)
T cd05625         120 MGFIHRDIKPDNILIDR-DGHIKLTDFGLCT  149 (382)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEeECCCCc
Confidence            35899999999999976 6889999998864


No 155
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=92.04  E-value=0.087  Score=54.75  Aligned_cols=31  Identities=29%  Similarity=0.380  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||++++.+.+.|+||..|.
T Consensus       274 ~gIiHRDLKP~NILl~~~~~~~KL~DFGlA~  304 (566)
T PLN03225        274 TGIVHRDVKPQNIIFSEGSGSFKIIDLGAAA  304 (566)
T ss_pred             CCEEeCcCCHHHEEEeCCCCcEEEEeCCCcc
Confidence            4699999999999998645789999999885


No 156
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=92.03  E-value=0.15  Score=48.02  Aligned_cols=30  Identities=20%  Similarity=0.370  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+.
T Consensus       115 ~~ivHrDlkp~Nil~~~-~~~~kl~Dfg~~~  144 (316)
T cd05620         115 KGIIYRDLKLDNVMLDR-DGHIKIADFGMCK  144 (316)
T ss_pred             CCeEecCCCHHHeEECC-CCCEEeCccCCCe
Confidence            46899999999999986 6789999998775


No 157
>KOG4250|consensus
Probab=92.02  E-value=0.18  Score=53.32  Aligned_cols=32  Identities=25%  Similarity=0.337  Sum_probs=24.5

Q ss_pred             CeeeeecCCCCCCeeeeC-C-CCeEE-EEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDE-T-EDKVT-FIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~-~-~~~l~-lIDfEya~   74 (317)
                      +..+||+||+|+||+.-. . +..|+ |+||-+|.
T Consensus       138 En~IvHRDlKP~NIvl~~Gedgq~IyKLtDfG~Ar  172 (732)
T KOG4250|consen  138 ENGIVHRDLKPGNIVLQIGEDGQSIYKLTDFGAAR  172 (732)
T ss_pred             HcCceeccCCCCcEEEeecCCCceEEeeecccccc
Confidence            568999999999998742 2 23454 99998875


No 158
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=92.00  E-value=0.18  Score=47.72  Aligned_cols=30  Identities=20%  Similarity=0.406  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.||+++. ++.+.|+||..+.
T Consensus       121 ~~iiHrDlkp~Nili~~-~~~~kL~DfG~a~  150 (332)
T cd05623         121 LHYVHRDIKPDNILMDM-NGHIRLADFGSCL  150 (332)
T ss_pred             CCeEecCCCHHHEEECC-CCCEEEeecchhe
Confidence            45899999999999976 6789999998764


No 159
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=91.98  E-value=0.17  Score=46.90  Aligned_cols=29  Identities=24%  Similarity=0.389  Sum_probs=25.6

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|++|.||++++ .+.+.|+||.++.
T Consensus       158 ~ivH~dlkp~Nill~~-~~~~kl~DfG~~~  186 (304)
T cd05096         158 NFVHRDLATRNCLVGE-NLTIKIADFGMSR  186 (304)
T ss_pred             CccccCcchhheEEcC-CccEEECCCccce
Confidence            4899999999999986 6789999998775


No 160
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=91.98  E-value=0.16  Score=46.01  Aligned_cols=31  Identities=26%  Similarity=0.395  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||.++..
T Consensus       121 ~~i~H~dl~p~Nill~~-~~~~~L~dfg~~~~  151 (262)
T cd05071         121 MNYVHRDLRAANILVGE-NLVCKVADFGLARL  151 (262)
T ss_pred             CCccccccCcccEEEcC-CCcEEeccCCceee
Confidence            45799999999999976 67899999998863


No 161
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=91.96  E-value=0.17  Score=45.19  Aligned_cols=52  Identities=17%  Similarity=0.197  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ......-+..+.+.+........++|+|+.+.||++++ ++.+.|+||..+..
T Consensus        98 ~~~~~~~~~~l~~~l~~lh~~~~~~H~~l~~~ni~~~~-~~~~~l~df~~~~~  149 (264)
T cd06623          98 EPVLAYIARQILKGLDYLHTKRHIIHRDIKPSNLLINS-KGEVKIADFGISKV  149 (264)
T ss_pred             HHHHHHHHHHHHHHHHHHhccCCCccCCCCHHHEEECC-CCCEEEccCcccee
Confidence            33333433444444433333278899999999999976 68899999987653


No 162
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=91.94  E-value=0.15  Score=47.71  Aligned_cols=30  Identities=27%  Similarity=0.359  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||++. ++.+.|+||..+.
T Consensus       122 ~~ivH~dlkp~NIll~~-~~~~kL~Dfg~~~  151 (338)
T cd07859         122 ANVFHRDLKPKNILANA-DCKLKICDFGLAR  151 (338)
T ss_pred             CCeecCCCCHHHeEECC-CCcEEEccCcccc
Confidence            35899999999999976 6789999998775


No 163
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=91.94  E-value=0.091  Score=47.10  Aligned_cols=33  Identities=24%  Similarity=0.310  Sum_probs=28.3

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++|+|++|.||+++. ++.+.++||.++...
T Consensus       120 ~~~i~H~di~p~Nili~~-~~~~~l~d~g~~~~~  152 (256)
T cd05039         120 EKNFVHRDLAARNVLVSE-DLVAKVSDFGLAKEA  152 (256)
T ss_pred             hCCccchhcccceEEEeC-CCCEEEccccccccc
Confidence            346899999999999986 678999999988765


No 164
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=91.90  E-value=0.18  Score=44.59  Aligned_cols=52  Identities=17%  Similarity=0.116  Sum_probs=34.8

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      .+.+..-+..+...+... ....++|+|+++.||++++ .+.+.++||.++..-
T Consensus        98 ~~~~~~~~~~i~~~l~~l-H~~~i~H~dl~p~ni~i~~-~~~~~l~d~~~~~~~  149 (254)
T cd06627          98 ESLVAVYVYQVLQGLAYL-HEQGVIHRDIKAANILTTK-DGVVKLADFGVATKL  149 (254)
T ss_pred             HHHHHHHHHHHHHHHHHH-hhCCcccCCCCHHHEEECC-CCCEEEeccccceec
Confidence            444444444443333221 2346799999999999986 678999999988743


No 165
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=91.90  E-value=0.087  Score=48.78  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.||+++. ++.+.++||..+.
T Consensus       120 ~~i~H~dlkp~NIli~~-~~~~kl~Dfg~~~  149 (291)
T cd05612         120 KEIVYRDLKPENILLDK-EGHIKLTDFGFAK  149 (291)
T ss_pred             CCeeecCCCHHHeEECC-CCCEEEEecCcch
Confidence            46899999999999976 6789999998765


No 166
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=91.85  E-value=0.21  Score=46.65  Aligned_cols=31  Identities=23%  Similarity=0.384  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.||++++ ++.+.|+||..+..
T Consensus       128 ~~iiH~dlkp~Nill~~-~~~~kl~DfG~a~~  158 (316)
T cd05108         128 RRLVHRDLAARNVLVKT-PQHVKITDFGLAKL  158 (316)
T ss_pred             cCeeccccchhheEecC-CCcEEEcccccccc
Confidence            35899999999999976 67899999998864


No 167
>KOG0608|consensus
Probab=91.78  E-value=0.19  Score=53.06  Aligned_cols=32  Identities=22%  Similarity=0.462  Sum_probs=28.6

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ....|.|+|++|+|||+|- +|.|.|-||-.|.
T Consensus       746 HkmGFIHRDiKPDNILIDr-dGHIKLTDFGLCT  777 (1034)
T KOG0608|consen  746 HKMGFIHRDIKPDNILIDR-DGHIKLTDFGLCT  777 (1034)
T ss_pred             HhccceecccCccceEEcc-CCceeeeeccccc
Confidence            4579999999999999986 6899999998876


No 168
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=91.78  E-value=0.1  Score=54.07  Aligned_cols=36  Identities=22%  Similarity=0.324  Sum_probs=29.6

Q ss_pred             CeeeeecCCCCCCeeeeCCCC----eEEEEeeccccCCchh
Q psy8745          43 PVVFCHNDLLLGNIIYDETED----KVTFIDYEYAGVNYQA   79 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~----~l~lIDfEya~~n~~~   79 (317)
                      ...|.|.|++||||+++. ++    ++.+|||-.++.-++.
T Consensus       278 ~~GffHaDpHPGNIlv~~-~g~~~~~i~llDFGivg~l~~~  317 (537)
T PRK04750        278 RDGFFHADMHPGNIFVSY-DPPENPRYIALDFGIVGSLNKE  317 (537)
T ss_pred             hCCeeeCCCChHHeEEec-CCCCCCeEEEEecceEEECCHH
Confidence            357999999999999976 34    8999999988865443


No 169
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=91.77  E-value=0.19  Score=47.07  Aligned_cols=31  Identities=26%  Similarity=0.377  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.||++++ ++.+.|+||..+..
T Consensus       117 ~~i~H~dlkp~Nil~~~-~~~~kL~Dfg~~~~  147 (318)
T cd05582         117 LGIIYRDLKPENILLDE-EGHIKLTDFGLSKE  147 (318)
T ss_pred             CCEecCCCCHHHeEECC-CCcEEEeeccCCcc
Confidence            46899999999999976 67899999987653


No 170
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=91.72  E-value=0.18  Score=45.63  Aligned_cols=33  Identities=33%  Similarity=0.415  Sum_probs=28.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ..++|+|+.+.||+++. ++.+.+.||..+..-.
T Consensus       128 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~~~  160 (284)
T cd05038         128 QRYIHRDLAARNILVES-EDLVKISDFGLAKVLP  160 (284)
T ss_pred             CCeecCCCCHHhEEEcC-CCCEEEcccccccccc
Confidence            46899999999999986 5789999998887644


No 171
>PHA03212 serine/threonine kinase US3; Provisional
Probab=91.72  E-value=0.19  Score=49.31  Aligned_cols=30  Identities=23%  Similarity=0.266  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||++. .+.+.|+||..|.
T Consensus       201 ~~IvHrDiKP~NIll~~-~~~vkL~DFG~a~  230 (391)
T PHA03212        201 NRIIHRDIKAENIFINH-PGDVCLGDFGAAC  230 (391)
T ss_pred             CCcccCCCChHhEEEcC-CCCEEEEeCCccc
Confidence            35899999999999976 6789999998775


No 172
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=91.71  E-value=0.2  Score=47.56  Aligned_cols=31  Identities=26%  Similarity=0.387  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.|+||..+..
T Consensus       115 ~~ivH~Dikp~Nili~~-~~~~kL~DfG~~~~  145 (329)
T cd05618         115 RGIIYRDLKLDNVLLDS-EGHIKLTDYGMCKE  145 (329)
T ss_pred             CCeeeCCCCHHHEEECC-CCCEEEeeCCcccc
Confidence            36899999999999976 67899999987753


No 173
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=91.71  E-value=0.073  Score=49.41  Aligned_cols=30  Identities=20%  Similarity=0.363  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. ++.+.|+||..+.
T Consensus       122 ~~ivH~dlkp~Nill~~-~~~~kl~Dfg~~~  151 (303)
T cd07869         122 RYILHRDLKPQNLLISD-TGELKLADFGLAR  151 (303)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEECCCCcce
Confidence            35899999999999976 6789999998875


No 174
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=91.69  E-value=0.18  Score=47.31  Aligned_cols=34  Identities=21%  Similarity=0.215  Sum_probs=28.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      ..++|+|+++.||++++ ++.+.|+||..+.....
T Consensus       122 ~gi~H~dlkp~nili~~-~~~~~L~dfg~~~~~~~  155 (330)
T cd07834         122 ANVIHRDLKPSNILVNS-NCDLKICDFGLARGVDP  155 (330)
T ss_pred             CCeecCCCCHHHEEEcC-CCCEEEcccCceEeecc
Confidence            35899999999999986 58899999998885433


No 175
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=91.68  E-value=0.19  Score=47.60  Aligned_cols=30  Identities=23%  Similarity=0.409  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       115 ~~ivHrDlkp~Nili~~-~~~~kl~Dfg~~~  144 (327)
T cd05617         115 RGIIYRDLKLDNVLLDA-DGHIKLTDYGMCK  144 (327)
T ss_pred             CCeeccCCCHHHEEEeC-CCCEEEeccccce
Confidence            46899999999999986 6789999998765


No 176
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=91.66  E-value=0.096  Score=46.81  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.++||.++..
T Consensus       113 ~~i~H~dl~p~nil~~~-~~~~kl~dfg~~~~  143 (252)
T cd05084         113 KHCIHRDLAARNCLVTE-KNVLKISDFGMSRE  143 (252)
T ss_pred             CCccccccchheEEEcC-CCcEEECccccCcc
Confidence            35799999999999976 57899999998763


No 177
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=91.64  E-value=0.24  Score=44.48  Aligned_cols=31  Identities=19%  Similarity=0.359  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||+++. ++.+.|+||..+..
T Consensus       114 ~~i~H~di~p~nili~~-~~~~kl~df~~~~~  144 (257)
T cd05060         114 KHFVHRDLAARNVLLVN-RHQAKISDFGMSRA  144 (257)
T ss_pred             cCeeccCcccceEEEcC-CCcEEeccccccce
Confidence            35899999999999976 67899999988764


No 178
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=91.63  E-value=0.078  Score=49.37  Aligned_cols=31  Identities=23%  Similarity=0.370  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.|+||..+..
T Consensus       123 ~~ivH~dlkp~Nill~~-~~~~kl~Dfg~~~~  153 (309)
T cd07872         123 RKVLHRDLKPQNLLINE-RGELKLADFGLARA  153 (309)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEECcccccee
Confidence            46899999999999986 67899999987753


No 179
>KOG0592|consensus
Probab=91.55  E-value=0.22  Score=51.31  Aligned_cols=36  Identities=22%  Similarity=0.331  Sum_probs=30.6

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ...+.|+||+|.|||+++ ++++.+-||-.|..-.+.
T Consensus       192 ~~GIIHRDlKPENILLd~-dmhikITDFGsAK~l~~~  227 (604)
T KOG0592|consen  192 SNGIIHRDLKPENILLDK-DGHIKITDFGSAKILSPS  227 (604)
T ss_pred             hcCceeccCChhheeEcC-CCcEEEeeccccccCChh
Confidence            468999999999999987 799999999888764443


No 180
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=91.52  E-value=0.2  Score=44.74  Aligned_cols=31  Identities=32%  Similarity=0.456  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.++||.++..
T Consensus       116 ~~i~H~di~p~nil~~~-~~~~kl~dfg~~~~  146 (257)
T cd05040         116 KRFIHRDLAARNILLAS-DDKVKIGDFGLMRA  146 (257)
T ss_pred             CCccccccCcccEEEec-CCEEEecccccccc
Confidence            46899999999999986 58899999988764


No 181
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=91.51  E-value=0.19  Score=45.01  Aligned_cols=31  Identities=26%  Similarity=0.349  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       122 ~~i~h~di~p~nili~~-~~~~~l~d~g~~~~  152 (261)
T cd05034         122 RNYIHRDLAARNILVGE-NLVCKIADFGLARL  152 (261)
T ss_pred             CCcccCCcchheEEEcC-CCCEEECcccccee
Confidence            35899999999999976 68899999987753


No 182
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=91.50  E-value=0.24  Score=44.05  Aligned_cols=31  Identities=19%  Similarity=0.253  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||+++. ++.+.|+||..+..
T Consensus       112 ~~i~h~di~p~nili~~-~~~~~l~d~g~~~~  142 (251)
T cd05041         112 KNCIHRDLAARNCLVGE-NNVLKISDFGMSRE  142 (251)
T ss_pred             CCEehhhcCcceEEEcC-CCcEEEeecccccc
Confidence            46899999999999976 67899999988764


No 183
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=91.49  E-value=0.21  Score=46.60  Aligned_cols=30  Identities=20%  Similarity=0.429  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ ++.+.++||..+.
T Consensus       119 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~  148 (308)
T cd06615         119 HKIMHRDVKPSNILVNS-RGEIKLCDFGVSG  148 (308)
T ss_pred             CCEEECCCChHHEEEec-CCcEEEccCCCcc
Confidence            35899999999999986 5789999998775


No 184
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=91.48  E-value=0.2  Score=47.80  Aligned_cols=31  Identities=16%  Similarity=0.394  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||++. ++.+.|+||..+..
T Consensus       120 ~~ivH~Dlkp~NIl~~~-~~~~kl~Dfg~~~~  150 (364)
T cd05599         120 LGYIHRDIKPDNLLLDA-KGHIKLSDFGLCTG  150 (364)
T ss_pred             CCeEeccCCHHHeEECC-CCCEEEeeccccee
Confidence            35889999999999976 67899999988753


No 185
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=91.47  E-value=0.091  Score=49.49  Aligned_cols=31  Identities=19%  Similarity=0.350  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.|+||..|..
T Consensus       115 ~~ivH~dlkp~Nill~~-~~~~kL~Dfg~a~~  145 (316)
T cd05592         115 KGIIYRDLKLDNVLLDK-DGHIKIADFGMCKE  145 (316)
T ss_pred             CCEEeCCCCHHHeEECC-CCCEEEccCcCCeE
Confidence            46899999999999976 67899999988763


No 186
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=91.45  E-value=0.074  Score=49.39  Aligned_cols=31  Identities=19%  Similarity=0.379  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.||+++. ++.+.++||..+..
T Consensus       134 ~~i~H~dL~p~Nili~~-~~~~~l~Dfg~~~~  164 (297)
T cd06656         134 NQVIHRDIKSDNILLGM-DGSVKLTDFGFCAQ  164 (297)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEECcCccceE
Confidence            46899999999999976 67899999998753


No 187
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=91.45  E-value=0.17  Score=46.05  Aligned_cols=31  Identities=19%  Similarity=0.156  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.|+||..+..
T Consensus       143 ~gi~H~dlkp~Nil~~~-~~~~kl~Dfg~~~~  173 (283)
T cd05091         143 HHVVHKDLATRNVLVFD-KLNVKISDLGLFRE  173 (283)
T ss_pred             cCccccccchhheEecC-CCceEecccccccc
Confidence            35899999999999976 57799999987663


No 188
>PHA03209 serine/threonine kinase US3; Provisional
Probab=91.45  E-value=0.21  Score=47.99  Aligned_cols=31  Identities=26%  Similarity=0.269  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.|||++. .+.+.|+||..+..
T Consensus       176 ~~ivHrDlkp~Nill~~-~~~~kl~DfG~a~~  206 (357)
T PHA03209        176 QRIIHRDVKTENIFIND-VDQVCIGDLGAAQF  206 (357)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEecCccccc
Confidence            35899999999999976 67899999998763


No 189
>KOG3087|consensus
Probab=91.40  E-value=0.33  Score=44.22  Aligned_cols=34  Identities=24%  Similarity=0.430  Sum_probs=27.6

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeE--EEEeeccccCC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKV--TFIDYEYAGVN   76 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l--~lIDfEya~~n   76 (317)
                      ..-+||+||...|||+.++.+++  .+|||-.+..+
T Consensus       131 ~ndiiHGDLTTSNill~~~~~~~~~~lIdfgls~~s  166 (229)
T KOG3087|consen  131 DNDIIHGDLTTSNILLRSDGNQITPILIDFGLSSVS  166 (229)
T ss_pred             hCCeecccccccceEEecCCCcCceEEEeecchhcc
Confidence            35789999999999987655555  89999887765


No 190
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=91.40  E-value=0.19  Score=46.28  Aligned_cols=31  Identities=19%  Similarity=0.362  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ ++.+.|+||.++..
T Consensus       120 ~~i~H~dl~p~nili~~-~~~~kl~dfg~~~~  150 (290)
T cd05580         120 LDIVYRDLKPENLLLDS-DGYIKITDFGFAKR  150 (290)
T ss_pred             CCEecCCCCHHHEEECC-CCCEEEeeCCCccc
Confidence            56899999999999976 57899999988764


No 191
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=91.40  E-value=0.099  Score=50.11  Aligned_cols=31  Identities=23%  Similarity=0.366  Sum_probs=27.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       145 ~~ivH~Dlkp~NIll~~-~~~~kL~DfG~a~~  175 (364)
T cd07875         145 AGIIHRDLKPSNIVVKS-DCTLKILDFGLART  175 (364)
T ss_pred             CCeecCCCCHHHEEECC-CCcEEEEeCCCccc
Confidence            46899999999999976 67899999998864


No 192
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=91.39  E-value=0.11  Score=50.30  Aligned_cols=31  Identities=19%  Similarity=0.368  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..|..
T Consensus       161 ~~ivHrDLkp~NIll~~-~~~ikL~DfG~a~~  191 (371)
T cd05622         161 MGFIHRDVKPDNMLLDK-SGHLKLADFGTCMK  191 (371)
T ss_pred             CCEEeCCCCHHHEEECC-CCCEEEEeCCceeE
Confidence            46899999999999986 68899999988753


No 193
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=91.37  E-value=0.11  Score=49.18  Aligned_cols=31  Identities=23%  Similarity=0.362  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       137 ~~ivHrdikp~Nil~~~-~~~~kl~Dfg~~~~  167 (343)
T cd07878         137 AGIIHRDLKPSNVAVNE-DCELRILDFGLARQ  167 (343)
T ss_pred             CCeecccCChhhEEECC-CCCEEEcCCcccee
Confidence            46899999999999986 67899999987763


No 194
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=91.32  E-value=0.24  Score=47.24  Aligned_cols=30  Identities=30%  Similarity=0.400  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+++ .+.+.|+||..+.
T Consensus       192 ~~ivHrDikp~Nill~~-~~~vkL~DfG~a~  221 (337)
T cd05054         192 RKCIHRDLAARNILLSE-NNVVKICDFGLAR  221 (337)
T ss_pred             CCeecCCCCcceEEEeC-CCcEEEeccccch
Confidence            46899999999999986 5789999998765


No 195
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=91.32  E-value=0.14  Score=48.26  Aligned_cols=30  Identities=30%  Similarity=0.400  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||-.+.
T Consensus       193 ~~ivHrDiKp~Nil~~~-~~~~kl~DfG~a~  222 (338)
T cd05102         193 RKCIHRDLAARNILLSE-NNVVKICDFGLAR  222 (338)
T ss_pred             CCEECCCCccceEEEcC-CCcEEEeeccccc
Confidence            46899999999999986 6789999998775


No 196
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=91.31  E-value=0.11  Score=47.83  Aligned_cols=31  Identities=23%  Similarity=0.232  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.|||+++ .+.+.++||..+..
T Consensus       121 ~~iiH~dikp~Nill~~-~~~~kl~Dfg~~~~  151 (285)
T cd05631         121 ERIVYRDLKPENILLDD-RGHIRISDLGLAVQ  151 (285)
T ss_pred             CCEEeCCCCHHHEEECC-CCCEEEeeCCCcEE
Confidence            46899999999999976 57899999987754


No 197
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=91.30  E-value=0.19  Score=46.75  Aligned_cols=31  Identities=26%  Similarity=0.298  Sum_probs=25.4

Q ss_pred             eeeeecCCCCCCeeeeC---CCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDE---TEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~---~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||+..   ..+.+.|+||..|.
T Consensus       127 ~~ivHrDlkp~Nil~~~~~~~~~~~kl~DfG~a~  160 (317)
T cd07868         127 NWVLHRDLKPANILVMGEGPERGRVKIADMGFAR  160 (317)
T ss_pred             CCEEcCCCCHHHEEEecCCCCcCcEEEeecCcee
Confidence            35899999999999942   24679999998875


No 198
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=91.29  E-value=0.22  Score=48.30  Aligned_cols=30  Identities=23%  Similarity=0.467  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.|||++. .+.+.|+||..+.
T Consensus       120 ~givHrDlKp~Nili~~-~~~~kL~DFGl~~  149 (381)
T cd05626         120 MGFIHRDIKPDNILIDL-DGHIKLTDFGLCT  149 (381)
T ss_pred             CCeeecCCcHHHEEECC-CCCEEEeeCcCCc
Confidence            46899999999999976 6889999998764


No 199
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=91.29  E-value=0.088  Score=50.35  Aligned_cols=31  Identities=23%  Similarity=0.366  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.|+||..+..
T Consensus       142 ~~ivHrDlkp~NIl~~~-~~~~kl~Dfg~a~~  172 (359)
T cd07876         142 AGIIHRDLKPSNIVVKS-DCTLKILDFGLART  172 (359)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEecCCCccc
Confidence            46899999999999976 68899999988764


No 200
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=91.28  E-value=0.2  Score=45.47  Aligned_cols=32  Identities=19%  Similarity=0.285  Sum_probs=27.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+++.||++++ .+.+.++||..+..-
T Consensus       118 ~~i~H~dl~p~ni~~~~-~~~~~l~dfg~~~~~  149 (286)
T cd07832         118 NGIMHRDLKPANLLISA-DGVLKIADFGLARLF  149 (286)
T ss_pred             CCeecCCcCHHHEEEcC-CCcEEEeeeeecccc
Confidence            35899999999999986 678999999887643


No 201
>KOG0588|consensus
Probab=91.28  E-value=0.12  Score=54.44  Aligned_cols=49  Identities=18%  Similarity=0.379  Sum_probs=36.2

Q ss_pred             HHHHHHHHhc--CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          30 WQYIETALSK--TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        30 ~~~L~~~l~~--~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      +..+.+.+..  .....-+||+||+|.|+|++. .++|.+=||-+|..-.++
T Consensus       115 a~ff~QIi~gv~yCH~~~icHRDLKpENlLLd~-~~nIKIADFGMAsLe~~g  165 (786)
T KOG0588|consen  115 AHFFRQILDGVSYCHAFNICHRDLKPENLLLDV-KNNIKIADFGMASLEVPG  165 (786)
T ss_pred             HHHHHHHHHHHHHHhhhcceeccCCchhhhhhc-ccCEeeeccceeecccCC
Confidence            3344444432  245678999999999999987 455999999999876554


No 202
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=91.28  E-value=0.12  Score=47.16  Aligned_cols=31  Identities=26%  Similarity=0.460  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||.++..
T Consensus       128 ~~iiH~dlkp~Nil~~~-~~~~kL~dfG~~~~  158 (279)
T cd05109         128 VRLVHRDLAARNVLVKS-PNHVKITDFGLARL  158 (279)
T ss_pred             CCeeccccccceEEEcC-CCcEEECCCCceee
Confidence            45899999999999975 67899999987754


No 203
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=91.24  E-value=0.23  Score=45.14  Aligned_cols=31  Identities=26%  Similarity=0.280  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||++++ ++.+.++||..+..
T Consensus       138 ~~~vH~dlkp~Nil~~~-~~~~~l~dfg~~~~  168 (277)
T cd05062         138 NKFVHRDLAARNCMVAE-DFTVKIGDFGMTRD  168 (277)
T ss_pred             CCcccCCcchheEEEcC-CCCEEECCCCCccc
Confidence            35899999999999986 67899999987653


No 204
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=91.23  E-value=0.19  Score=46.79  Aligned_cols=31  Identities=26%  Similarity=0.358  Sum_probs=26.8

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...++|+|++|.|||+++ ++.+.|+||..+.
T Consensus       142 ~~gi~H~dlkp~Nili~~-~~~~kl~dfg~~~  172 (303)
T cd05088         142 QKQFIHRDLAARNILVGE-NYVAKIADFGLSR  172 (303)
T ss_pred             hCCccccccchheEEecC-CCcEEeCccccCc
Confidence            357899999999999976 6789999998874


No 205
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=91.18  E-value=0.13  Score=45.90  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||..+..
T Consensus       112 ~~~~H~dl~p~nili~~-~~~~~l~d~g~~~~  142 (250)
T cd05085         112 KNCIHRDLAARNCLVGE-NNVLKISDFGMSRQ  142 (250)
T ss_pred             CCeeecccChheEEEcC-CCeEEECCCcccee
Confidence            46899999999999976 67899999998753


No 206
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=91.16  E-value=0.24  Score=47.72  Aligned_cols=31  Identities=23%  Similarity=0.373  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+..
T Consensus       122 ~~ivH~dlkp~Nili~~-~~~~kL~Dfg~a~~  152 (372)
T cd07853         122 AGILHRDIKPGNLLVNS-NCVLKICDFGLARV  152 (372)
T ss_pred             CCeeCCCCChHHEEECC-CCCEEeccccceee
Confidence            35899999999999986 67899999998764


No 207
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=91.12  E-value=0.26  Score=45.16  Aligned_cols=31  Identities=23%  Similarity=0.368  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+..
T Consensus       124 ~~i~H~dl~p~nil~~~-~~~~kl~dfg~~~~  154 (290)
T cd05613         124 LGIIYRDIKLENILLDS-NGHVVLTDFGLSKE  154 (290)
T ss_pred             CCeeccCCCHHHeEECC-CCCEEEeeCcccee
Confidence            46899999999999986 67899999987653


No 208
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=91.12  E-value=0.11  Score=49.68  Aligned_cols=31  Identities=23%  Similarity=0.366  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|+||+++. ++.+.|+||..+..
T Consensus       138 ~givHrDikp~Nill~~-~~~~kl~Dfg~~~~  168 (355)
T cd07874         138 AGIIHRDLKPSNIVVKS-DCTLKILDFGLART  168 (355)
T ss_pred             CCcccCCCChHHEEECC-CCCEEEeeCccccc
Confidence            46899999999999976 67899999998864


No 209
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=91.10  E-value=0.21  Score=46.06  Aligned_cols=31  Identities=23%  Similarity=0.160  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ .+.+.++||.++..
T Consensus       121 ~~iiH~dikp~Nili~~-~~~~kl~Dfg~~~~  151 (285)
T cd05632         121 ENTVYRDLKPENILLDD-YGHIRISDLGLAVK  151 (285)
T ss_pred             CCeeecCCCHHHEEECC-CCCEEEecCCccee
Confidence            45899999999999976 57899999998753


No 210
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=91.07  E-value=0.18  Score=43.66  Aligned_cols=35  Identities=29%  Similarity=0.331  Sum_probs=29.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ..++|+|+.+.||++++ ++.+.++||+.+..-...
T Consensus       106 ~~i~h~~i~~~ni~~~~-~~~~~l~d~~~~~~~~~~  140 (244)
T smart00220      106 NGIIHRDLKPENILLDE-DGHVKLADFGLARQLDPG  140 (244)
T ss_pred             cCeecCCcCHHHeEECC-CCcEEEccccceeeeccc
Confidence            37899999999999986 578999999988865443


No 211
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=91.06  E-value=0.25  Score=44.60  Aligned_cols=31  Identities=26%  Similarity=0.377  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+.|+|+++.||++++ ++.+.++||..+..
T Consensus       119 ~~i~H~dl~p~nili~~-~~~~kl~d~g~~~~  149 (256)
T cd05113         119 KQFIHRDLAARNCLVDD-QGCVKVSDFGLSRY  149 (256)
T ss_pred             CCeeccccCcceEEEcC-CCCEEECCCcccee
Confidence            46899999999999976 57899999987753


No 212
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=91.04  E-value=0.11  Score=46.86  Aligned_cols=31  Identities=26%  Similarity=0.367  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||..+..
T Consensus       131 ~~i~H~dlkp~Nil~~~-~~~~kl~Dfg~~~~  161 (272)
T cd05075         131 KSFIHRDLAARNCMLNE-NMNVCVADFGLSKK  161 (272)
T ss_pred             CCeeccccchhheEEcC-CCCEEECCCCcccc
Confidence            35899999999999976 67899999987653


No 213
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=91.04  E-value=0.29  Score=44.22  Aligned_cols=33  Identities=21%  Similarity=0.226  Sum_probs=27.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ..++|+|+++.||++++ ++.+.++||.++....
T Consensus       117 ~~i~H~dl~p~nili~~-~~~~~l~df~~~~~~~  149 (283)
T cd05118         117 HGILHRDLKPENLLINT-EGVLKLADFGLARSFG  149 (283)
T ss_pred             CCeeecCcCHHHEEECC-CCcEEEeeeeeeEecC
Confidence            45899999999999986 6789999999886443


No 214
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=91.03  E-value=0.23  Score=44.45  Aligned_cols=31  Identities=26%  Similarity=0.279  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||+++..
T Consensus       123 ~~i~h~dl~~~nilv~~-~~~~kl~d~g~~~~  153 (261)
T cd05148         123 QNSIHRDLAARNILVGE-DLVCKVADFGLARL  153 (261)
T ss_pred             CCeeccccCcceEEEcC-CceEEEccccchhh
Confidence            35899999999999986 57899999998864


No 215
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=91.02  E-value=0.15  Score=46.56  Aligned_cols=32  Identities=25%  Similarity=0.375  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|.||++++ ++.+.++||.++...
T Consensus       126 ~~i~H~dlkp~Nili~~-~~~~~l~dfg~~~~~  157 (283)
T cd05080         126 QHYIHRDLAARNVLLDN-DRLVKIGDFGLAKAV  157 (283)
T ss_pred             CCeeccccChheEEEcC-CCcEEEeeccccccc
Confidence            46899999999999976 578999999987643


No 216
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=91.01  E-value=0.25  Score=45.47  Aligned_cols=32  Identities=22%  Similarity=0.217  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|++|.||++++ ++.+.|+||.++..
T Consensus       141 ~~~i~H~dlkp~Nil~~~-~~~~~l~dfg~a~~  172 (291)
T cd05094         141 SQHFVHRDLATRNCLVGA-NLLVKIGDFGMSRD  172 (291)
T ss_pred             hCCeeecccCcceEEEcc-CCcEEECCCCcccc
Confidence            346899999999999986 67899999998753


No 217
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=91.00  E-value=0.16  Score=52.41  Aligned_cols=33  Identities=24%  Similarity=0.429  Sum_probs=28.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      .-.|-|.|+|||||++++ ++++.++||-..|.=
T Consensus       283 ~dgffHaDpHpGNi~v~~-~g~i~~lDfGi~g~l  315 (517)
T COG0661         283 RDGFFHADPHPGNILVRS-DGRIVLLDFGIVGRL  315 (517)
T ss_pred             hcCccccCCCccceEEec-CCcEEEEcCcceecC
Confidence            468999999999999987 689999999777643


No 218
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=90.99  E-value=0.23  Score=44.56  Aligned_cols=32  Identities=28%  Similarity=0.383  Sum_probs=27.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+||.+.||++++ ++.+.++||+.+...
T Consensus       119 ~~i~h~dl~~~nil~~~-~~~~~l~d~~~~~~~  150 (258)
T cd05578         119 KGIIHRDIKPDNILLDE-QGHVHITDFNIATKV  150 (258)
T ss_pred             CCeeccCCCHHHeEEcC-CCCEEEeeccccccc
Confidence            45899999999999986 678999999877654


No 219
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=90.96  E-value=0.23  Score=45.97  Aligned_cols=30  Identities=23%  Similarity=0.351  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+.
T Consensus       138 ~~ivH~dlkp~Nill~~-~~~~kl~dfg~~~  167 (297)
T cd05089         138 KQFIHRDLAARNVLVGE-NLASKIADFGLSR  167 (297)
T ss_pred             CCcccCcCCcceEEECC-CCeEEECCcCCCc
Confidence            46899999999999976 5789999998775


No 220
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=90.94  E-value=0.36  Score=43.72  Aligned_cols=39  Identities=23%  Similarity=0.413  Sum_probs=32.8

Q ss_pred             ceEEEeecCccCCCCCCCCc-ccHHHHHHHHHhhcccCCC
Q psy8745         207 GLVYQYVRGVTITPDSIREP-HIHPLVARNMARLHKVHSN  245 (317)
Q Consensus       207 G~~e~fi~g~tL~~~~l~~~-~i~~~IA~~la~~H~~~~~  245 (317)
                      +.+.+||+|++++...+.++ .+...+|+-|+++|.+.++
T Consensus        70 ~~l~~~i~G~~l~~~~~~~~~~l~~~la~~l~~LH~i~~~  109 (235)
T cd05155          70 WSVYRWLEGETATAAALSDPSEFAEDLADFLAALRQIDPS  109 (235)
T ss_pred             eEEEEeecCCCCCccccCCHHHHHHHHHHHHHHHhCCCcc
Confidence            46999999999988877765 5778899999999998764


No 221
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=90.90  E-value=0.2  Score=45.86  Aligned_cols=31  Identities=26%  Similarity=0.397  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.++||.++..
T Consensus       124 ~~~~H~dl~p~nil~~~-~~~~~l~dfg~~~~  154 (288)
T cd05583         124 LGIIYRDIKLENILLDS-EGHVVLTDFGLSKE  154 (288)
T ss_pred             CCeeccCCCHHHeEECC-CCCEEEEECccccc
Confidence            46899999999999976 57899999987653


No 222
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=90.89  E-value=0.29  Score=43.75  Aligned_cols=31  Identities=26%  Similarity=0.293  Sum_probs=26.7

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...++|+|++|.||++++ ++.+.++||..+.
T Consensus       118 ~~~i~H~dl~p~nili~~-~~~~~l~dfg~~~  148 (255)
T cd08219         118 EKRVLHRDIKSKNIFLTQ-NGKVKLGDFGSAR  148 (255)
T ss_pred             hCCcccCCCCcceEEECC-CCcEEEcccCcce
Confidence            347899999999999976 6789999999775


No 223
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=90.89  E-value=0.34  Score=44.52  Aligned_cols=31  Identities=19%  Similarity=0.459  Sum_probs=26.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...++|+|+++.||+++. ++.+.|+||..+.
T Consensus       128 ~~~i~H~dlkp~Nili~~-~~~~kl~dfg~~~  158 (292)
T cd06644         128 SMKIIHRDLKAGNVLLTL-DGDIKLADFGVSA  158 (292)
T ss_pred             cCCeeecCCCcceEEEcC-CCCEEEccCccce
Confidence            357899999999999975 6789999997654


No 224
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=90.85  E-value=0.24  Score=44.83  Aligned_cols=31  Identities=23%  Similarity=0.356  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||.++..
T Consensus       125 ~~i~h~dlkp~nili~~-~~~~~l~dfg~~~~  155 (267)
T cd05066         125 MGYVHRDLAARNILVNS-NLVCKVSDFGLSRV  155 (267)
T ss_pred             CCEeehhhchhcEEECC-CCeEEeCCCCcccc
Confidence            45899999999999976 67899999987753


No 225
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=90.84  E-value=0.19  Score=46.25  Aligned_cols=31  Identities=23%  Similarity=0.348  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||.++..
T Consensus       134 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~  164 (311)
T cd07866         134 NHILHRDIKAANILIDN-QGILKIADFGLARP  164 (311)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEECcCccchh
Confidence            46899999999999986 67899999988864


No 226
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=90.83  E-value=0.28  Score=45.03  Aligned_cols=31  Identities=26%  Similarity=0.259  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.|+||.++..
T Consensus       139 ~~i~H~dlkp~Nili~~-~~~~kl~dfg~~~~  169 (288)
T cd05093         139 QHFVHRDLATRNCLVGE-NLLVKIGDFGMSRD  169 (288)
T ss_pred             CCeeecccCcceEEEcc-CCcEEeccCCcccc
Confidence            46899999999999976 67899999998763


No 227
>TIGR02457 TreS_Cterm trehalose synthase-fused probable maltokinase. Three pathways for the biosynthesis of trehalose, an osmoprotectant that in some species is also a precursor of certain cell wall glycolipids. Trehalose synthase, TreS, can interconvert maltose and trehalose, but while the equilibrium may favor trehalose, physiological concentrations of trehalose may be much greater than that of maltose and TreS may act largely in its degradation. This model describes a domain found only as a C-terminal fusion to TreS proteins. The most closely related proteins outside this family, Pep2 of Streptomyces coelicolor and Mak1 of Actinoplanes missouriensis, have known maltokinase activity. We suggest this domain acts as a maltokinase and helps drive conversion of trehalose to maltose.
Probab=90.83  E-value=0.36  Score=49.93  Aligned_cols=44  Identities=25%  Similarity=0.426  Sum_probs=33.7

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccc---------cCCchhhhHHHHHHHhh
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYA---------GVNYQAFDIANHFDEFA   90 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya---------~~n~~~fDiAn~~~E~~   90 (317)
                      .=||+|+|-+|+|+..  ++.+|||||-=         ....|.-|+|.++..+.
T Consensus       380 ~RiHGD~HLgqvL~t~--~d~~IiDFEGEP~Rpl~ERR~k~sPLRDVAGMLRSf~  432 (528)
T TIGR02457       380 IRIHGDFHLGQVLVVQ--DDAVLIDFEGEPARPLAERRAKRSPLRDVAGMLRSFD  432 (528)
T ss_pred             EeEecCcchhcEEEeC--CCeEEEcCCCCCCCChHHhccCCChHHHHHHHHHHHH
Confidence            3399999999999974  56779999861         34567778888877654


No 228
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=90.83  E-value=0.32  Score=43.36  Aligned_cols=32  Identities=13%  Similarity=0.012  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCC------eEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETED------KVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~------~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++....      .+.+.||.++..
T Consensus       120 ~~i~H~dlkp~Nill~~~~~~~~~~~~~kl~Dfg~a~~  157 (259)
T cd05037         120 KKLVHGNVCGKNILVARYGLNEGYVPFIKLSDPGIPIT  157 (259)
T ss_pred             CCeecccCccceEEEecCccccCCceeEEeCCCCcccc
Confidence            46899999999999975321      599999998874


No 229
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=90.81  E-value=0.13  Score=46.47  Aligned_cols=30  Identities=33%  Similarity=0.333  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.++||..+.
T Consensus       119 ~~ivH~dlkp~Nill~~-~~~~kl~dfg~~~  148 (269)
T cd05042         119 ADFIHSDLALRNCQLTA-DLSVKIGDYGLAL  148 (269)
T ss_pred             cCEecccccHhheEecC-CCcEEEecccccc
Confidence            35799999999999986 6789999998764


No 230
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=90.79  E-value=0.29  Score=44.42  Aligned_cols=30  Identities=27%  Similarity=0.372  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.++||..+.
T Consensus       131 ~~i~H~dikp~nili~~-~~~~kl~dfgl~~  160 (270)
T cd05047         131 KQFIHRDLAARNILVGE-NYVAKIADFGLSR  160 (270)
T ss_pred             CCEeecccccceEEEcC-CCeEEECCCCCcc
Confidence            57899999999999976 6789999998874


No 231
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=90.76  E-value=0.25  Score=44.13  Aligned_cols=30  Identities=23%  Similarity=0.288  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++. .+.+.++||+.+.
T Consensus       119 ~~i~h~dl~p~ni~i~~-~~~~~l~d~g~~~  148 (256)
T cd05112         119 SNVIHRDLAARNCLVGE-NQVVKVSDFGMTR  148 (256)
T ss_pred             CCccccccccceEEEcC-CCeEEECCCccee
Confidence            35899999999999975 5789999998765


No 232
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=90.73  E-value=0.33  Score=43.60  Aligned_cols=31  Identities=19%  Similarity=0.341  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       114 ~~i~H~dlkp~nill~~-~~~~kl~Dfg~~~~  144 (257)
T cd05116         114 TNFVHRDLAARNVLLVT-QHYAKISDFGLSKA  144 (257)
T ss_pred             CCEeecccchhhEEEcC-CCeEEECCCccccc
Confidence            35799999999999976 57799999987753


No 233
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=90.72  E-value=0.11  Score=49.13  Aligned_cols=31  Identities=26%  Similarity=0.385  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.|+||..+..
T Consensus       115 ~~ivH~dlkp~Nili~~-~~~~kL~Dfg~~~~  145 (329)
T cd05588         115 RGIIYRDLKLDNVLLDA-EGHIKLTDYGMCKE  145 (329)
T ss_pred             CCeEecCCCHHHeEECC-CCCEEECcCccccc
Confidence            46899999999999976 67899999987753


No 234
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=90.71  E-value=0.4  Score=42.45  Aligned_cols=32  Identities=22%  Similarity=0.300  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+++.||+++. .+.+.++||..+...
T Consensus       112 ~~~~H~~l~p~ni~~~~-~~~~~l~d~~~~~~~  143 (250)
T cd05123         112 LGIIYRDLKPENILLDA-DGHIKLTDFGLAKEL  143 (250)
T ss_pred             CCceecCCCcceEEEcC-CCcEEEeecCcceec
Confidence            56899999999999976 678999999877643


No 235
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=90.70  E-value=0.17  Score=46.39  Aligned_cols=31  Identities=16%  Similarity=0.227  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||..+..
T Consensus       114 ~~ivH~dikp~Nili~~-~~~~~l~Dfg~~~~  144 (277)
T cd05607         114 MDIVYRDMKPENVLLDD-QGNCRLSDLGLAVE  144 (277)
T ss_pred             CCEEEccCChHhEEEcC-CCCEEEeeceeeee
Confidence            46899999999999976 67899999987653


No 236
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=90.68  E-value=0.25  Score=45.49  Aligned_cols=30  Identities=17%  Similarity=0.402  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+.
T Consensus       134 ~~i~H~dl~p~Nil~~~-~~~~~l~d~g~~~  163 (285)
T cd06648         134 QGVIHRDIKSDSILLTS-DGRVKLSDFGFCA  163 (285)
T ss_pred             CCeecCCCChhhEEEcC-CCcEEEcccccch
Confidence            46899999999999976 6789999998665


No 237
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=90.67  E-value=0.25  Score=46.49  Aligned_cols=31  Identities=26%  Similarity=0.329  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.||++++ ++.+.|+||..+..
T Consensus       120 ~~ivHrdlkp~Nill~~-~~~~kL~Dfg~~~~  150 (324)
T cd05589         120 NKIVYRDLKLDNLLLDT-EGFVKIADFGLCKE  150 (324)
T ss_pred             CCeEecCCCHHHeEECC-CCcEEeCcccCCcc
Confidence            45899999999999986 68899999987753


No 238
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=90.66  E-value=0.51  Score=43.32  Aligned_cols=30  Identities=23%  Similarity=0.390  Sum_probs=26.0

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+++.||+++..++.+.+.||..+.
T Consensus       122 ~i~H~dl~p~nill~~~~~~~kl~dfg~~~  151 (294)
T PLN00009        122 RVLHRDLKPQNLLIDRRTNALKLADFGLAR  151 (294)
T ss_pred             CeeCCCCCcceEEEECCCCEEEEccccccc
Confidence            589999999999998645678999998875


No 239
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=90.62  E-value=0.13  Score=49.78  Aligned_cols=30  Identities=20%  Similarity=0.399  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||..+.
T Consensus       161 ~~ivHrDLkp~NILl~~-~~~~kL~DfG~~~  190 (370)
T cd05596         161 MGFIHRDVKPDNMLLDK-SGHLKLADFGTCM  190 (370)
T ss_pred             CCeeccCCCHHHEEEcC-CCCEEEEecccee
Confidence            45899999999999986 6889999998765


No 240
>KOG0581|consensus
Probab=90.61  E-value=0.25  Score=48.55  Aligned_cols=36  Identities=17%  Similarity=0.358  Sum_probs=30.3

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ..-+.|+|++|.|||++. .|.|.|=||--++.--..
T Consensus       197 ~~~IIHRDIKPsNlLvNs-kGeVKicDFGVS~~lvnS  232 (364)
T KOG0581|consen  197 ERKIIHRDIKPSNLLVNS-KGEVKICDFGVSGILVNS  232 (364)
T ss_pred             ccCeeeccCCHHHeeecc-CCCEEeccccccHHhhhh
Confidence            478899999999999987 799999999888853333


No 241
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=90.61  E-value=0.3  Score=44.88  Aligned_cols=51  Identities=16%  Similarity=0.178  Sum_probs=33.9

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .+.+...+..+.+.|.-. ....++|+|+.+.||+++. ++.+.++||..+..
T Consensus       101 ~~~~~~~~~qi~~al~~l-H~~~i~H~dl~p~nill~~-~~~~~l~dfg~~~~  151 (298)
T cd07841         101 PADIKSYMLMTLRGLEYL-HSNWILHRDLKPNNLLIAS-DGVLKLADFGLARS  151 (298)
T ss_pred             HHHHHHHHHHHHHHHHHH-HhCCeeecCCChhhEEEcC-CCCEEEccceeeee
Confidence            444444443333333221 1235899999999999986 67899999987753


No 242
>PHA03210 serine/threonine kinase US3; Provisional
Probab=90.60  E-value=0.27  Score=50.04  Aligned_cols=30  Identities=27%  Similarity=0.368  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++. ++.++|+||..+.
T Consensus       286 ~gIiHrDLKP~NILl~~-~~~vkL~DFGla~  315 (501)
T PHA03210        286 KKLIHRDIKLENIFLNC-DGKIVLGDFGTAM  315 (501)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEEeCCCce
Confidence            46899999999999976 6789999998775


No 243
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=90.59  E-value=0.24  Score=45.58  Aligned_cols=30  Identities=30%  Similarity=0.310  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ ++.+.++||..+.
T Consensus       116 ~~ivH~dikp~Nil~~~-~~~~~l~dfg~~~  145 (279)
T cd05633         116 RFVVYRDLKPANILLDE-HGHVRISDLGLAC  145 (279)
T ss_pred             CCcCCCCCCHHHEEECC-CCCEEEccCCcce
Confidence            34799999999999976 6789999999875


No 244
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=90.59  E-value=0.12  Score=47.50  Aligned_cols=30  Identities=23%  Similarity=0.244  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ ++.+.++||..+.
T Consensus       116 ~~i~H~dlkp~Nili~~-~~~~~l~dfg~~~  145 (280)
T cd05608         116 RRIIYRDLKPENVLLDN-DGNVRISDLGLAV  145 (280)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEeeCccce
Confidence            46899999999999976 6789999998764


No 245
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=90.56  E-value=0.28  Score=44.04  Aligned_cols=30  Identities=30%  Similarity=0.408  Sum_probs=25.9

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|++|.||++++ ++.+.++||..+..
T Consensus       120 ~i~H~dl~p~ni~i~~-~~~~kl~dfg~~~~  149 (256)
T cd05059         120 GFIHRDLAARNCLVGE-DNVVKVSDFGLARY  149 (256)
T ss_pred             CcccccccHhhEEECC-CCcEEECCccccee
Confidence            4899999999999976 67899999987753


No 246
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=90.56  E-value=0.26  Score=44.71  Aligned_cols=59  Identities=22%  Similarity=0.323  Sum_probs=47.7

Q ss_pred             CcchhhhhcCC-CCceEEEecCc--eEEEeecCccCCC-CCCCCcccHHHHHHHHHhhcccCC
Q psy8745         186 PSPQILHRAGL-APRLYAEFDNG--LVYQYVRGVTITP-DSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       186 ~~~~~L~~~~~-gp~l~g~F~nG--~~e~fi~g~tL~~-~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      ..+..+.+.|+ .|-||-+.++.  ++=|||+|+.|.. -+-..|.+++.|.+.++++|.-.+
T Consensus        51 ril~~a~~~GV~~P~v~dvD~~~~~I~me~I~G~~lkd~l~~~~~~~~r~vG~~vg~lH~~gi  113 (204)
T COG3642          51 RILAKAREAGVPVPIVYDVDPDNGLIVMEYIEGELLKDALEEARPDLLREVGRLVGKLHKAGI  113 (204)
T ss_pred             HHHHHHHHcCCCCCeEEEEcCCCCEEEEEEeCChhHHHHHHhcchHHHHHHHHHHHHHHhcCe
Confidence            55667778888 78899999999  8999999998872 112258899999999999998653


No 247
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=90.55  E-value=0.16  Score=45.54  Aligned_cols=31  Identities=23%  Similarity=0.309  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       123 ~~i~H~dl~p~nilv~~-~~~~~l~dfg~~~~  153 (263)
T cd06625         123 NMIVHRDIKGANILRDS-AGNVKLGDFGASKR  153 (263)
T ss_pred             CCeecCCCCHHHEEEcC-CCCEEEeeccccee
Confidence            46799999999999976 67899999988753


No 248
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=90.54  E-value=0.26  Score=43.88  Aligned_cols=32  Identities=25%  Similarity=0.359  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++++++.+.+.||..+..
T Consensus       120 ~~i~h~dl~~~nil~~~~~~~~~l~d~~~~~~  151 (256)
T cd08220         120 KLILHRDLKTQNILLDKHKMVVKIGDFGISKI  151 (256)
T ss_pred             CCeecCCCCHHHEEEcCCCCEEEEccCCCcee
Confidence            47899999999999976455678999988764


No 249
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=90.51  E-value=0.23  Score=46.92  Aligned_cols=30  Identities=23%  Similarity=0.413  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.|+||.++.
T Consensus       124 ~givH~dlkp~Nili~~-~~~~kl~Dfg~a~  153 (332)
T cd07857         124 ANVLHRDLKPGNLLVNA-DCELKICDFGLAR  153 (332)
T ss_pred             CCcccCCCCHHHeEEcC-CCCEEeCcCCCce
Confidence            45899999999999976 6789999999875


No 250
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=90.50  E-value=0.38  Score=44.02  Aligned_cols=31  Identities=23%  Similarity=0.377  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+.|+|+++.||++++ ++.+.++||..+..
T Consensus       128 ~~iiH~dlkp~nili~~-~~~~kl~Dfg~~~~  158 (279)
T cd05111         128 HRMVHRNLAARNILLKS-DSIVQIADFGVADL  158 (279)
T ss_pred             CCEeccccCcceEEEcC-CCcEEEcCCcccee
Confidence            34899999999999976 67899999988753


No 251
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=90.45  E-value=0.11  Score=47.98  Aligned_cols=31  Identities=23%  Similarity=0.370  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       123 ~~i~H~dlkp~Nil~~~-~~~~kl~dfg~~~~  153 (301)
T cd07873         123 RKVLHRDLKPQNLLINE-RGELKLADFGLARA  153 (301)
T ss_pred             CCeeCCCCCHHHEEECC-CCcEEECcCcchhc
Confidence            46899999999999976 57899999987753


No 252
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=90.38  E-value=0.18  Score=47.20  Aligned_cols=31  Identities=23%  Similarity=0.325  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.|+||..+..
T Consensus       153 ~gi~H~dlkp~Nill~~-~~~~kL~Dfg~~~~  183 (314)
T cd05099         153 RRCIHRDLAARNVLVTE-DNVMKIADFGLARG  183 (314)
T ss_pred             CCeeeccccceeEEEcC-CCcEEEcccccccc
Confidence            46899999999999976 67899999988763


No 253
>PHA03207 serine/threonine kinase US3; Provisional
Probab=90.35  E-value=0.2  Score=48.93  Aligned_cols=30  Identities=27%  Similarity=0.314  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||++.|||++. .+.++|+||..+.
T Consensus       204 ~givHrDlkp~Nill~~-~~~~~l~DfG~a~  233 (392)
T PHA03207        204 RGIIHRDVKTENIFLDE-PENAVLGDFGAAC  233 (392)
T ss_pred             CCccccCCCHHHEEEcC-CCCEEEccCcccc
Confidence            46899999999999986 6789999998775


No 254
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=90.35  E-value=0.32  Score=43.96  Aligned_cols=31  Identities=23%  Similarity=0.360  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. .+.+.++||..+..
T Consensus       126 ~~~~H~dl~p~nili~~-~~~~~l~d~g~~~~  156 (270)
T cd05056         126 KRFVHRDIAARNVLVSS-PDCVKLGDFGLSRY  156 (270)
T ss_pred             CCeeccccChheEEEec-CCCeEEccCceeee
Confidence            46899999999999986 67899999987754


No 255
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=90.34  E-value=0.16  Score=46.50  Aligned_cols=32  Identities=22%  Similarity=0.410  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|++|.||++++ ++.+.|+||..+..
T Consensus       127 ~~gi~H~dlkp~Nil~~~-~~~~~l~dfg~~~~  158 (284)
T cd05079         127 SRQYVHRDLAARNVLVES-EHQVKIGDFGLTKA  158 (284)
T ss_pred             HCCeeecccchheEEEcC-CCCEEECCCccccc
Confidence            346899999999999976 67899999987763


No 256
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=90.29  E-value=0.18  Score=45.64  Aligned_cols=31  Identities=16%  Similarity=0.237  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++...+.+.|+||..+.
T Consensus       127 ~~i~h~dl~p~nil~~~~~~~~~l~dfg~~~  157 (268)
T cd06624         127 NQIVHRDIKGDNVLVNTYSGVVKISDFGTSK  157 (268)
T ss_pred             CCEeecCCCHHHEEEcCCCCeEEEecchhhe
Confidence            4689999999999997645789999998764


No 257
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=90.28  E-value=0.29  Score=43.91  Aligned_cols=31  Identities=23%  Similarity=0.290  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||+++..
T Consensus       119 ~~i~H~dl~p~ni~i~~-~~~~kl~d~g~~~~  149 (256)
T cd05114         119 NSFIHRDLAARNCLVSS-TGVVKVSDFGMTRY  149 (256)
T ss_pred             CCccccccCcceEEEcC-CCeEEECCCCCccc
Confidence            45899999999999976 67899999998764


No 258
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=90.28  E-value=0.27  Score=43.86  Aligned_cols=32  Identities=16%  Similarity=0.204  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.+.||..+...
T Consensus       120 ~~i~h~dl~p~ni~~~~-~~~~kl~d~~~~~~~  151 (256)
T cd08221         120 AGILHRDIKTLNIFLTK-AGLIKLGDFGISKIL  151 (256)
T ss_pred             CCccccCCChHhEEEeC-CCCEEECcCcceEEc
Confidence            45789999999999986 678999999887643


No 259
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=90.25  E-value=0.34  Score=44.11  Aligned_cols=32  Identities=22%  Similarity=0.344  Sum_probs=27.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+++.||++++ .+.+.|+||.++..-
T Consensus       128 ~~i~H~di~p~nil~~~-~~~~kL~dfg~~~~~  159 (279)
T cd05057         128 KRLVHRDLAARNVLVKT-PQHVKITDFGLAKLL  159 (279)
T ss_pred             CCEEecccCcceEEEcC-CCeEEECCCcccccc
Confidence            57899999999999976 678999999988643


No 260
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=90.25  E-value=0.22  Score=44.84  Aligned_cols=32  Identities=28%  Similarity=0.390  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|+.+.||+++. ++.+.++||..+..
T Consensus       120 ~~~~~H~dl~~~ni~i~~-~~~~~l~df~~~~~  151 (280)
T cd05581         120 SKGIIHRDLKPENILLDK-DMHIKITDFGTAKV  151 (280)
T ss_pred             HCCeeecCCCHHHeEECC-CCCEEecCCccccc
Confidence            346899999999999976 67899999987763


No 261
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=90.14  E-value=0.28  Score=43.56  Aligned_cols=32  Identities=25%  Similarity=0.393  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+...
T Consensus       112 ~~i~H~di~~~nil~~~-~~~~~l~dfg~~~~~  143 (265)
T cd05579         112 NGIIHRDLKPDNILIDS-NGHLKLTDFGLSKVG  143 (265)
T ss_pred             cCeecCCCCHHHeEEcC-CCCEEEEecccchhc
Confidence            46899999999999986 678999999876643


No 262
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=90.14  E-value=0.16  Score=45.87  Aligned_cols=32  Identities=19%  Similarity=0.269  Sum_probs=27.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|.||++++ ++.+.++||.++...
T Consensus       125 ~~i~H~di~p~nili~~-~~~~~l~dfg~~~~~  156 (266)
T cd05033         125 MNYVHRDLAARNILVNS-NLVCKVSDFGLSRRL  156 (266)
T ss_pred             CCcccCCCCcceEEEcC-CCCEEECccchhhcc
Confidence            46899999999999986 678999999877643


No 263
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=90.13  E-value=0.18  Score=45.10  Aligned_cols=31  Identities=23%  Similarity=0.327  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.|+||.++..
T Consensus       120 ~~i~h~dl~p~ni~i~~-~~~~~l~d~g~~~~  150 (262)
T cd06613         120 TGKIHRDIKGANILLTE-DGDVKLADFGVSAQ  150 (262)
T ss_pred             CCceecCCChhhEEECC-CCCEEECccccchh
Confidence            46899999999999986 67899999988753


No 264
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=90.11  E-value=0.31  Score=44.32  Aligned_cols=30  Identities=20%  Similarity=0.355  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++. ++.+.|+||..+.
T Consensus       118 ~~i~H~dl~~~nil~~~-~~~~~l~dfg~~~  147 (284)
T cd07839         118 HNVLHRDLKPQNLLINK-NGELKLADFGLAR  147 (284)
T ss_pred             CCEecCCCCHHHEEEcC-CCcEEECccchhh
Confidence            36899999999999986 6789999998775


No 265
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=90.06  E-value=0.35  Score=43.01  Aligned_cols=31  Identities=26%  Similarity=0.241  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ .+.+.++||..+..
T Consensus       120 ~~i~h~dl~~~nili~~-~~~~~l~df~~~~~  150 (256)
T cd08529         120 KKILHRDIKSLNLFLDA-YDNVKIGDLGVAKL  150 (256)
T ss_pred             CCcccCCCCcceEEEeC-CCCEEEccccccee
Confidence            47899999999999986 67899999987663


No 266
>PTZ00284 protein kinase; Provisional
Probab=89.95  E-value=0.3  Score=48.82  Aligned_cols=31  Identities=23%  Similarity=0.349  Sum_probs=24.2

Q ss_pred             eeeeecCCCCCCeeeeCCCC---------------eEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETED---------------KVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~---------------~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++..+.               .+.|+||..+.
T Consensus       251 ~gIiHrDlKP~NILl~~~~~~~~~~~~~~~~~~~~~vkl~DfG~~~  296 (467)
T PTZ00284        251 LHLMHTDLKPENILMETSDTVVDPVTNRALPPDPCRVRICDLGGCC  296 (467)
T ss_pred             CCeecCCCCHHHEEEecCCcccccccccccCCCCceEEECCCCccc
Confidence            46899999999999975221               48899998654


No 267
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=89.94  E-value=0.15  Score=48.13  Aligned_cols=30  Identities=23%  Similarity=0.375  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+.
T Consensus       120 ~~ivHrDikp~Nill~~-~~~ikL~Dfg~~~  149 (323)
T cd05615         120 RGIIYRDLKLDNVMLDS-EGHIKIADFGMCK  149 (323)
T ss_pred             CCeeccCCCHHHeEECC-CCCEEEecccccc
Confidence            46899999999999986 6789999998765


No 268
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=89.90  E-value=0.38  Score=43.57  Aligned_cols=30  Identities=23%  Similarity=0.254  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|.||+++. .+.+.|+||..+.
T Consensus       141 ~~i~h~dlkp~nili~~-~~~~kl~d~g~~~  170 (280)
T cd05049         141 QHFVHRDLATRNCLVGY-DLVVKIGDFGMSR  170 (280)
T ss_pred             CCeeccccccceEEEcC-CCeEEECCcccce
Confidence            35899999999999976 5889999998775


No 269
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=89.88  E-value=0.34  Score=44.04  Aligned_cols=31  Identities=26%  Similarity=0.291  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       143 ~~i~H~dlkp~Nil~~~-~~~~~L~dfg~~~~  173 (283)
T cd05048         143 HHFVHRDLAARNCLVGE-GLTVKISDFGLSRD  173 (283)
T ss_pred             CCeeccccccceEEEcC-CCcEEECCCcceee
Confidence            35899999999999976 57899999987753


No 270
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=89.87  E-value=0.44  Score=43.93  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.++||..+.
T Consensus       149 ~~i~H~dlkp~Nili~~-~~~~~l~dfg~~~  178 (296)
T cd05095         149 LNFVHRDLATRNCLVGK-NYTIKIADFGMSR  178 (296)
T ss_pred             CCeecccCChheEEEcC-CCCEEeccCcccc
Confidence            35899999999999976 6789999998876


No 271
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=89.86  E-value=0.16  Score=46.30  Aligned_cols=31  Identities=23%  Similarity=0.315  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.++||..+..
T Consensus       143 ~~i~H~dlkp~nili~~-~~~~kl~dfg~~~~  173 (286)
T cd06638         143 NKTIHRDVKGNNILLTT-EGGVKLVDFGVSAQ  173 (286)
T ss_pred             CCccccCCCHHhEEECC-CCCEEEccCCceee
Confidence            36899999999999976 57799999998753


No 272
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=89.85  E-value=0.33  Score=44.77  Aligned_cols=31  Identities=19%  Similarity=0.338  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       148 ~~i~H~dlkp~Nill~~-~~~~kl~dfg~~~~  178 (295)
T cd05097         148 LNFVHRDLATRNCLVGN-HYTIKIADFGMSRN  178 (295)
T ss_pred             cCeeccccChhhEEEcC-CCcEEecccccccc
Confidence            46799999999999976 57899999987753


No 273
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=89.79  E-value=0.17  Score=46.25  Aligned_cols=31  Identities=19%  Similarity=0.368  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.++||..+..
T Consensus       119 ~~i~H~dlkp~Nill~~-~~~~kl~Dfg~~~~  149 (287)
T cd07848         119 NDIVHRDIKPENLLISH-NDVLKLCDFGFARN  149 (287)
T ss_pred             CCeecCCCCHHHEEEcC-CCcEEEeeccCccc
Confidence            45899999999999976 67899999988764


No 274
>KOG0616|consensus
Probab=89.77  E-value=0.45  Score=45.96  Aligned_cols=45  Identities=16%  Similarity=0.247  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          26 LQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        26 L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+|+-..-+.|.+    .-+..+||+|.|||+|. +|-|.++||-+|-.
T Consensus       149 YAAeivlAleylH~----~~iiYRDLKPENiLlD~-~G~iKitDFGFAK~  193 (355)
T KOG0616|consen  149 YAAEIVLALEYLHS----LDIIYRDLKPENLLLDQ-NGHIKITDFGFAKR  193 (355)
T ss_pred             HHHHHHHHHHHHHh----cCeeeccCChHHeeecc-CCcEEEEeccceEE
Confidence            34455554555544    56889999999999987 78999999988864


No 275
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=89.77  E-value=0.35  Score=44.93  Aligned_cols=30  Identities=20%  Similarity=0.426  Sum_probs=26.2

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+.+.||++++ .+.+.|+||.++..
T Consensus       128 ~i~H~dl~p~nil~~~-~~~~kL~dfg~~~~  157 (309)
T cd07845         128 FIIHRDLKVSNLLLTD-KGCLKIADFGLART  157 (309)
T ss_pred             CeecCCCCHHHEEECC-CCCEEECccceeee
Confidence            4899999999999976 67899999988764


No 276
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=89.73  E-value=0.39  Score=44.49  Aligned_cols=31  Identities=19%  Similarity=0.313  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++++||+++. ++.+.+.||..+..
T Consensus       120 ~~ivH~dlk~~Nili~~-~~~~kl~d~~~~~~  150 (314)
T cd08216         120 KGFIHRSVKASHILLSG-DGKVVLSGLRYSVS  150 (314)
T ss_pred             CCeecCCCCcceEEEec-CCceEEecCcccee
Confidence            35899999999999986 67899999987653


No 277
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=89.73  E-value=0.34  Score=43.69  Aligned_cols=31  Identities=23%  Similarity=0.289  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. .+.+.|+||.++..
T Consensus       125 ~~i~H~dl~p~nil~~~-~~~~~l~Dfg~~~~  155 (265)
T cd06652         125 NMIVHRDIKGANILRDS-VGNVKLGDFGASKR  155 (265)
T ss_pred             CCEecCCCCHHHEEecC-CCCEEECcCccccc
Confidence            34899999999999976 67899999987763


No 278
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=89.72  E-value=0.5  Score=43.10  Aligned_cols=32  Identities=31%  Similarity=0.648  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++.+.+.+.++||..+..
T Consensus       128 ~~i~H~dl~p~nil~~~~~~~~~l~dfg~~~~  159 (267)
T PHA03390        128 HNIIHNDIKLENVLYDRAKDRIYLCDYGLCKI  159 (267)
T ss_pred             CCeeeCCCCHHHEEEeCCCCeEEEecCcccee
Confidence            35899999999999987433899999987753


No 279
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=89.69  E-value=0.19  Score=45.87  Aligned_cols=31  Identities=29%  Similarity=0.492  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       127 ~~i~H~dlkp~nili~~-~~~~~l~dfg~~~~  157 (284)
T cd05081         127 KRYVHRDLATRNILVES-ENRVKIGDFGLTKV  157 (284)
T ss_pred             CCceeccCCHhhEEECC-CCeEEECCCccccc
Confidence            35899999999999976 67899999987764


No 280
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=89.67  E-value=0.39  Score=44.54  Aligned_cols=32  Identities=25%  Similarity=0.308  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeC---CCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDE---TEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~---~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++..   ..+.+.|+||..|..
T Consensus       127 ~~ivH~Dlkp~Nil~~~~~~~~~~~kl~DfG~a~~  161 (317)
T cd07867         127 NWVLHRDLKPANILVMGEGPERGRVKIADMGFARL  161 (317)
T ss_pred             CCEEcCCCCHHHEEEccCCCCCCcEEEeeccceec
Confidence            35899999999999842   246799999998863


No 281
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=89.63  E-value=0.52  Score=42.90  Aligned_cols=32  Identities=25%  Similarity=0.407  Sum_probs=27.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|++++||++++ ++.+.++||.++..
T Consensus       119 ~~~i~h~dl~p~Ni~i~~-~~~~~l~dfg~~~~  150 (277)
T cd06641         119 SEKKIHRDIKAANVLLSE-HGEVKLADFGVAGQ  150 (277)
T ss_pred             cCCeecCCCCHHhEEECC-CCCEEEeeccccee
Confidence            457899999999999976 67899999998764


No 282
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=89.62  E-value=0.39  Score=43.90  Aligned_cols=30  Identities=23%  Similarity=0.467  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|.||+++. ++.+.++||.++.
T Consensus       135 ~gi~H~dl~p~ni~i~~-~~~~~l~d~~~~~  164 (286)
T cd06614         135 QNVIHRDIKSDNILLSK-DGSVKLADFGFAA  164 (286)
T ss_pred             CCeeeCCCChhhEEEcC-CCCEEECccchhh
Confidence            56899999999999986 6789999998765


No 283
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=89.61  E-value=0.34  Score=41.74  Aligned_cols=32  Identities=25%  Similarity=0.284  Sum_probs=27.8

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      .++|+|+.+.||+++. ++.+.++||+.+....
T Consensus       118 ~i~h~di~~~ni~v~~-~~~~~l~d~g~~~~~~  149 (225)
T smart00221      118 GIVHRDLKPENILLGM-DGLVKLADFGLARFIH  149 (225)
T ss_pred             CeecCCCCHHHEEEcC-CCCEEEeeCceeeEec
Confidence            8899999999999986 5889999998777543


No 284
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=89.60  E-value=0.42  Score=43.19  Aligned_cols=30  Identities=20%  Similarity=0.344  Sum_probs=25.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.||+++. .+.+.++||..+.
T Consensus       114 ~~i~H~dlkp~nil~~~-~~~~kl~dfg~~~  143 (257)
T cd05115         114 KNFVHRDLAARNVLLVN-QHYAKISDFGLSK  143 (257)
T ss_pred             cCeeecccchheEEEcC-CCcEEeccCCccc
Confidence            45899999999999976 5779999998765


No 285
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=89.58  E-value=0.21  Score=44.91  Aligned_cols=30  Identities=27%  Similarity=0.366  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+.|+|++|.||++++ .+.+.++||..+.
T Consensus       132 ~~i~H~dlkp~Nil~~~-~~~~kl~dfg~~~  161 (273)
T cd05035         132 RNFIHRDLAARNCMLRE-DMTVCVADFGLSK  161 (273)
T ss_pred             CCeeccccchheEEECC-CCeEEECCcccee
Confidence            46899999999999976 5789999998765


No 286
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=89.57  E-value=0.25  Score=45.85  Aligned_cols=31  Identities=19%  Similarity=0.379  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||+|.||+++. ++.+.++||.++..
T Consensus       135 ~gi~H~dLkp~Nill~~-~~~~kl~dfg~~~~  165 (296)
T cd06654         135 NQVIHRDIKSDNILLGM-DGSVKLTDFGFCAQ  165 (296)
T ss_pred             CCcccCCCCHHHEEEcC-CCCEEECccccchh
Confidence            35899999999999976 57899999998764


No 287
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=89.55  E-value=0.26  Score=45.82  Aligned_cols=31  Identities=16%  Similarity=0.369  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.||+++. ++.+.++||..+..
T Consensus       134 ~~i~H~dL~p~Nili~~-~~~~kl~dfg~~~~  164 (296)
T cd06655         134 NQVIHRDIKSDNVLLGM-DGSVKLTDFGFCAQ  164 (296)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEccCccchh
Confidence            35789999999999976 67899999987663


No 288
>KOG1163|consensus
Probab=89.53  E-value=0.51  Score=44.64  Aligned_cols=38  Identities=26%  Similarity=0.346  Sum_probs=28.8

Q ss_pred             CeeeeecCCCCCCeeee--CCCCeEEEEeeccccCCchhhhHH
Q psy8745          43 PVVFCHNDLLLGNIIYD--ETEDKVTFIDYEYAGVNYQAFDIA   83 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~--~~~~~l~lIDfEya~~n~~~fDiA   83 (317)
                      ...|.|+|++|.|+|..  -..+++++|||-.|.   ..+|+-
T Consensus       129 ~r~fiHRDIKPdNFLMGlgrh~~kl~LIDFGLaK---ky~d~~  168 (341)
T KOG1163|consen  129 LRNFIHRDIKPDNFLMGLGRHCNKLYLIDFGLAK---KYRDIR  168 (341)
T ss_pred             hhccccccCCccceeeccccccceEEEEeccchh---hhcccc
Confidence            35899999999999984  224689999996554   556654


No 289
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=89.52  E-value=0.34  Score=43.60  Aligned_cols=30  Identities=23%  Similarity=0.303  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.++||..+.
T Consensus       121 ~~i~H~dl~p~ni~i~~-~~~~~l~d~~~~~  150 (260)
T cd05073         121 RNYIHRDLRAANILVSA-SLVCKIADFGLAR  150 (260)
T ss_pred             CCccccccCcceEEEcC-CCcEEECCCccee
Confidence            35799999999999976 6789999998775


No 290
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=89.52  E-value=0.17  Score=47.73  Aligned_cols=31  Identities=23%  Similarity=0.357  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.++||..+..
T Consensus       115 ~~ivHrdikp~Nil~~~-~~~~kl~Dfg~~~~  145 (316)
T cd05619         115 KGIVYRDLKLDNILLDT-DGHIKIADFGMCKE  145 (316)
T ss_pred             CCeEeCCCCHHHEEECC-CCCEEEccCCcceE
Confidence            46899999999999986 67899999987753


No 291
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=89.50  E-value=0.52  Score=41.76  Aligned_cols=33  Identities=27%  Similarity=0.223  Sum_probs=27.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++|+|+++.||++++ ++.+.|+||..+...
T Consensus       121 ~~~i~h~~l~~~ni~~~~-~~~~kl~d~g~~~~~  153 (256)
T cd08530         121 EQKILHRDLKSANILLVA-NDLVKIGDLGISKVL  153 (256)
T ss_pred             hCCcccCCCCcceEEEec-CCcEEEeeccchhhh
Confidence            346799999999999987 678999999877543


No 292
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=89.46  E-value=0.45  Score=43.41  Aligned_cols=31  Identities=29%  Similarity=0.366  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ .+.+.++||..+..
T Consensus       143 ~~i~H~dlkp~nili~~-~~~~kl~dfg~~~~  173 (283)
T cd05090         143 HFFVHKDLAARNILIGE-QLHVKISDLGLSRE  173 (283)
T ss_pred             cCeehhccccceEEEcC-CCcEEecccccccc
Confidence            35899999999999986 57799999987754


No 293
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=89.44  E-value=0.37  Score=43.32  Aligned_cols=31  Identities=29%  Similarity=0.353  Sum_probs=25.4

Q ss_pred             eeeeecCCCCCCeeeeCCCC-----eEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETED-----KVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~-----~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||+++. .+     .+.++||.++..
T Consensus       125 ~~i~H~dl~p~nil~~~-~~~~~~~~~~l~dfg~~~~  160 (269)
T cd05044         125 MHFIHRDLAARNCLVSE-KGYDADRVVKIGDFGLARD  160 (269)
T ss_pred             CCcccCCCChheEEEec-CCCCCCcceEECCcccccc
Confidence            35899999999999976 33     689999988753


No 294
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=89.43  E-value=0.42  Score=42.78  Aligned_cols=32  Identities=19%  Similarity=0.299  Sum_probs=27.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.|+||..+...
T Consensus       132 ~~i~H~~l~p~ni~~~~-~~~~~l~d~~~~~~~  163 (275)
T cd06608         132 NKVIHRDIKGQNILLTK-NAEVKLVDFGVSAQL  163 (275)
T ss_pred             CCcccCCCCHHHEEEcc-CCeEEECCCccceec
Confidence            46899999999999986 678999999887643


No 295
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=89.43  E-value=0.4  Score=43.11  Aligned_cols=32  Identities=16%  Similarity=0.163  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|+.+.||+++. .+.+.++||..+..
T Consensus       124 ~~~i~H~dl~~~nil~~~-~~~~~l~d~g~~~~  155 (267)
T cd08228         124 SRRVMHRDIKPANVFITA-TGVVKLGDLGLGRF  155 (267)
T ss_pred             hCCeeCCCCCHHHEEEcC-CCCEEECcccccee
Confidence            347899999999999976 57899999987764


No 296
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=89.41  E-value=0.37  Score=43.25  Aligned_cols=33  Identities=21%  Similarity=0.288  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+++.||+++.++..+.++||..+...
T Consensus       122 ~~i~H~~i~~~nil~~~~~~~~~l~dfg~~~~~  154 (268)
T cd06630         122 NQIIHRDVKGANLLIDSTGQRLRIADFGAAARL  154 (268)
T ss_pred             CCeecCCCCHHHEEEcCCCCEEEEccccccccc
Confidence            468999999999999764456899999887543


No 297
>PHA03211 serine/threonine kinase US3; Provisional
Probab=89.41  E-value=0.39  Score=48.68  Aligned_cols=31  Identities=16%  Similarity=0.264  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||++.|||++. .+.+.|+||..+..
T Consensus       279 ~gIvHrDLKP~NILl~~-~~~vkL~DFGla~~  309 (461)
T PHA03211        279 EGIIHRDIKTENVLVNG-PEDICLGDFGAACF  309 (461)
T ss_pred             CCEEECcCCHHHEEECC-CCCEEEcccCCcee
Confidence            35899999999999976 67899999988753


No 298
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=89.41  E-value=0.32  Score=43.51  Aligned_cols=29  Identities=17%  Similarity=0.224  Sum_probs=25.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ..++|+|++|.||++++ ++.+.++||..+
T Consensus       104 ~~i~H~dlkp~Nil~~~-~~~~~l~df~~~  132 (237)
T cd05576         104 EGIVCRDLNPNNILLDD-RGHIQLTYFSRW  132 (237)
T ss_pred             CCeeccCCCHHHEEEcC-CCCEEEecccch
Confidence            46899999999999986 678999998754


No 299
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=89.30  E-value=0.58  Score=42.78  Aligned_cols=31  Identities=19%  Similarity=0.243  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||+++.+.+.+.+.||..+.
T Consensus       129 ~~i~H~dl~~~nil~~~~~~~~kl~dfg~~~  159 (295)
T cd07837         129 HGVMHRDLKPQNLLVDKQKGLLKIADLGLGR  159 (295)
T ss_pred             CCeeecCCChHHEEEecCCCeEEEeecccce
Confidence            4689999999999998646789999998765


No 300
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=89.30  E-value=0.27  Score=45.69  Aligned_cols=31  Identities=23%  Similarity=0.336  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.++||..+..
T Consensus       159 ~gi~H~dlkp~Nill~~-~~~~kL~dfg~a~~  189 (307)
T cd05098         159 KKCIHRDLAARNVLVTE-DNVMKIADFGLARD  189 (307)
T ss_pred             CCcccccccHHheEEcC-CCcEEECCCccccc
Confidence            47899999999999986 57899999987753


No 301
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=89.23  E-value=0.21  Score=46.41  Aligned_cols=31  Identities=16%  Similarity=0.341  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. .+.+.++||..+..
T Consensus       120 ~~i~H~dl~p~NIll~~-~~~~~l~dfg~~~~  150 (305)
T cd05609         120 YGIVHRDLKPDNLLITS-MGHIKLTDFGLSKI  150 (305)
T ss_pred             CCccccCCchHHEEECC-CCCEEEeeCCCccc
Confidence            35899999999999976 67899999998764


No 302
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=89.21  E-value=0.2  Score=45.99  Aligned_cols=30  Identities=20%  Similarity=0.269  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.|+||..+.
T Consensus       122 ~~i~H~dlkp~Nil~~~-~~~~~l~Dfg~~~  151 (291)
T cd07870         122 QHILHRDLKPQNLLISY-LGELKLADFGLAR  151 (291)
T ss_pred             CCcccCCCChHHEEEcC-CCcEEEecccccc
Confidence            35899999999999976 6789999998775


No 303
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=89.21  E-value=0.53  Score=42.56  Aligned_cols=30  Identities=30%  Similarity=0.386  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.++||..+.
T Consensus       119 ~~i~H~dlkp~nil~~~-~~~~kL~dfg~~~  148 (269)
T cd05087         119 NNFIHSDLALRNCLLTA-DLTVKIGDYGLSH  148 (269)
T ss_pred             CCEeccccCcceEEEcC-CCcEEECCccccc
Confidence            45899999999999976 6789999998774


No 304
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=89.18  E-value=0.45  Score=42.88  Aligned_cols=30  Identities=27%  Similarity=0.377  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.++||..+.
T Consensus       132 ~~i~H~dikp~nili~~-~~~~kl~dfg~~~  161 (273)
T cd05074         132 KNFIHRDLAARNCMLNE-NMTVCVADFGLSK  161 (273)
T ss_pred             CCEeecccchhhEEEcC-CCCEEECcccccc
Confidence            35899999999999976 6789999998766


No 305
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=89.16  E-value=0.35  Score=44.26  Aligned_cols=30  Identities=27%  Similarity=0.356  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.++||-++.
T Consensus       149 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~  178 (288)
T cd05050         149 RKFVHRDLATRNCLVGE-NMVVKIADFGLSR  178 (288)
T ss_pred             CCeecccccHhheEecC-CCceEECccccce
Confidence            47999999999999976 6789999997764


No 306
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=89.15  E-value=0.44  Score=44.14  Aligned_cols=30  Identities=23%  Similarity=0.361  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ .+.+.++||..+.
T Consensus       156 ~givH~dlkp~Nili~~-~~~~kl~D~g~~~  185 (304)
T cd05101         156 QKCIHRDLAARNVLVTE-NNVMKIADFGLAR  185 (304)
T ss_pred             CCeeecccccceEEEcC-CCcEEECCCccce
Confidence            36899999999999976 5789999998775


No 307
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=89.15  E-value=0.2  Score=46.13  Aligned_cols=31  Identities=23%  Similarity=0.194  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.++||..+..
T Consensus       121 ~~ivH~dlkp~Nil~~~-~~~~~l~Dfg~~~~  151 (285)
T cd05605         121 ERIVYRDLKPENILLDD-YGHIRISDLGLAVE  151 (285)
T ss_pred             CCcEecCCCHHHEEECC-CCCEEEeeCCCcee
Confidence            35899999999999976 57899999987764


No 308
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=89.14  E-value=0.33  Score=45.64  Aligned_cols=31  Identities=23%  Similarity=0.345  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.|+||.++..
T Consensus       115 ~~ivH~dlkp~Nill~~-~~~~kl~Dfg~~~~  145 (318)
T cd05570         115 RGIIYRDLKLDNVLLDS-EGHIKIADFGMCKE  145 (318)
T ss_pred             CCeEccCCCHHHeEECC-CCcEEecccCCCee
Confidence            46899999999999986 67899999988753


No 309
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=89.11  E-value=0.37  Score=43.22  Aligned_cols=31  Identities=26%  Similarity=0.365  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.++||..+..
T Consensus       122 ~~i~H~dl~p~nili~~-~~~~~l~dfg~~~~  152 (261)
T cd05072         122 KNYIHRDLRAANVLVSE-SLMCKIADFGLARV  152 (261)
T ss_pred             CCeeccccchhhEEecC-CCcEEECCCcccee
Confidence            35799999999999986 57899999998864


No 310
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=89.09  E-value=0.37  Score=44.14  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.+.||.++.
T Consensus       149 ~~i~H~dlkp~Nili~~-~~~~~l~dfg~~~  178 (296)
T cd05051         149 LNFVHRDLATRNCLVGK-NYTIKIADFGMSR  178 (296)
T ss_pred             cCccccccchhceeecC-CCceEEcccccee
Confidence            45799999999999986 5789999998765


No 311
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=89.07  E-value=0.41  Score=42.97  Aligned_cols=32  Identities=22%  Similarity=0.300  Sum_probs=27.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+...
T Consensus       112 ~~~~h~dl~~~nilv~~-~~~~~l~df~~~~~~  143 (262)
T cd05572         112 RGIIYRDLKPENLLLDS-NGYVKLVDFGFAKKL  143 (262)
T ss_pred             CCcccCCCCHHHEEEcC-CCCEEEeeCCccccc
Confidence            56899999999999976 678999999887643


No 312
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=89.04  E-value=0.16  Score=45.84  Aligned_cols=30  Identities=20%  Similarity=0.393  Sum_probs=26.0

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+++.||++++ ++.+.++||..+..
T Consensus       131 ~ivh~dl~~~nili~~-~~~~~l~Dfg~~~~  160 (272)
T cd06637         131 KVIHRDIKGQNVLLTE-NAEVKLVDFGVSAQ  160 (272)
T ss_pred             CCccCCCCHHHEEECC-CCCEEEccCCCcee
Confidence            5899999999999986 57899999988753


No 313
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=89.00  E-value=0.46  Score=42.67  Aligned_cols=32  Identities=25%  Similarity=0.299  Sum_probs=27.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|.||++++ ++.+.++||..+...
T Consensus       121 ~~i~H~dl~p~ni~i~~-~~~~~l~dfg~~~~~  152 (260)
T cd05067         121 KNYIHRDLRAANILVSE-TLCCKIADFGLARLI  152 (260)
T ss_pred             CCeecccccHHhEEEcC-CCCEEEccCcceeec
Confidence            45899999999999986 578999999888653


No 314
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=88.99  E-value=0.58  Score=42.43  Aligned_cols=33  Identities=21%  Similarity=0.306  Sum_probs=28.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ..++|+|+.+.||++++ ++.+.|+||..+..-.
T Consensus       119 ~~i~H~dl~~~ni~~~~-~~~~kl~d~g~~~~~~  151 (288)
T cd07833         119 HNIIHRDIKPENILVSE-SGVLKLCDFGFARALR  151 (288)
T ss_pred             CCeecCCCCHHHeEECC-CCCEEEEeeecccccC
Confidence            35899999999999986 6889999998877543


No 315
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=88.94  E-value=0.43  Score=43.16  Aligned_cols=31  Identities=26%  Similarity=0.325  Sum_probs=26.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...++|+|+.|.||++++ ++.+.++||.++.
T Consensus       137 ~~~i~H~di~p~nill~~-~~~~kl~dfg~~~  167 (277)
T cd05032         137 AKKFVHRDLAARNCMVAE-DLTVKIGDFGMTR  167 (277)
T ss_pred             hCCccccccChheEEEcC-CCCEEECCcccch
Confidence            346899999999999986 6789999998764


No 316
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=88.90  E-value=0.67  Score=44.99  Aligned_cols=30  Identities=17%  Similarity=0.265  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ .+.+.|+||..+.
T Consensus       231 ~giiHrDLkp~Nil~~~-~~~~kL~DfGla~  260 (374)
T cd05106         231 KNCIHRDVAARNVLLTD-GRVAKICDFGLAR  260 (374)
T ss_pred             CCEEeccCchheEEEeC-CCeEEEeeceeee
Confidence            35799999999999986 5789999998765


No 317
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=88.89  E-value=0.23  Score=44.56  Aligned_cols=30  Identities=33%  Similarity=0.420  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ .+.+.++||..+.
T Consensus       117 ~~i~H~dlk~~nili~~-~~~~kl~dfg~~~  146 (262)
T cd05058         117 KKFVHRDLAARNCMLDE-SFTVKVADFGLAR  146 (262)
T ss_pred             CCccccccCcceEEEcC-CCcEEECCccccc
Confidence            46899999999999976 5779999998775


No 318
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=88.88  E-value=0.46  Score=45.28  Aligned_cols=31  Identities=23%  Similarity=0.366  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       137 ~gi~H~dlkp~Nil~~~-~~~~kL~Dfg~~~~  167 (353)
T cd07850         137 AGIIHRDLKPSNIVVKS-DCTLKILDFGLART  167 (353)
T ss_pred             CCeeeCCCCHHHEEECC-CCCEEEccCcccee
Confidence            36899999999999986 67899999988764


No 319
>KOG0598|consensus
Probab=88.88  E-value=0.34  Score=47.51  Aligned_cols=39  Identities=21%  Similarity=0.272  Sum_probs=31.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHH
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIA   83 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiA   83 (317)
                      ..+.|+||+|.|||+|. +|.|.|=||-.|..+--.=|-.
T Consensus       144 ~gIiyRDlKPENILLd~-~GHi~LtDFgL~k~~~~~~~~t  182 (357)
T KOG0598|consen  144 KGIIYRDLKPENILLDE-QGHIKLTDFGLCKEDLKDGDAT  182 (357)
T ss_pred             CCeeeccCCHHHeeecC-CCcEEEeccccchhcccCCCcc
Confidence            67899999999999987 7999999998777544443333


No 320
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=88.86  E-value=0.42  Score=43.78  Aligned_cols=30  Identities=30%  Similarity=0.310  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+.
T Consensus       116 ~~i~H~di~p~nili~~-~~~~kl~dfg~~~  145 (278)
T cd05606         116 RFVVYRDLKPANILLDE-HGHVRISDLGLAC  145 (278)
T ss_pred             CCEEcCCCCHHHEEECC-CCCEEEccCcCcc
Confidence            45899999999999976 5789999998764


No 321
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=88.82  E-value=0.71  Score=41.66  Aligned_cols=32  Identities=19%  Similarity=0.281  Sum_probs=27.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+++.||++++ ++.+.++||..+...
T Consensus       127 ~~i~H~dl~~~nil~~~-~~~~~l~d~~~~~~~  158 (272)
T cd06629         127 KGILHRDLKADNLLVDA-DGICKISDFGISKKS  158 (272)
T ss_pred             CCeeecCCChhhEEEcC-CCeEEEeeccccccc
Confidence            46899999999999986 688999999888653


No 322
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=88.81  E-value=0.43  Score=43.73  Aligned_cols=31  Identities=23%  Similarity=0.347  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.++||..+..
T Consensus       147 ~~ivH~dlkp~nili~~-~~~~kl~dfg~~~~  177 (291)
T cd06639         147 NRIIHRDVKGNNILLTT-EGGVKLVDFGVSAQ  177 (291)
T ss_pred             CCeeccCCCHHHEEEcC-CCCEEEeecccchh
Confidence            46899999999999976 67899999987763


No 323
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=88.81  E-value=0.4  Score=42.80  Aligned_cols=32  Identities=25%  Similarity=0.394  Sum_probs=26.8

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|+.+.||++++ ++.+.|+||.++..
T Consensus       120 ~~~i~h~~l~p~ni~~~~-~~~~~l~df~~~~~  151 (267)
T cd06610         120 SNGQIHRDIKAGNILLGE-DGSVKIADFGVSAS  151 (267)
T ss_pred             hCCeecCCCCHHhEEEcC-CCCEEEcccchHHH
Confidence            346899999999999986 57899999987653


No 324
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=88.79  E-value=0.3  Score=44.53  Aligned_cols=31  Identities=23%  Similarity=0.460  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+.|+|+++.||+++. .+.+.++||..+..
T Consensus       122 ~~i~H~dlkp~nili~~-~~~~kl~dfg~~~~  152 (282)
T cd06643         122 NKIIHRDLKAGNILFTL-DGDIKLADFGVSAK  152 (282)
T ss_pred             CCeeecCCCcccEEEcc-CCCEEEcccccccc
Confidence            46899999999999976 67899999987754


No 325
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=88.78  E-value=0.42  Score=45.55  Aligned_cols=31  Identities=26%  Similarity=0.428  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ ++.+.++||..+..
T Consensus       137 ~gi~H~dlkp~Nill~~-~~~~kl~dfg~~~~  167 (343)
T cd07880         137 AGIIHRDLKPGNLAVNE-DCELKILDFGLARQ  167 (343)
T ss_pred             CCeecCCCCHHHEEEcC-CCCEEEeecccccc
Confidence            45899999999999986 67899999987763


No 326
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=88.77  E-value=0.5  Score=43.34  Aligned_cols=29  Identities=21%  Similarity=0.369  Sum_probs=25.5

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+.+.||++++ ++.+.++||.++.
T Consensus       126 ~i~H~dl~p~nili~~-~~~~~l~d~g~~~  154 (293)
T cd07843         126 WILHRDLKTSNLLLNN-RGILKICDFGLAR  154 (293)
T ss_pred             CeeeccCCHHHEEECC-CCcEEEeecCcee
Confidence            5899999999999986 6889999998765


No 327
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=88.77  E-value=0.33  Score=43.15  Aligned_cols=32  Identities=19%  Similarity=0.167  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||+++++...+.++||.++..
T Consensus       120 ~~i~H~dl~~~nil~~~~~~~~~l~d~~~~~~  151 (257)
T cd08225         120 RKILHRDIKSQNIFLSKNGMVAKLGDFGIARQ  151 (257)
T ss_pred             CCcccccCCHHHEEEcCCCCeEEecccccchh
Confidence            46899999999999986444578999988764


No 328
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=88.69  E-value=0.39  Score=45.40  Aligned_cols=30  Identities=20%  Similarity=0.361  Sum_probs=26.1

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+++.||++++ .+.+.++||..+..
T Consensus       126 ~ivH~dlkp~Nill~~-~~~~kl~dfg~~~~  155 (336)
T cd07849         126 NVLHRDLKPSNLLLNT-NCDLKICDFGLARI  155 (336)
T ss_pred             CeeccCCCHHHEEECC-CCCEEECcccceee
Confidence            5899999999999976 67899999987754


No 329
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=88.65  E-value=0.35  Score=43.88  Aligned_cols=31  Identities=23%  Similarity=0.356  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+..
T Consensus       120 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~  150 (285)
T cd07861         120 RRVLHRDLKPQNLLIDN-KGVIKLADFGLARA  150 (285)
T ss_pred             CCeeecCCCHHHEEEcC-CCcEEECcccceee
Confidence            46899999999999976 67899999988753


No 330
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=88.62  E-value=0.66  Score=41.95  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=26.1

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+++.||++++ ++.+.|+||..+..
T Consensus       127 ~i~h~~l~~~nili~~-~~~~~l~dfg~~~~  156 (287)
T cd07838         127 RIVHRDLKPQNILVTS-DGQVKIADFGLARI  156 (287)
T ss_pred             CeeeccCChhhEEEcc-CCCEEEeccCccee
Confidence            5899999999999987 58899999987754


No 331
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=88.60  E-value=0.29  Score=45.83  Aligned_cols=31  Identities=29%  Similarity=0.500  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||.+.||+++. ++.+.++||..+..
T Consensus       144 ~~i~H~dL~p~Nil~~~-~~~~kl~dfg~~~~  174 (317)
T cd06635         144 HNMIHRDIKAGNILLTE-PGQVKLADFGSASI  174 (317)
T ss_pred             CCcccCCCCcccEEECC-CCCEEEecCCCccc
Confidence            45799999999999976 67899999987754


No 332
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=88.59  E-value=0.4  Score=43.54  Aligned_cols=31  Identities=23%  Similarity=0.372  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+..
T Consensus       119 ~~i~h~~l~p~ni~~~~-~~~~~l~dfg~~~~  149 (286)
T cd07846         119 HNIIHRDIKPENILVSQ-SGVVKLCDFGFART  149 (286)
T ss_pred             CCccccCCCHHHEEECC-CCcEEEEeeeeeee
Confidence            46899999999999976 67899999987764


No 333
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=88.54  E-value=0.25  Score=45.14  Aligned_cols=30  Identities=17%  Similarity=0.366  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||++.||+++. ++.+.|+||..+.
T Consensus       114 ~~i~H~dlkp~Nill~~-~~~~~l~dfg~~~  143 (279)
T cd06619         114 LKILHRDVKPSNMLVNT-RGQVKLCDFGVST  143 (279)
T ss_pred             CCEeeCCCCHHHEEECC-CCCEEEeeCCcce
Confidence            46899999999999986 6889999998775


No 334
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=88.52  E-value=0.21  Score=44.99  Aligned_cols=31  Identities=23%  Similarity=0.294  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.++||++++ .+.+.++||..+..
T Consensus       125 ~~i~H~dl~p~nill~~-~~~~~l~dfg~~~~  155 (267)
T cd06646         125 KGKMHRDIKGANILLTD-NGDVKLADFGVAAK  155 (267)
T ss_pred             CCccccCCCHHHEEECC-CCCEEECcCcccee
Confidence            46899999999999976 57799999998863


No 335
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=88.48  E-value=0.31  Score=44.24  Aligned_cols=29  Identities=31%  Similarity=0.374  Sum_probs=25.0

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+++.|||++. ++.+.++||..+.
T Consensus       119 ~i~H~dikp~nil~~~-~~~~~l~Dfg~~~  147 (268)
T cd05086         119 NFLHSDLALRNCFLTS-DLTVKVGDYGIGP  147 (268)
T ss_pred             CeeccCCccceEEEcC-CccEEeccccccc
Confidence            4799999999999976 5789999998764


No 336
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=88.43  E-value=0.55  Score=42.19  Aligned_cols=30  Identities=20%  Similarity=0.331  Sum_probs=25.8

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+.|.||++++ .+.+.++||..+..
T Consensus       122 ~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~  151 (265)
T cd06631         122 CVVHRDIKGNNVMLMP-NGIIKLIDFGCARR  151 (265)
T ss_pred             CcccCCcCHHhEEECC-CCeEEeccchhhHh
Confidence            4789999999999976 68899999987663


No 337
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=88.42  E-value=0.23  Score=44.60  Aligned_cols=31  Identities=16%  Similarity=0.164  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||+++. ++.+.++||..+..
T Consensus       125 ~~i~H~dl~p~nili~~-~~~~~l~dfg~~~~  155 (267)
T cd08229         125 RRVMHRDIKPANVFITA-TGVVKLGDLGLGRF  155 (267)
T ss_pred             CCeecCCCCHHHEEEcC-CCCEEECcchhhhc
Confidence            46899999999999976 67899999987653


No 338
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=88.42  E-value=0.26  Score=45.49  Aligned_cols=31  Identities=23%  Similarity=0.227  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ .+.+.++||..+..
T Consensus       121 ~~iiH~dikp~Nil~~~-~~~~~l~Dfg~~~~  151 (285)
T cd05630         121 ERIVYRDLKPENILLDD-HGHIRISDLGLAVH  151 (285)
T ss_pred             CCEEeCCCCHHHEEECC-CCCEEEeeccceee
Confidence            46889999999999986 57899999987753


No 339
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=88.32  E-value=0.51  Score=42.76  Aligned_cols=32  Identities=19%  Similarity=0.372  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..+.|+|+++.||++++ ++.+.++||.++..-
T Consensus       119 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~~  150 (286)
T cd07847         119 HNCIHRDVKPENILITK-QGQIKLCDFGFARIL  150 (286)
T ss_pred             CCceecCCChhhEEEcC-CCcEEECccccceec
Confidence            45789999999999976 578999999887653


No 340
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=88.30  E-value=0.29  Score=43.83  Aligned_cols=31  Identities=16%  Similarity=0.177  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||+++. ++.+.++||..+..
T Consensus       125 ~~i~h~dl~p~nil~~~-~~~~~l~d~~~~~~  155 (267)
T cd08224         125 KRIMHRDIKPANVFITA-TGVVKLGDLGLGRF  155 (267)
T ss_pred             CCEecCCcChhhEEECC-CCcEEEeccceeee
Confidence            47899999999999976 67899999987653


No 341
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=88.24  E-value=0.38  Score=44.69  Aligned_cols=30  Identities=17%  Similarity=0.405  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||.++.
T Consensus       135 ~givH~dl~p~Nilv~~-~~~~~l~dfg~~~  164 (292)
T cd06657         135 QGVIHRDIKSDSILLTH-DGRVKLSDFGFCA  164 (292)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEcccccce
Confidence            35899999999999986 5789999999765


No 342
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=88.20  E-value=0.44  Score=43.21  Aligned_cols=30  Identities=20%  Similarity=0.349  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ .+.+.++||.++.
T Consensus       119 ~~i~h~dl~p~ni~~~~-~~~~~l~d~g~~~  148 (284)
T cd07836         119 NRVLHRDLKPQNLLINK-RGELKLADFGLAR  148 (284)
T ss_pred             CCeeeCCCCHHHEEECC-CCcEEEeecchhh
Confidence            46899999999999976 6789999998774


No 343
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=88.18  E-value=0.51  Score=43.72  Aligned_cols=29  Identities=14%  Similarity=0.430  Sum_probs=25.4

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+.+.||++++ ++.+.++||..+.
T Consensus       138 ~ivH~dlkp~Nill~~-~~~~kL~dfg~~~  166 (292)
T cd06658         138 GVIHRDIKSDSILLTS-DGRIKLSDFGFCA  166 (292)
T ss_pred             CEeecCCCHHHEEEcC-CCCEEEccCcchh
Confidence            5789999999999976 5789999998765


No 344
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=88.16  E-value=0.57  Score=41.78  Aligned_cols=31  Identities=23%  Similarity=0.336  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. ++.+.++||.++..
T Consensus       120 ~~i~h~~l~~~nil~~~-~~~~~l~d~~~~~~  150 (256)
T cd08218         120 RKILHRDIKSQNIFLTK-DGTIKLGDFGIARV  150 (256)
T ss_pred             CCEecCCCCHHHEEEcC-CCCEEEeeccceee
Confidence            46899999999999976 67899999988764


No 345
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=88.15  E-value=0.21  Score=45.68  Aligned_cols=30  Identities=23%  Similarity=0.359  Sum_probs=26.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+.
T Consensus       122 ~~i~H~dl~p~nil~~~-~~~~kl~dfg~~~  151 (291)
T cd07844         122 RRVLHRDLKPQNLLISE-RGELKLADFGLAR  151 (291)
T ss_pred             CCeecccCCHHHEEEcC-CCCEEECcccccc
Confidence            35899999999999976 6789999998764


No 346
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=88.12  E-value=0.55  Score=42.77  Aligned_cols=30  Identities=27%  Similarity=0.453  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|+||++++ .+.+.++||..+.
T Consensus       120 ~~ivH~dl~p~Nil~~~-~~~~~l~dfg~~~  149 (277)
T cd06640         120 EKKIHRDIKAANVLLSE-QGDVKLADFGVAG  149 (277)
T ss_pred             CCccCcCCChhhEEEcC-CCCEEEcccccce
Confidence            46789999999999986 6789999998775


No 347
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=88.08  E-value=0.31  Score=43.34  Aligned_cols=31  Identities=29%  Similarity=0.494  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.|.||..+..
T Consensus       118 ~~i~H~dl~~~ni~~~~-~~~~~l~dfg~~~~  148 (256)
T cd06612         118 NKKIHRDIKAGNILLNE-EGQAKLADFGVSGQ  148 (256)
T ss_pred             CCcccCCCCcceEEECC-CCcEEEcccccchh
Confidence            35799999999999986 57899999987664


No 348
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=88.08  E-value=0.3  Score=46.07  Aligned_cols=30  Identities=23%  Similarity=0.381  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|.||++++ ++.+.|+||.++.
T Consensus       153 ~givH~dlkp~Nill~~-~~~~kL~Dfg~~~  182 (334)
T cd05100         153 QKCIHRDLAARNVLVTE-DNVMKIADFGLAR  182 (334)
T ss_pred             CCeeccccccceEEEcC-CCcEEECCcccce
Confidence            46899999999999976 5789999998775


No 349
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=88.07  E-value=0.23  Score=44.77  Aligned_cols=29  Identities=21%  Similarity=0.339  Sum_probs=25.4

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|++|.||+++. .+.+.++||..+.
T Consensus       126 ~i~H~dlkp~nili~~-~~~~~l~dfg~~~  154 (267)
T cd06645         126 GKMHRDIKGANILLTD-NGHVKLADFGVSA  154 (267)
T ss_pred             CeecCCCCHHHEEECC-CCCEEECcceeee
Confidence            5899999999999976 6789999998765


No 350
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=88.06  E-value=0.3  Score=45.35  Aligned_cols=31  Identities=23%  Similarity=0.402  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++|.||++++ .+.+.|+||..+..
T Consensus       128 ~~ivH~dikp~Nill~~-~~~~kL~Dfg~~~~  158 (303)
T cd05110         128 RRLVHRDLAARNVLVKS-PNHVKITDFGLARL  158 (303)
T ss_pred             cCeeccccccceeeecC-CCceEEcccccccc
Confidence            45799999999999975 57899999987764


No 351
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=88.02  E-value=0.46  Score=43.16  Aligned_cols=30  Identities=27%  Similarity=0.388  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++. .+.+.++||..+.
T Consensus       118 ~~~~H~dl~p~nil~~~-~~~~~l~df~~~~  147 (283)
T cd07835         118 HRVLHRDLKPQNLLIDR-EGALKLADFGLAR  147 (283)
T ss_pred             CCeeCCCCCHHHEEEcC-CCcEEEeeccccc
Confidence            46899999999999987 6889999998875


No 352
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=88.01  E-value=0.4  Score=45.69  Aligned_cols=32  Identities=28%  Similarity=0.349  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|++|.||++++ .+.+.++||..+..
T Consensus       197 ~~~i~H~dikp~Nil~~~-~~~~kl~dfg~~~~  228 (343)
T cd05103         197 SRKCIHRDLAARNILLSE-NNVVKICDFGLARD  228 (343)
T ss_pred             hCCeecCCCccCeEEEcC-CCcEEEEecccccc
Confidence            357899999999999986 67899999987753


No 353
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=88.01  E-value=0.44  Score=43.16  Aligned_cols=31  Identities=26%  Similarity=0.413  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ .+.+.++||.++..
T Consensus       120 ~~i~H~dl~p~ni~i~~-~~~~~l~dfg~~~~  150 (277)
T cd06917         120 VGVIHRDIKAANILVTN-TGNVKLCDFGVAAL  150 (277)
T ss_pred             CCcccCCcCHHHEEEcC-CCCEEEccCCceee
Confidence            46899999999999986 68899999987753


No 354
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=88.00  E-value=0.29  Score=49.86  Aligned_cols=30  Identities=20%  Similarity=0.318  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||+++ ++.+.|+||-.+.
T Consensus       162 ~~IiHrDLKP~NILl~~-~~~vkL~DFGls~  191 (496)
T PTZ00283        162 KHMIHRDIKSANILLCS-NGLVKLGDFGFSK  191 (496)
T ss_pred             CCEecCCCCHHHEEEeC-CCCEEEEecccCe
Confidence            35799999999999986 6789999998653


No 355
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=87.96  E-value=0.66  Score=41.58  Aligned_cols=31  Identities=16%  Similarity=0.314  Sum_probs=26.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||.|.||++++ .+.+.++||..+..
T Consensus       116 ~~i~H~dl~p~nil~~~-~~~~~l~dfg~~~~  146 (260)
T cd05611         116 RGIIHRDIKPENLLIDQ-TGHLKLTDFGLSRN  146 (260)
T ss_pred             CCeecCCCCHHHeEECC-CCcEEEeeccccee
Confidence            35899999999999976 67899999987653


No 356
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=87.93  E-value=0.56  Score=42.33  Aligned_cols=30  Identities=23%  Similarity=0.341  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.|.||..+.
T Consensus       125 ~~i~H~~l~p~nil~~~-~~~~~l~dfg~~~  154 (266)
T cd06651         125 NMIVHRDIKGANILRDS-AGNVKLGDFGASK  154 (266)
T ss_pred             CCeeeCCCCHHHEEECC-CCCEEEccCCCcc
Confidence            45899999999999976 5789999998775


No 357
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=87.84  E-value=0.54  Score=43.68  Aligned_cols=30  Identities=17%  Similarity=0.369  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++. ++.+.|+||..+.
T Consensus       136 ~~ivH~dl~p~Nill~~-~~~~kL~dfg~~~  165 (297)
T cd06659         136 QGVIHRDIKSDSILLTL-DGRVKLSDFGFCA  165 (297)
T ss_pred             CCeecCCCCHHHeEEcc-CCcEEEeechhHh
Confidence            45899999999999976 6789999998764


No 358
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=87.84  E-value=0.6  Score=49.40  Aligned_cols=30  Identities=23%  Similarity=0.428  Sum_probs=26.7

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+||+|.|||++. .+.+.|+||..+..
T Consensus       124 gIiHrDLKP~NILl~~-~g~vkL~DFGls~~  153 (669)
T cd05610         124 GIIHRDLKPDNMLISN-EGHIKLTDFGLSKV  153 (669)
T ss_pred             CEEeCCccHHHEEEcC-CCCEEEEeCCCCcc
Confidence            6899999999999976 67899999998864


No 359
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=87.69  E-value=0.51  Score=42.50  Aligned_cols=30  Identities=20%  Similarity=0.375  Sum_probs=25.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ ++.+.++||.++.
T Consensus       126 ~~i~H~dlkp~Nili~~-~~~~kl~dfg~~~  155 (268)
T cd05063         126 MNYVHRDLAARNILVNS-NLECKVSDFGLSR  155 (268)
T ss_pred             CCeeccccchhhEEEcC-CCcEEECCCccce
Confidence            35899999999999976 6789999997765


No 360
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=87.68  E-value=0.3  Score=45.54  Aligned_cols=30  Identities=23%  Similarity=0.305  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.++||..+.
T Consensus       160 ~~ivH~dlkp~Nil~~~-~~~~~l~dfg~~~  189 (302)
T cd05055         160 KNCIHRDLAARNVLLTH-GKIVKICDFGLAR  189 (302)
T ss_pred             CCeehhhhccceEEEcC-CCeEEECCCcccc
Confidence            35899999999999975 5778999998775


No 361
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=87.58  E-value=0.38  Score=42.25  Aligned_cols=34  Identities=24%  Similarity=0.249  Sum_probs=28.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      ..++|+|+.+.||++++ ++.+.++||.++.....
T Consensus       120 ~~~~h~dl~p~ni~i~~-~~~~~l~d~~~~~~~~~  153 (260)
T cd06606         120 NGIVHRDIKGANILVDS-DGVVKLADFGCAKRLGD  153 (260)
T ss_pred             CCccccCCCHHHEEEcC-CCCEEEcccccEEeccc
Confidence            57899999999999986 68899999988775443


No 362
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=87.51  E-value=0.3  Score=44.82  Aligned_cols=30  Identities=23%  Similarity=0.292  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.++||..+.
T Consensus       138 ~~i~H~dikp~nili~~-~~~~~L~Dfg~~~  167 (288)
T cd05061         138 KKFVHRDLAARNCMVAH-DFTVKIGDFGMTR  167 (288)
T ss_pred             CCCcCCCCChheEEEcC-CCcEEECcCCccc
Confidence            46899999999999986 6789999998765


No 363
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=87.47  E-value=0.27  Score=44.74  Aligned_cols=31  Identities=19%  Similarity=0.359  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ .+.+.++||.++..
T Consensus       140 ~~ivH~dl~~~nili~~-~~~~~l~dfg~~~~  170 (282)
T cd06636         140 HKVIHRDIKGQNVLLTE-NAEVKLVDFGVSAQ  170 (282)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEeeCcchhh
Confidence            46899999999999986 67899999987663


No 364
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=87.43  E-value=0.3  Score=44.79  Aligned_cols=30  Identities=23%  Similarity=0.418  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.|+||..+.
T Consensus       146 ~~ivH~dikp~nill~~-~~~~kl~dfg~~~  175 (290)
T cd05045         146 MKLVHRDLAARNVLVAE-GRKMKISDFGLSR  175 (290)
T ss_pred             CCeehhhhhhheEEEcC-CCcEEeccccccc
Confidence            46899999999999976 6789999997765


No 365
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=87.40  E-value=0.55  Score=42.19  Aligned_cols=30  Identities=20%  Similarity=0.317  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|.||++++ .+.+.+.||.++.
T Consensus       125 ~~ivH~di~p~nil~~~-~~~~~l~dfg~~~  154 (267)
T cd06628         125 RGIIHRDIKGANILVDN-KGGIKISDFGISK  154 (267)
T ss_pred             cCcccccCCHHHEEEcC-CCCEEecccCCCc
Confidence            35799999999999976 6789999998775


No 366
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=87.28  E-value=0.29  Score=46.58  Aligned_cols=31  Identities=26%  Similarity=0.423  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. ++.+.|+||..+..
T Consensus       136 ~~i~H~dlkp~NIll~~-~~~~kL~dfg~~~~  166 (342)
T cd07879         136 AGIIHRDLKPGNLAVNE-DCELKILDFGLARH  166 (342)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEeeCCCCcC
Confidence            35799999999999986 68899999988764


No 367
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=87.26  E-value=0.51  Score=43.12  Aligned_cols=30  Identities=23%  Similarity=0.300  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.|.||++++ ++.+.++||..+.
T Consensus       141 ~~i~H~dlkp~nil~~~-~~~~kL~dfg~~~  170 (280)
T cd05092         141 LHFVHRDLATRNCLVGQ-GLVVKIGDFGMSR  170 (280)
T ss_pred             CCeecccccHhhEEEcC-CCCEEECCCCcee
Confidence            46899999999999976 6789999998775


No 368
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=87.25  E-value=0.24  Score=45.14  Aligned_cols=30  Identities=23%  Similarity=0.251  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+.
T Consensus       114 ~~i~H~di~p~Nil~~~-~~~~~l~dfg~~~  143 (277)
T cd05577         114 RRIVYRDLKPENVLLDD-HGNVRISDLGLAV  143 (277)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEccCcchh
Confidence            46799999999999976 6789999998765


No 369
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=87.23  E-value=0.45  Score=42.93  Aligned_cols=32  Identities=19%  Similarity=0.273  Sum_probs=27.0

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||++++ ++.+.+.||..+..-
T Consensus       119 ~~~~h~dl~p~nil~~~-~~~~~l~d~g~~~~~  150 (287)
T cd07840         119 NGILHRDIKGSNILINN-DGVLKLADFGLARPY  150 (287)
T ss_pred             CCceeccCcHHHeEEcC-CCCEEEccccceeec
Confidence            35899999999999986 678999999877643


No 370
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=87.18  E-value=0.36  Score=45.60  Aligned_cols=30  Identities=27%  Similarity=0.388  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+.
T Consensus       126 ~~i~H~dl~p~nill~~-~~~~kl~d~g~~~  155 (337)
T cd07852         126 GNVIHRDLKPSNILLNS-DCRVKLADFGLAR  155 (337)
T ss_pred             CCeecCCCCHHHEEEcC-CCcEEEeeccchh
Confidence            46899999999999986 6789999998665


No 371
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=87.17  E-value=0.85  Score=41.20  Aligned_cols=30  Identities=20%  Similarity=0.251  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.+.||+++.
T Consensus       136 ~~i~H~dlkp~Nili~~-~~~~~l~~~~~~~  165 (275)
T cd05046         136 ARFVHRDLAARNCLVSS-QREVKVSLLSLSK  165 (275)
T ss_pred             cCcccCcCccceEEEeC-CCcEEEccccccc
Confidence            35899999999999976 5778899998775


No 372
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=87.17  E-value=0.51  Score=43.33  Aligned_cols=30  Identities=20%  Similarity=0.381  Sum_probs=26.4

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+.+.||+++. ++.+.+.||..+..
T Consensus       139 ~i~H~dl~p~nil~~~-~~~~kl~dfg~~~~  168 (310)
T cd07865         139 KILHRDMKAANILITK-DGILKLADFGLARA  168 (310)
T ss_pred             CeeccCCCHHHEEECC-CCcEEECcCCCccc
Confidence            6899999999999976 67899999988763


No 373
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=87.17  E-value=0.48  Score=44.03  Aligned_cols=32  Identities=28%  Similarity=0.387  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.|.||++++ ++.+.+.||..+...
T Consensus       134 ~~i~H~dl~p~nIl~~~-~~~~kL~dfg~~~~~  165 (307)
T cd06607         134 HERIHRDIKAGNILLTE-PGTVKLADFGSASLV  165 (307)
T ss_pred             CCceecCCCcccEEECC-CCCEEEeecCcceec
Confidence            35799999999999976 678999999987654


No 374
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=87.16  E-value=0.41  Score=44.81  Aligned_cols=31  Identities=29%  Similarity=0.448  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.|.||++++ ++.+.++||..+..
T Consensus       140 ~gi~H~dl~p~nili~~-~~~~kL~dfg~~~~  170 (313)
T cd06633         140 HNMIHRDIKAGNILLTE-PGQVKLADFGSASK  170 (313)
T ss_pred             CCeecCCCChhhEEECC-CCCEEEeecCCCcc
Confidence            35899999999999976 67899999988753


No 375
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=87.08  E-value=0.7  Score=43.75  Aligned_cols=31  Identities=26%  Similarity=0.400  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.++||..+..
T Consensus       127 ~~iiH~dl~p~Nili~~-~~~~~l~dfg~~~~  157 (328)
T cd07856         127 AGVVHRDLKPSNILINE-NCDLKICDFGLARI  157 (328)
T ss_pred             CCcccCCCCHHHEeECC-CCCEEeCccccccc
Confidence            45899999999999976 67899999988763


No 376
>KOG0198|consensus
Probab=87.04  E-value=0.84  Score=44.25  Aligned_cols=33  Identities=24%  Similarity=0.358  Sum_probs=27.5

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...+.|+|+++.|||++..++.+.+-||--+.-
T Consensus       135 s~g~vH~DiK~~NiLl~~~~~~~KlaDFG~a~~  167 (313)
T KOG0198|consen  135 SKGIVHCDIKPANILLDPSNGDVKLADFGLAKK  167 (313)
T ss_pred             hCCEeccCcccceEEEeCCCCeEEeccCccccc
Confidence            568999999999999986447899999976653


No 377
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=87.03  E-value=0.69  Score=43.65  Aligned_cols=30  Identities=23%  Similarity=0.346  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++ ++.+.+.||..+.
T Consensus       126 ~~ivH~dlkp~Nil~~~-~~~~kl~dfg~~~  155 (334)
T cd07855         126 ANVIHRDLKPSNLLVNE-DCELRIGDFGMAR  155 (334)
T ss_pred             CCeecCCCCHHHEEEcC-CCcEEecccccce
Confidence            35899999999999986 6889999998764


No 378
>KOG0610|consensus
Probab=86.97  E-value=0.83  Score=45.86  Aligned_cols=45  Identities=16%  Similarity=0.160  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          27 QSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        27 ~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      .+|+-...++|..    ..+.=+||+|.|||+.+ +|.|+|.|||.+...
T Consensus       185 aAEvl~ALEYLHm----lGivYRDLKPENILvre-dGHIMLsDFDLS~~~  229 (459)
T KOG0610|consen  185 AAEVLLALEYLHM----LGIVYRDLKPENILVRE-DGHIMLSDFDLSLRC  229 (459)
T ss_pred             HHHHHHHHHHHHh----hceeeccCCcceeEEec-CCcEEeeeccccccC
Confidence            3444444445544    67889999999999987 699999999988754


No 379
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=86.95  E-value=0.67  Score=43.78  Aligned_cols=34  Identities=12%  Similarity=0.237  Sum_probs=27.6

Q ss_pred             eEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         208 LVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       208 ~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      ++.+||+|+++...   ++.....+++.||+||....
T Consensus       100 ~l~e~i~G~~~~~~---~~~~~~~~G~~LA~lH~~~~  133 (307)
T TIGR00938       100 CLVEFLQGLSVGRP---TAMHCRPVGEVLAWMHLAGA  133 (307)
T ss_pred             EEEEeCCCCCCCCC---CHHHHHHHHHHHHHHHhhhc
Confidence            58899999988643   45567899999999998654


No 380
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=86.81  E-value=0.72  Score=41.79  Aligned_cols=30  Identities=27%  Similarity=0.371  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ .+.+.|.||..+.
T Consensus       118 ~~i~H~dl~~~ni~i~~-~~~~~l~d~~~~~  147 (283)
T cd07830         118 HGFFHRDLKPENLLVSG-PEVVKIADFGLAR  147 (283)
T ss_pred             CCcccCCCChhhEEEcC-CCCEEEeecccce
Confidence            46899999999999986 6889999998765


No 381
>KOG1006|consensus
Probab=86.79  E-value=0.22  Score=47.56  Aligned_cols=33  Identities=24%  Similarity=0.440  Sum_probs=28.5

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...-+.|+|++|.|||++. .|.|.|-||--||.
T Consensus       185 ~~lkiIHRDvKPSNILldr-~G~vKLCDFGIcGq  217 (361)
T KOG1006|consen  185 EELKIIHRDVKPSNILLDR-HGDVKLCDFGICGQ  217 (361)
T ss_pred             HHhhhhhccCChhheEEec-CCCEeeecccchHh
Confidence            3467799999999999986 68999999988874


No 382
>KOG1166|consensus
Probab=86.73  E-value=0.84  Score=50.42  Aligned_cols=30  Identities=17%  Similarity=0.327  Sum_probs=23.8

Q ss_pred             eeeeecCCCCCCeeeeC------CCCeEEEEeeccc
Q psy8745          44 VVFCHNDLLLGNIIYDE------TEDKVTFIDYEYA   73 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~------~~~~l~lIDfEya   73 (317)
                      ..+.|+||+|.|+|+..      ....|+||||-++
T Consensus       813 ~~IIHgDiKPDNfll~~~~~~~~~~~~l~lIDfG~s  848 (974)
T KOG1166|consen  813 MGIIHGDIKPDNFLLRREICADSDSKGLYLIDFGRS  848 (974)
T ss_pred             cceecccCCcceeEeecccCCCCcccceEEEecccc
Confidence            57899999999999831      2357999999654


No 383
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=86.65  E-value=0.57  Score=43.68  Aligned_cols=31  Identities=29%  Similarity=0.416  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. ++.+.++||.++..
T Consensus       134 ~~i~H~dl~p~nil~~~-~~~~kl~dfg~~~~  164 (308)
T cd06634         134 HNMIHRDVKAGNILLSE-PGLVKLGDFGSASI  164 (308)
T ss_pred             CCcccCCCCHHhEEECC-CCcEEECCccccee
Confidence            46899999999999976 67899999988764


No 384
>KOG0612|consensus
Probab=86.58  E-value=0.67  Score=51.65  Aligned_cols=55  Identities=16%  Similarity=0.385  Sum_probs=37.0

Q ss_pred             hhhhhcCCCCHHHHH-HHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          13 SRFQALFPGGVSQLQ-SDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        13 ~~~~~~~p~~~~~L~-~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      +++. .+|.+++..- +|+-..-+.+    ...++.|+|++|.|||+|. .|.|.|=||-.|
T Consensus       167 Sk~~-~~pE~~ArFY~aEiVlAldsl----H~mgyVHRDiKPDNvLld~-~GHikLADFGsC  222 (1317)
T KOG0612|consen  167 SKFD-RLPEDWARFYTAEIVLALDSL----HSMGYVHRDIKPDNVLLDK-SGHIKLADFGSC  222 (1317)
T ss_pred             hhcC-CChHHHHHHHHHHHHHHHHHH----HhccceeccCCcceeEecc-cCcEeeccchhH
Confidence            5565 7774444322 2332222222    3579999999999999986 789999999655


No 385
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=86.58  E-value=0.39  Score=44.08  Aligned_cols=31  Identities=23%  Similarity=0.409  Sum_probs=26.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||.++..
T Consensus       124 ~~i~H~dl~~~nil~~~-~~~~~l~dfg~~~~  154 (287)
T cd06621         124 RKIIHRDIKPSNILLTR-KGQVKLCDFGVSGE  154 (287)
T ss_pred             CCcccCCCCHHHEEEec-CCeEEEeecccccc
Confidence            46899999999999976 67899999998764


No 386
>KOG0600|consensus
Probab=86.56  E-value=0.74  Score=47.24  Aligned_cols=35  Identities=20%  Similarity=0.243  Sum_probs=29.5

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNY   77 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~   77 (317)
                      ....+.|+|+++.|||+|. +|.+.|=||-.|....
T Consensus       235 H~~gvlHRDIK~SNiLidn-~G~LKiaDFGLAr~y~  269 (560)
T KOG0600|consen  235 HSRGVLHRDIKGSNILIDN-NGVLKIADFGLARFYT  269 (560)
T ss_pred             hhcCeeeccccccceEEcC-CCCEEeccccceeecc
Confidence            4467899999999999986 7889999999887433


No 387
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=86.55  E-value=0.44  Score=43.05  Aligned_cols=31  Identities=19%  Similarity=0.333  Sum_probs=26.2

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ ++.+.++||..+..
T Consensus       125 ~g~~H~dl~p~nili~~-~~~~kl~dfg~~~~  155 (269)
T cd05065         125 MNYVHRDLAARNILVNS-NLVCKVSDFGLSRF  155 (269)
T ss_pred             CCEeecccChheEEEcC-CCcEEECCCccccc
Confidence            46899999999999976 57899999987653


No 388
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=86.55  E-value=0.48  Score=45.98  Aligned_cols=30  Identities=23%  Similarity=0.268  Sum_probs=25.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. .+.+.++||.++.
T Consensus       233 ~~ivH~Dlkp~Nill~~-~~~~kl~DfG~a~  262 (375)
T cd05104         233 KNCIHRDLAARNILLTH-GRITKICDFGLAR  262 (375)
T ss_pred             CCeeccCCchhhEEEEC-CCcEEEecCccce
Confidence            35799999999999986 5678899998775


No 389
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=86.53  E-value=0.6  Score=43.06  Aligned_cols=32  Identities=25%  Similarity=0.173  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeC---CCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDE---TEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~---~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++   ..+.+.++||..+..
T Consensus       127 ~~i~h~dlkp~Nil~~~~~~~~~~~kl~Dfg~~~~  161 (316)
T cd07842         127 NWVLHRDLKPANILVMGEGPERGVVKIGDLGLARL  161 (316)
T ss_pred             CCEeeCCCCHHHEEEcCCCCccceEEECCCccccc
Confidence            35899999999999974   146799999987763


No 390
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=86.47  E-value=0.34  Score=43.02  Aligned_cols=31  Identities=26%  Similarity=0.304  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. .+.+.|+||.++..
T Consensus       121 ~~i~H~dl~~~ni~~~~-~~~~kl~d~~~~~~  151 (258)
T cd06632         121 RNTVHRDIKGANILVDT-NGVVKLADFGMAKQ  151 (258)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEccCcccee
Confidence            46899999999999976 67899999987764


No 391
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=86.47  E-value=0.59  Score=42.89  Aligned_cols=31  Identities=23%  Similarity=0.488  Sum_probs=26.6

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.+.||.++..
T Consensus       135 ~~i~H~dl~p~nili~~-~~~~kl~dfg~~~~  165 (302)
T cd07864         135 KNFLHRDIKCSNILLNN-KGQIKLADFGLARL  165 (302)
T ss_pred             CCeecCCCCHHHEEECC-CCcEEeCccccccc
Confidence            36899999999999976 67899999987763


No 392
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=86.24  E-value=0.33  Score=43.34  Aligned_cols=31  Identities=23%  Similarity=0.275  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+||.+.||++++ .+.+.|+||.++..
T Consensus       118 ~~i~H~dl~~~nil~~~-~~~~kl~d~g~~~~  148 (264)
T cd06626         118 HGIVHRDIKPANIFLDH-NGVIKLGDFGCAVK  148 (264)
T ss_pred             CCcccCCCCHHHEEECC-CCCEEEcccccccc
Confidence            35799999999999986 67899999988765


No 393
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=86.12  E-value=0.66  Score=41.82  Aligned_cols=31  Identities=23%  Similarity=0.309  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|++++||++++ ++.+.++||..+.-
T Consensus       125 ~~i~H~dl~p~ni~i~~-~~~~~l~dfg~~~~  155 (264)
T cd06653         125 NMIVHRDIKGANILRDS-AGNVKLGDFGASKR  155 (264)
T ss_pred             CCEecCCCCHHHEEEcC-CCCEEECccccccc
Confidence            35899999999999976 67899999987763


No 394
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=86.11  E-value=0.52  Score=42.84  Aligned_cols=31  Identities=26%  Similarity=0.419  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..+.|+|+.+.||++++ ++.+.++||..+..
T Consensus       120 ~~ivH~dl~p~ni~i~~-~~~~~l~dfg~~~~  150 (277)
T cd06642         120 ERKIHRDIKAANVLLSE-QGDVKLADFGVAGQ  150 (277)
T ss_pred             CCeeccCCChheEEEeC-CCCEEEcccccccc
Confidence            46899999999999976 67899999987753


No 395
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=85.95  E-value=0.98  Score=41.00  Aligned_cols=30  Identities=23%  Similarity=0.369  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||++++ ++.+.++||.++.
T Consensus       119 ~~i~H~~l~p~nill~~-~~~~~l~dfg~~~  148 (284)
T cd07860         119 HRVLHRDLKPQNLLINT-EGAIKLADFGLAR  148 (284)
T ss_pred             CCeecCCCCHHHEEECC-CCCEEEeeccchh
Confidence            35899999999999986 5789999998764


No 396
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=85.84  E-value=0.98  Score=49.80  Aligned_cols=32  Identities=25%  Similarity=0.225  Sum_probs=27.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|++|.||+++. .+.+.++||..|...
T Consensus       132 ~GIIHRDLKPeNILLd~-dg~vKLiDFGLAk~i  163 (932)
T PRK13184        132 KGVLHRDLKPDNILLGL-FGEVVILDWGAAIFK  163 (932)
T ss_pred             CCccccCCchheEEEcC-CCCEEEEecCcceec
Confidence            36899999999999976 678999999988654


No 397
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=85.84  E-value=0.79  Score=47.21  Aligned_cols=30  Identities=23%  Similarity=0.385  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||+++. ++.+.++||..+.
T Consensus       328 ~~ivHrDLKp~NILl~~-~~~~kL~DFGla~  357 (507)
T PLN03224        328 IGIVHRDIKPENLLVTV-DGQVKIIDFGAAV  357 (507)
T ss_pred             CCeecCCCchHhEEECC-CCcEEEEeCcCcc
Confidence            35799999999999976 5789999998874


No 398
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=85.82  E-value=0.86  Score=43.30  Aligned_cols=31  Identities=26%  Similarity=0.369  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||++++ .+.+.|+||.++..
T Consensus       137 ~gi~H~dlkp~Nill~~-~~~~kL~dfg~~~~  167 (343)
T cd07851         137 AGIIHRDLKPSNIAVNE-DCELKILDFGLARH  167 (343)
T ss_pred             CCeecCCCCHHHeEECC-CCCEEEcccccccc
Confidence            45899999999999986 67899999988763


No 399
>PLN00181 protein SPA1-RELATED; Provisional
Probab=85.75  E-value=1  Score=48.36  Aligned_cols=31  Identities=10%  Similarity=0.143  Sum_probs=25.0

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...++|+||+|.|||++. .+.+.+|||..+.
T Consensus        98 ~~gIvHrDlKP~NiLl~~-~~~~k~~d~~~~~  128 (793)
T PLN00181         98 SQGIVVHNVRPSCFVMSS-FNHVSFIESASCS  128 (793)
T ss_pred             hCCeeeccCCchhEEEcc-cCcEEEeeccccC
Confidence            356999999999999975 5678888886553


No 400
>KOG0659|consensus
Probab=85.72  E-value=0.48  Score=45.20  Aligned_cols=33  Identities=18%  Similarity=0.332  Sum_probs=27.9

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...-+.|+|++|+|+|+++ +|.+.+=||-.|..
T Consensus       118 H~~~IlHRDlKPnNLLis~-~g~lKiADFGLAr~  150 (318)
T KOG0659|consen  118 HSKWILHRDLKPNNLLISS-DGQLKIADFGLARF  150 (318)
T ss_pred             HhhhhhcccCCccceEEcC-CCcEEeecccchhc
Confidence            3467889999999999987 68899999987763


No 401
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=85.63  E-value=1.2  Score=43.92  Aligned_cols=30  Identities=23%  Similarity=0.328  Sum_probs=25.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ ++.+.++||..+.
T Consensus       256 ~~ivH~dikp~Nill~~-~~~~kL~DfGla~  285 (400)
T cd05105         256 KNCVHRDLAARNVLLAQ-GKIVKICDFGLAR  285 (400)
T ss_pred             CCeeCCCCChHhEEEeC-CCEEEEEeCCcce
Confidence            35899999999999986 5779999998775


No 402
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=85.42  E-value=0.83  Score=43.23  Aligned_cols=32  Identities=19%  Similarity=0.314  Sum_probs=27.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..++|+|+.+.||+++. .+.+.|+||..+...
T Consensus       127 ~~i~H~dlkp~Nil~~~-~~~~kL~Dfg~~~~~  158 (337)
T cd07858         127 ANVLHRDLKPSNLLLNA-NCDLKICDFGLARTT  158 (337)
T ss_pred             CCEecCCCCHHHEEEcC-CCCEEECcCcccccc
Confidence            46899999999999976 578999999877643


No 403
>KOG1164|consensus
Probab=85.31  E-value=0.4  Score=45.75  Aligned_cols=33  Identities=18%  Similarity=0.354  Sum_probs=26.6

Q ss_pred             CCeeeeecCCCCCCeeeeCCC----CeEEEEeecccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETE----DKVTFIDYEYAG   74 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~----~~l~lIDfEya~   74 (317)
                      ....++|+|++|+|+++....    ..|++|||-.|.
T Consensus       139 H~~G~iHRDiKp~N~~~g~~~~~~~~~~~llDfGlar  175 (322)
T KOG1164|consen  139 HSKGFIHRDIKPENFVVGQSSRSEVRTLYLLDFGLAR  175 (322)
T ss_pred             HhcCcccCCcCHHHeeecCCCCcccceEEEEecCCCc
Confidence            357999999999999996432    469999996665


No 404
>KOG1167|consensus
Probab=85.28  E-value=1  Score=45.10  Aligned_cols=34  Identities=18%  Similarity=0.354  Sum_probs=29.7

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ....+.|+|++|+|+|++...++-+||||-.|-.
T Consensus       149 h~~GIvHRDiKpsNFL~n~~t~rg~LvDFgLA~~  182 (418)
T KOG1167|consen  149 HKNGIVHRDIKPSNFLYNRRTQRGVLVDFGLAQR  182 (418)
T ss_pred             hccCccccCCCccccccccccCCceEEechhHHH
Confidence            4578999999999999987678889999988774


No 405
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=85.15  E-value=0.53  Score=44.85  Aligned_cols=31  Identities=23%  Similarity=0.360  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||++++ ++.+.++||..+..
T Consensus       139 ~~ivH~dlkp~NIll~~-~~~~kl~dfg~~~~  169 (345)
T cd07877         139 ADIIHRDLKPSNLAVNE-DCELKILDFGLARH  169 (345)
T ss_pred             CCeeecCCChHHEEEcC-CCCEEEeccccccc
Confidence            45899999999999986 67899999987653


No 406
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=85.11  E-value=0.83  Score=41.34  Aligned_cols=51  Identities=20%  Similarity=0.203  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...+...+..+-..+... ....++|+|+.+.||++++ ++.+.++||..+..
T Consensus        97 ~~~~~~~~~ql~~~l~~l-h~~~i~h~dl~p~ni~i~~-~~~~~l~d~g~~~~  147 (274)
T cd06609          97 ETYIAFILREVLLGLEYL-HEEGKIHRDIKAANILLSE-EGDVKLADFGVSGQ  147 (274)
T ss_pred             HHHHHHHHHHHHHHHHHH-HhCCcccCCCCHHHEEECC-CCCEEEccccccee
Confidence            444444444333333221 1245899999999999986 67899999987654


No 407
>KOG0605|consensus
Probab=85.08  E-value=0.46  Score=48.83  Aligned_cols=32  Identities=16%  Similarity=0.411  Sum_probs=28.6

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ....+.|+|++|.|+|+|. .|.|.|=||-.|.
T Consensus       258 H~~gyIHRDIKPdNlLiD~-~GHiKLSDFGLs~  289 (550)
T KOG0605|consen  258 HQLGYIHRDIKPDNLLIDA-KGHIKLSDFGLST  289 (550)
T ss_pred             HHcCcccccCChhheeecC-CCCEeeccccccc
Confidence            3578999999999999987 7999999999884


No 408
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=84.88  E-value=0.77  Score=41.94  Aligned_cols=29  Identities=21%  Similarity=0.478  Sum_probs=25.4

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .+.|+|+.+.||++++ .+.+.++||..+.
T Consensus       124 ~i~H~dl~p~nil~~~-~~~~~l~d~gl~~  152 (284)
T cd06620         124 RIMHRDIKPSNILVNS-RGQIKLCDFGVSG  152 (284)
T ss_pred             CeeccCCCHHHEEECC-CCcEEEccCCccc
Confidence            5899999999999976 6789999998764


No 409
>KOG0578|consensus
Probab=84.87  E-value=1.4  Score=45.48  Aligned_cols=37  Identities=16%  Similarity=0.263  Sum_probs=30.5

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhh
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAF   80 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~f   80 (317)
                      ...+.|+|++..|||.+. +|.|.+.||-||+.....-
T Consensus       387 ~~gIiHrDIKSDnILL~~-~g~vKltDFGFcaqi~~~~  423 (550)
T KOG0578|consen  387 ARGIIHRDIKSDNILLTM-DGSVKLTDFGFCAQISEEQ  423 (550)
T ss_pred             hcceeeeccccceeEecc-CCcEEEeeeeeeecccccc
Confidence            367899999999999976 6889999999998644433


No 410
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=84.86  E-value=1.4  Score=40.04  Aligned_cols=31  Identities=19%  Similarity=0.236  Sum_probs=24.9

Q ss_pred             eeeecCCCCCCeeeeCCC--CeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETE--DKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~--~~l~lIDfEya~~   75 (317)
                      .++|+|+.+.||+++..+  ..+.++||..+..
T Consensus       136 ~ivH~dlkp~nil~~~~~~~~~~kl~dfg~~~~  168 (277)
T cd05036         136 HFIHRDIAARNCLLTCKGPGRVAKIADFGMARD  168 (277)
T ss_pred             CEeecccchheEEEeccCCCcceEeccCccccc
Confidence            589999999999997532  3588999987764


No 411
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=84.68  E-value=0.86  Score=43.29  Aligned_cols=32  Identities=19%  Similarity=0.269  Sum_probs=26.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+++.||+++..++.+.++||.++..
T Consensus       133 ~givH~dikp~Nili~~~~~~~kl~dfg~~~~  164 (342)
T cd07854         133 ANVLHRDLKPANVFINTEDLVLKIGDFGLARI  164 (342)
T ss_pred             CCcccCCCCHHHEEEcCCCceEEECCccccee
Confidence            46899999999999975456788999998864


No 412
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=84.36  E-value=0.55  Score=42.44  Aligned_cols=29  Identities=21%  Similarity=0.331  Sum_probs=25.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+++.||++++  +.+.++||..+.
T Consensus       119 ~~i~H~dl~p~ni~l~~--~~~kl~dfg~~~  147 (282)
T cd07831         119 NGIFHRDIKPENILIKD--DILKLADFGSCR  147 (282)
T ss_pred             CCceecccCHHHEEEcC--CCeEEEeccccc
Confidence            35899999999999986  889999998775


No 413
>KOG2345|consensus
Probab=84.36  E-value=2.2  Score=40.52  Aligned_cols=31  Identities=19%  Similarity=0.323  Sum_probs=26.5

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      -+.|+|++|+||++.+ .+..+++||--+...
T Consensus       149 ~yAH~DiKP~NILls~-~~~~vl~D~GS~~~a  179 (302)
T KOG2345|consen  149 PYAHRDIKPANILLSD-SGLPVLMDLGSATQA  179 (302)
T ss_pred             cccccCCCcceeEecC-CCceEEEeccCcccc
Confidence            5999999999999976 688999999776643


No 414
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=84.35  E-value=1.6  Score=39.51  Aligned_cols=32  Identities=13%  Similarity=0.056  Sum_probs=24.1

Q ss_pred             CeeeeecCCCCCCeeeeCCCC------eEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETED------KVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~------~l~lIDfEya~   74 (317)
                      ...++|+|++|.||+++.+..      .+.++||..+.
T Consensus       123 ~~~ivH~dlkp~Nill~~~~~~~~~~~~~~l~d~g~~~  160 (262)
T cd05077         123 DKDLVHGNVCTKNILLAREGIDGECGPFIKLSDPGIPI  160 (262)
T ss_pred             hCCeECCCCCcccEEEecCCccCCCCceeEeCCCCCCc
Confidence            346899999999999964221      27899997764


No 415
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=84.14  E-value=0.57  Score=42.55  Aligned_cols=30  Identities=27%  Similarity=0.295  Sum_probs=26.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||++++ .+.+.++||.++.
T Consensus       136 ~~i~H~di~p~nil~~~-~~~~kl~d~g~~~  165 (280)
T cd05043         136 RGVIHKDIAARNCVIDE-ELQVKITDNALSR  165 (280)
T ss_pred             CCEeecccCHhhEEEcC-CCcEEECCCCCcc
Confidence            46899999999999976 5789999998875


No 416
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=84.06  E-value=1.3  Score=39.88  Aligned_cols=32  Identities=16%  Similarity=0.207  Sum_probs=24.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCe-------EEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDK-------VTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~-------l~lIDfEya~   74 (317)
                      ...++|+|+++.||+++.++..       +.+.||..+.
T Consensus       118 ~~~iiH~dlkp~nili~~~~~~~~~~~~~~~l~d~g~~~  156 (258)
T cd05078         118 DKGLTHGNVCAKNVLLIREEDRKTGNPPFIKLSDPGISI  156 (258)
T ss_pred             HCCeecCCCccceEEEecccccccCCCceEEeccccccc
Confidence            3468999999999999753322       6788887764


No 417
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=83.91  E-value=1.6  Score=39.38  Aligned_cols=30  Identities=23%  Similarity=0.382  Sum_probs=25.7

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      .++|+|+.+.||++++ ++.+.+.||..+..
T Consensus       118 ~i~H~~l~~~ni~~~~-~~~~~l~d~g~~~~  147 (282)
T cd07829         118 RILHRDLKPQNILINR-DGVLKLADFGLARA  147 (282)
T ss_pred             CcccCCCChheEEEcC-CCCEEEecCCcccc
Confidence            5799999999999976 68899999977653


No 418
>KOG0660|consensus
Probab=83.85  E-value=0.55  Score=46.08  Aligned_cols=37  Identities=16%  Similarity=0.220  Sum_probs=31.4

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ..-.+.|+||+|+|++++. +..+.+-||-+|...+..
T Consensus       142 HSAnViHRDLKPsNll~n~-~c~lKI~DFGLAR~~~~~  178 (359)
T KOG0660|consen  142 HSANVIHRDLKPSNLLLNA-DCDLKICDFGLARYLDKF  178 (359)
T ss_pred             hcccccccccchhheeecc-CCCEEeccccceeecccc
Confidence            4567899999999999987 678999999999876554


No 419
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=83.68  E-value=0.98  Score=41.75  Aligned_cols=30  Identities=20%  Similarity=0.408  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|+.+.||+++. .+.+.++||..+.
T Consensus       134 ~gi~H~dL~p~Nili~~-~~~~kL~dfg~~~  163 (293)
T cd06647         134 NQVIHRDIKSDNILLGM-DGSVKLTDFGFCA  163 (293)
T ss_pred             CCEeeccCCHHHEEEcC-CCCEEEccCccee
Confidence            45899999999999976 5789999998765


No 420
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=83.48  E-value=1.1  Score=42.25  Aligned_cols=31  Identities=26%  Similarity=0.344  Sum_probs=26.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. .+.+.++||..+..
T Consensus       138 ~~i~H~dl~~~nill~~-~~~~kl~dfg~~~~  168 (335)
T PTZ00024        138 WYFMHRDLSPANIFINS-KGICKIADFGLARR  168 (335)
T ss_pred             CCeecccccHHHeEECC-CCCEEECCccceee
Confidence            46899999999999976 67899999987753


No 421
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=83.39  E-value=0.38  Score=42.01  Aligned_cols=58  Identities=26%  Similarity=0.489  Sum_probs=41.3

Q ss_pred             cchhhhhcCC-CCceEEE-----ecC--ceEEEeecCccCCC--CCCCCcccHHHHHHHHHhhcccCC
Q psy8745         187 SPQILHRAGL-APRLYAE-----FDN--GLVYQYVRGVTITP--DSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       187 ~~~~L~~~~~-gp~l~g~-----F~n--G~~e~fi~g~tL~~--~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      .++.|.++|+ .|++++.     +.+  ..+.+|++|+++..  ..-..+.+...+|+.|+++|...+
T Consensus        43 ~~~~l~~~~~pvP~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~l~~lh~~~~  110 (239)
T PF01636_consen   43 VLRQLAEHGIPVPRVLAFDTSDEFNGFPYLLMEYIPGRPLDDELSPEQRPELLRQLGRALAQLHQVPP  110 (239)
T ss_dssp             HHHHHHHTTSBS--EEEEEEETEETSEEEEEEEEESSEEHHHTSTHHHHHHHHHHHHHHHHHHHHSHT
T ss_pred             HHHHHHhcCCCCceEEeecccccccccceEEEEEeccccccccccccccccccccchhhhhhcccccc
Confidence            3466788888 8888883     222  36899999999888  222345688899999999999853


No 422
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=83.28  E-value=1.4  Score=40.06  Aligned_cols=31  Identities=26%  Similarity=0.401  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.||+++. ++.+.++||..+..
T Consensus       122 ~~i~h~dl~p~nili~~-~~~~~l~d~g~~~~  152 (280)
T cd06611         122 HKVIHRDLKAGNILLTL-DGDVKLADFGVSAK  152 (280)
T ss_pred             CCcccCCCChhhEEECC-CCCEEEccCccchh
Confidence            35799999999999976 67899999976543


No 423
>KOG1187|consensus
Probab=83.02  E-value=1.4  Score=43.35  Aligned_cols=41  Identities=24%  Similarity=0.344  Sum_probs=31.2

Q ss_pred             HHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          36 ALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        36 ~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      +|.... +..+.|+|+++.|||+|+ +-.-.+-||..|..++.
T Consensus       189 yLH~~~-~~~iiHrDiKssNILLD~-~~~aKlsDFGLa~~~~~  229 (361)
T KOG1187|consen  189 YLHEGC-PPPIIHRDIKSSNILLDE-DFNAKLSDFGLAKLGPE  229 (361)
T ss_pred             HHccCC-CCCEecCCCCHHHeeECC-CCCEEccCccCcccCCc
Confidence            344433 337899999999999986 56788999999866654


No 424
>KOG0596|consensus
Probab=82.59  E-value=0.92  Score=47.17  Aligned_cols=30  Identities=23%  Similarity=0.389  Sum_probs=25.1

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...+.|.||+|.|+|+-  .|.|.||||--|.
T Consensus       478 ~~gIVHSDLKPANFLlV--kG~LKLIDFGIA~  507 (677)
T KOG0596|consen  478 QHGIVHSDLKPANFLLV--KGRLKLIDFGIAN  507 (677)
T ss_pred             HhceeecCCCcccEEEE--eeeEEeeeechhc
Confidence            45889999999999985  5899999995443


No 425
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=82.25  E-value=0.99  Score=44.65  Aligned_cols=29  Identities=28%  Similarity=0.339  Sum_probs=25.6

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+++.|||+++ .+.+.++||.++.
T Consensus       259 ~ivHrdlkp~NiLl~~-~~~~kL~DfGla~  287 (401)
T cd05107         259 NCVHRDLAARNVLICE-GKLVKICDFGLAR  287 (401)
T ss_pred             CcCcccCCcceEEEeC-CCEEEEEecCcce
Confidence            5799999999999986 6789999998876


No 426
>KOG0593|consensus
Probab=81.89  E-value=0.84  Score=44.43  Aligned_cols=30  Identities=23%  Similarity=0.369  Sum_probs=25.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .-..|+|++|.|||++. ++.+.|-||-||.
T Consensus       120 ~n~IHRDIKPENILit~-~gvvKLCDFGFAR  149 (396)
T KOG0593|consen  120 NNCIHRDIKPENILITQ-NGVVKLCDFGFAR  149 (396)
T ss_pred             cCeecccCChhheEEec-CCcEEeccchhhH
Confidence            34789999999999986 6889999998876


No 427
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=81.81  E-value=1.3  Score=39.62  Aligned_cols=31  Identities=19%  Similarity=0.264  Sum_probs=26.0

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ...++|+|+.+.||++++  +.+.++||.++..
T Consensus       124 ~~~i~h~~l~~~nili~~--~~~~l~d~g~~~~  154 (260)
T cd08222         124 QRRILHRDLKAKNIFLKN--NLLKIGDFGVSRL  154 (260)
T ss_pred             HcCccccCCChhheEeec--CCEeecccCceee
Confidence            357899999999999964  6699999987754


No 428
>KOG0615|consensus
Probab=81.72  E-value=0.73  Score=46.27  Aligned_cols=33  Identities=21%  Similarity=0.272  Sum_probs=25.8

Q ss_pred             CeeeeecCCCCCCeeeeCCC--CeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETE--DKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~--~~l~lIDfEya~~   75 (317)
                      ...+||+|++|.|||+..+.  --|.+=||-.|-.
T Consensus       294 ~~GI~HRDiKPeNILl~~~~e~~llKItDFGlAK~  328 (475)
T KOG0615|consen  294 SQGIIHRDIKPENILLSNDAEDCLLKITDFGLAKV  328 (475)
T ss_pred             HcCcccccCCcceEEeccCCcceEEEecccchhhc
Confidence            46899999999999996532  2466889987764


No 429
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=81.72  E-value=1.3  Score=41.34  Aligned_cols=34  Identities=15%  Similarity=0.304  Sum_probs=28.2

Q ss_pred             eEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         208 LVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       208 ~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      ++.+|++|+++.   ..++.-...+|+.||+||....
T Consensus        72 ~l~~~i~G~~~~---~~~~~~~~~~g~~La~lH~~~~  105 (313)
T TIGR02906        72 VLTEWIEGRECD---FNNPIDLKKAAKGLALFHHASK  105 (313)
T ss_pred             EEehhccCcCCC---CCCHHHHHHHHHHHHHHHHhCC
Confidence            788999999887   3456678889999999998653


No 430
>KOG0595|consensus
Probab=81.69  E-value=2.5  Score=42.36  Aligned_cols=42  Identities=19%  Similarity=0.176  Sum_probs=32.5

Q ss_pred             eeeeecCCCCCCeeeeCC-C----CeEEEEeeccccCCchhhhHHHH
Q psy8745          44 VVFCHNDLLLGNIIYDET-E----DKVTFIDYEYAGVNYQAFDIANH   85 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~-~----~~l~lIDfEya~~n~~~fDiAn~   85 (317)
                      .-+.|+||+|.|||++.. .    -.+.+=||-+|.+-.++.-.++.
T Consensus       128 ~~IiHRDLKPQNiLLs~~~~~~~~~~LKIADFGfAR~L~~~~~a~tl  174 (429)
T KOG0595|consen  128 NNIIHRDLKPQNILLSTTARNDTSPVLKIADFGFARFLQPGSMAETL  174 (429)
T ss_pred             CCeeeccCCcceEEeccCCCCCCCceEEecccchhhhCCchhHHHHh
Confidence            578999999999999753 1    24779999999988766655443


No 431
>KOG1235|consensus
Probab=81.53  E-value=1.1  Score=46.67  Aligned_cols=31  Identities=23%  Similarity=0.371  Sum_probs=23.6

Q ss_pred             CeeeeecCCCCCCeeeeC---CCCeEEEEeeccc
Q psy8745          43 PVVFCHNDLLLGNIIYDE---TEDKVTFIDYEYA   73 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~---~~~~l~lIDfEya   73 (317)
                      ...|.|+|.|||||++..   .+.++.+.|+-..
T Consensus       319 ~~GffHaDPHPGNilv~~~~~~~~~ivllDhGl~  352 (538)
T KOG1235|consen  319 KTGFFHADPHPGNILVRPNPEGDEEIVLLDHGLY  352 (538)
T ss_pred             hcCCccCCCCCCcEEEecCCCCCccEEEEccccc
Confidence            346999999999999984   2467888886433


No 432
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=81.46  E-value=2.8  Score=37.84  Aligned_cols=58  Identities=14%  Similarity=0.259  Sum_probs=42.7

Q ss_pred             CcchhhhhcCC-CCceEEEecCceEEEeecCccCCCCCCCC--------cccHHHHHHHHHhh-cccC
Q psy8745         186 PSPQILHRAGL-APRLYAEFDNGLVYQYVRGVTITPDSIRE--------PHIHPLVARNMARL-HKVH  243 (317)
Q Consensus       186 ~~~~~L~~~~~-gp~l~g~F~nG~~e~fi~g~tL~~~~l~~--------~~i~~~IA~~la~~-H~~~  243 (317)
                      ..++.|.+.|+ .|++|+...|..+-|||.|..+....|++        ..+...+...|+++ |...
T Consensus        78 r~L~rl~~~Gv~vP~pi~~~~~~lvME~Ig~~~~~~~~Lkd~~~~~~~~~~i~~~i~~~l~~l~H~~g  145 (197)
T cd05146          78 HNLKRMQKAGIPCPEVVVLKKHVLVMSFIGDDQVPAPKLKDAKLNDEEMKNAYYQVLSMMKQLYKECN  145 (197)
T ss_pred             HHHHHHHHcCCCCCeEEEecCCEEEEEEcCCCCccchhhhccccCHHHHHHHHHHHHHHHHHHHHhCC
Confidence            56678889987 89999999999999999986333333333        23567788888887 7643


No 433
>KOG3021|consensus
Probab=81.10  E-value=1.8  Score=40.56  Aligned_cols=44  Identities=18%  Similarity=0.121  Sum_probs=32.2

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHH
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFD   87 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~   87 (317)
                      .-..+.|+||+.+|+-.|+ .+.-++.|= -+.|+++-||+|...+
T Consensus       208 I~PaLlHGDLW~GNva~D~-~~ePiIfDP-asfYgh~Efefgia~m  251 (313)
T KOG3021|consen  208 ILPALLHGDLWSGNVAEDG-AGEPIIFDP-ASFYGHSEFEFGIAKM  251 (313)
T ss_pred             eehhhhccccccCcccccC-CCCceEeCc-hhhcCCcHHHHHHHHH
Confidence            3456789999999998876 344555553 3468999999997644


No 434
>KOG0665|consensus
Probab=80.83  E-value=0.93  Score=44.21  Aligned_cols=37  Identities=19%  Similarity=0.304  Sum_probs=30.0

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ....+.|+||+|.||+++. +..+.+.||-+|.-..+.
T Consensus       135 hs~~IihRdLkPsnivv~~-~~~lKi~dfg~ar~e~~~  171 (369)
T KOG0665|consen  135 HSAGIIHRDLKPSNIVVNS-DCTLKILDFGLARTEDTD  171 (369)
T ss_pred             HhcceeecccCcccceecc-hhheeeccchhhcccCcc
Confidence            3578999999999999976 577889999888754443


No 435
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=80.52  E-value=1.1  Score=42.50  Aligned_cols=27  Identities=26%  Similarity=0.277  Sum_probs=23.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEY   72 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEy   72 (317)
                      ..+.|+||..-|||+.  ++.+++|||-=
T Consensus       186 a~LVHgDLSEyNiL~~--~~~p~iID~~Q  212 (268)
T COG1718         186 AGLVHGDLSEYNILVH--DGEPYIIDVSQ  212 (268)
T ss_pred             cCcccccchhhheEEE--CCeEEEEECcc
Confidence            4789999999999997  47899999943


No 436
>PHA02988 hypothetical protein; Provisional
Probab=80.24  E-value=1.6  Score=40.36  Aligned_cols=28  Identities=14%  Similarity=0.000  Sum_probs=23.3

Q ss_pred             eeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          46 FCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        46 ~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..|+|+.|.||++++ ++.+.++||-.+.
T Consensus       144 ~~Hrdlkp~nill~~-~~~~kl~dfg~~~  171 (283)
T PHA02988        144 KPYKNLTSVSFLVTE-NYKLKIICHGLEK  171 (283)
T ss_pred             CCCCcCChhhEEECC-CCcEEEcccchHh
Confidence            349999999999986 5789999996654


No 437
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=79.85  E-value=1.8  Score=39.11  Aligned_cols=30  Identities=7%  Similarity=0.184  Sum_probs=24.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..++|+|++|.||+++. ++.+.+.||..+.
T Consensus       126 ~~iiH~dikp~nili~~-~~~~~l~dfg~~~  155 (266)
T cd05064         126 MGYVHKGLAAHKVLVNS-DLVCKISGFRRLQ  155 (266)
T ss_pred             CCEeeccccHhhEEEcC-CCcEEECCCcccc
Confidence            45799999999999976 5778899987554


No 438
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=79.83  E-value=1.8  Score=34.35  Aligned_cols=54  Identities=22%  Similarity=0.348  Sum_probs=40.3

Q ss_pred             hhhhc-CCCCceEEEec----CceEEEeecCccCCCC-CCCCcccHHHHHHHHHhhcccC
Q psy8745         190 ILHRA-GLAPRLYAEFD----NGLVYQYVRGVTITPD-SIREPHIHPLVARNMARLHKVH  243 (317)
Q Consensus       190 ~L~~~-~~gp~l~g~F~----nG~~e~fi~g~tL~~~-~l~~~~i~~~IA~~la~~H~~~  243 (317)
                      .|+.. ...|++++.+.    ...+.+|++|.++... ....+.+...++..|+++|...
T Consensus        47 ~l~~~~~~~p~~~~~~~~~~~~~~v~e~~~g~~~~~~~~~~~~~~~~~~~~~l~~lh~~~  106 (155)
T cd05120          47 LLARKGLPVPKVLASGESDGWSYLLMEWIEGETLDEVSEEEKEDIAEQLAELLAKLHQLP  106 (155)
T ss_pred             HHHHcCCCCCeEEEEcCCCCccEEEEEecCCeecccCCHHHHHHHHHHHHHHHHHHhCCC
Confidence            34443 56788888887    6789999999888653 2234667888999999999864


No 439
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=79.52  E-value=1.7  Score=43.57  Aligned_cols=60  Identities=25%  Similarity=0.416  Sum_probs=45.2

Q ss_pred             HHHHHHHHHHHHHH---HhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHH
Q psy8745          23 VSQLQSDWQYIETA---LSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIAN   84 (317)
Q Consensus        23 ~~~L~~e~~~L~~~---l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn   84 (317)
                      .+...+++..+...   +.......-|-|+|+.-+|||++  +|+|.||||-.|..+++.=+|.+
T Consensus       317 ~~~~~e~lsff~s~~sil~~lekkf~fehrnlt~~niLId--~GnvtLIDfklsRl~~~q~~isy  379 (488)
T COG5072         317 ADRSEEELSFFWSCISILDILEKKFPFEHRNLTLDNILID--EGNVTLIDFKLSRLSYSQGIISY  379 (488)
T ss_pred             cccHHHHHHHHHHHHHHHhhhhhcCCcccccccccceeee--cCceEEEEeeeeecccCCceeec
Confidence            34455555555543   23445677899999999999998  58999999999998888776654


No 440
>KOG0577|consensus
Probab=78.91  E-value=0.95  Score=47.61  Aligned_cols=36  Identities=28%  Similarity=0.341  Sum_probs=30.7

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      .....|+|++.||||+.+ +|.|.|-||--|++..|+
T Consensus       144 S~~~IHRDiKAGNILLse-~g~VKLaDFGSAsi~~PA  179 (948)
T KOG0577|consen  144 SHNRIHRDIKAGNILLSE-PGLVKLADFGSASIMAPA  179 (948)
T ss_pred             HhhHHhhhccccceEecC-CCeeeeccccchhhcCch
Confidence            356789999999999986 788999999999877664


No 441
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=78.80  E-value=1.5  Score=37.98  Aligned_cols=57  Identities=19%  Similarity=0.285  Sum_probs=41.2

Q ss_pred             chhhhhcC-CCCceEEEecC--ceEEEeecCccCCCCCCCCc-ccHHHHHHHHHhhcccCC
Q psy8745         188 PQILHRAG-LAPRLYAEFDN--GLVYQYVRGVTITPDSIREP-HIHPLVARNMARLHKVHS  244 (317)
Q Consensus       188 ~~~L~~~~-~gp~l~g~F~n--G~~e~fi~g~tL~~~~l~~~-~i~~~IA~~la~~H~~~~  244 (317)
                      +..|...| ..|.+++.-++  ..+.+|++|.+|..--.... .+...||+.|+.+|....
T Consensus        51 l~~l~~~~i~~p~~~~~~~~~~~lv~e~~~g~~l~~~~~~~~~~~~~~i~~~l~~lH~~gi  111 (199)
T TIGR03724        51 LSRARKAGVNTPVVYDVDPDNKTIVMEYIEGKPLKDVIEEGNDELLREIGRLVGKLHKAGI  111 (199)
T ss_pred             HHHHHHCCCCCCEEEEEECCCCEEEEEEECCccHHHHHhhcHHHHHHHHHHHHHHHHHCCe
Confidence            34455556 46778888777  78899999998864321222 688999999999998654


No 442
>PF10009 DUF2252:  Uncharacterized protein conserved in bacteria (DUF2252);  InterPro: IPR018721 This domain has no known function.
Probab=78.45  E-value=8.4  Score=38.38  Aligned_cols=49  Identities=20%  Similarity=0.212  Sum_probs=38.7

Q ss_pred             CCCeeeeecCCCCCCeee-eCCCCeEE--EEeeccccCCchhhhHHHHHHHh
Q psy8745          41 KSPVVFCHNDLLLGNIIY-DETEDKVT--FIDYEYAGVNYQAFDIANHFDEF   89 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~-~~~~~~l~--lIDfEya~~n~~~fDiAn~~~E~   89 (317)
                      ..+.|++++|+|.+|+=. .+.++.|+  +=|||=+..++..|||--+....
T Consensus        40 ~~~~v~icGD~Hl~NFG~~~~~~~~~vFdiNDFDEa~~gp~~wDl~Rla~Si   91 (385)
T PF10009_consen   40 SGPPVWICGDAHLENFGAFASPEGRVVFDINDFDEALPGPFEWDLKRLATSI   91 (385)
T ss_pred             CCCceEEeccchhhccCcccCCCCCEEecCCCCCcCCcCChHHHHHHHHHHH
Confidence            467899999999999943 33345555  77999999999999997766543


No 443
>PRK10271 thiK thiamine kinase; Provisional
Probab=78.44  E-value=5.2  Score=36.02  Aligned_cols=56  Identities=13%  Similarity=-0.025  Sum_probs=43.4

Q ss_pred             EEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCCCCCCCcchHHHHHHHhhccccCCCc
Q psy8745         209 VYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHSNMKTPKLWSTGKHMLSLIPRTYSNP  269 (317)
Q Consensus       209 ~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~~~~~p~lw~~i~kwl~~~~~~f~d~  269 (317)
                      +=+|++|.+++..     .....+|..++++|...+.+..=+++..|.++...+.+...++
T Consensus         2 lv~Wl~Ge~~~~~-----~~~~~La~~l~~LH~~p~~~~~~~l~~~i~~Yw~~l~~~~~~~   57 (188)
T PRK10271          2 AVDYLPGEVKSYL-----PDTNELAGLLYHLHQQPRFGWRITLLPLLEQYWQQSDPARRTP   57 (188)
T ss_pred             cccccCCCcCCCc-----cCHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHhccccCCH
Confidence            4589999999855     4778899999999997654444469999999999886654443


No 444
>KOG0582|consensus
Probab=78.02  E-value=3.2  Score=42.28  Aligned_cols=27  Identities=30%  Similarity=0.505  Sum_probs=23.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeec
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYE   71 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfE   71 (317)
                      ..-.|+|++++|||+++ +|.|.|=||.
T Consensus       145 ~G~IHRdvKAgnILi~~-dG~VkLadFg  171 (516)
T KOG0582|consen  145 NGHIHRDVKAGNILIDS-DGTVKLADFG  171 (516)
T ss_pred             cCceecccccccEEEcC-CCcEEEcCce
Confidence            46799999999999987 6889999993


No 445
>KOG0670|consensus
Probab=77.89  E-value=1.6  Score=45.39  Aligned_cols=31  Identities=23%  Similarity=0.378  Sum_probs=25.8

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+.|.|++|.|||++++..-|.|-||--|+
T Consensus       555 c~vlHaDIKPDNiLVNE~k~iLKLCDfGSA~  585 (752)
T KOG0670|consen  555 CGVLHADIKPDNILVNESKNILKLCDFGSAS  585 (752)
T ss_pred             cCeeecccCccceEeccCcceeeeccCcccc
Confidence            4689999999999999866667788887665


No 446
>KOG0662|consensus
Probab=77.89  E-value=2.6  Score=38.42  Aligned_cols=27  Identities=22%  Similarity=0.434  Sum_probs=23.2

Q ss_pred             eecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          47 CHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        47 CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .|+||+|.|+|++. +|.+.+-||-.|.
T Consensus       123 lhrdlkpqnllin~-ngelkladfglar  149 (292)
T KOG0662|consen  123 LHRDLKPQNLLINR-NGELKLADFGLAR  149 (292)
T ss_pred             hhccCCcceEEecc-CCcEEecccchhh
Confidence            46899999999986 7899999997663


No 447
>KOG4717|consensus
Probab=77.58  E-value=2.3  Score=44.27  Aligned_cols=47  Identities=15%  Similarity=0.239  Sum_probs=38.9

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHH
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDE   88 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E   88 (317)
                      ..+-+.|+||+|.|+.+.++-|-|.|-||-|+.---|+--|...+..
T Consensus       135 HqLHVVHRDLKPENVVFFEKlGlVKLTDFGFSNkf~PG~kL~TsCGS  181 (864)
T KOG4717|consen  135 HQLHVVHRDLKPENVVFFEKLGLVKLTDFGFSNKFQPGKKLTTSCGS  181 (864)
T ss_pred             hhhhhhcccCCcceeEEeeecCceEeeeccccccCCCcchhhcccch
Confidence            44667899999999999887888999999999988888777665443


No 448
>KOG0032|consensus
Probab=77.45  E-value=2.2  Score=42.33  Aligned_cols=40  Identities=18%  Similarity=0.312  Sum_probs=32.0

Q ss_pred             CeeeeecCCCCCCeeeeCCC---CeEEEEeeccccCCchhhhH
Q psy8745          43 PVVFCHNDLLLGNIIYDETE---DKVTFIDYEYAGVNYQAFDI   82 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~---~~l~lIDfEya~~n~~~fDi   82 (317)
                      ...++|+|++|.|+|+....   +.+.++||-.+.+..+...+
T Consensus       153 ~~gvvHrDlKpEN~L~~~~~~~~~~ik~~DFGla~~~~~~~~~  195 (382)
T KOG0032|consen  153 SLGVVHRDLKPENLLLASKDEGSGRIKLIDFGLAKFIKPGERL  195 (382)
T ss_pred             hCCceeccCCHHHeeeccccCCCCcEEEeeCCCceEccCCceE
Confidence            37899999999999996432   37999999999887774433


No 449
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=77.44  E-value=3.5  Score=38.71  Aligned_cols=27  Identities=15%  Similarity=0.288  Sum_probs=22.5

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeec
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYE   71 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfE   71 (317)
                      ..++|+|++|.||+++. ++.+.+.|+.
T Consensus       120 ~~iiH~dlkp~Nil~~~-~~~~~l~~~~  146 (327)
T cd08227         120 MGYVHRSVKASHILISV-DGKVYLSGLR  146 (327)
T ss_pred             CCEecCCCChhhEEEec-CCcEEEcccc
Confidence            45899999999999976 5778888874


No 450
>KOG1035|consensus
Probab=77.33  E-value=2.5  Score=47.59  Aligned_cols=32  Identities=28%  Similarity=0.291  Sum_probs=28.3

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++.|+||+|.||.+++ .+.|.+.||-.|..
T Consensus       715 ~~giIHRDLKP~NIFLd~-~~~VKIGDFGLAt~  746 (1351)
T KOG1035|consen  715 DQGIIHRDLKPRNIFLDS-RNSVKIGDFGLATD  746 (1351)
T ss_pred             hCceeeccCCcceeEEcC-CCCeeecccccchh
Confidence            356999999999999986 78899999988886


No 451
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=75.29  E-value=5.2  Score=36.15  Aligned_cols=30  Identities=23%  Similarity=0.387  Sum_probs=25.3

Q ss_pred             eeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          46 FCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        46 ~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ++|+||.+.||++++ ++.+.|-||.++...
T Consensus       124 iiH~~l~~~nill~~-~~~~Kl~~f~~~~~~  153 (259)
T PF07714_consen  124 IIHGNLSPSNILLDS-NGQVKLSDFGLSRPI  153 (259)
T ss_dssp             EEEST-SGGGEEEET-TTEEEEESTTTGEET
T ss_pred             ccccccccccccccc-ccccccccccccccc
Confidence            899999999999987 678999999877654


No 452
>PRK05231 homoserine kinase; Provisional
Probab=75.28  E-value=3.4  Score=38.93  Aligned_cols=34  Identities=15%  Similarity=0.168  Sum_probs=27.0

Q ss_pred             eEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         208 LVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       208 ~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      .+.+|++|+.+...   ++...+.+++.||+||....
T Consensus        99 ~l~~~l~G~~~~~~---~~~~~~~~G~~LA~lH~~~~  132 (319)
T PRK05231         99 AIVTFLEGKWPRAP---TAAHCAEVGEMLARMHLAGR  132 (319)
T ss_pred             EEEEecCCCCCCCC---CHHHHHHHHHHHHHHHhhhh
Confidence            68899999986542   45667889999999998653


No 453
>KOG1989|consensus
Probab=74.65  E-value=3.6  Score=44.32  Aligned_cols=67  Identities=13%  Similarity=0.186  Sum_probs=47.1

Q ss_pred             chhhhhcCCCCHHHHHHHHHHHHHHHhc-CCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhh
Q psy8745          12 SSRFQALFPGGVSQLQSDWQYIETALSK-TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFD   81 (317)
Q Consensus        12 ~~~~~~~~p~~~~~L~~e~~~L~~~l~~-~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fD   81 (317)
                      |.|++..|-  .+++.+-+--+-+.+.. .-.+.=+.|+||+..|||++. ++.++|=||--|+-..+..+
T Consensus       134 n~Rlq~~lt--e~eVLkIf~dv~~AVa~mH~~~pPiIHRDLKiENvLls~-~g~~KLCDFGSatt~~~~~~  201 (738)
T KOG1989|consen  134 NTRLQTRLT--EDEVLKIFYDVCEAVAAMHYLKPPIIHRDLKIENVLLSA-DGNYKLCDFGSATTKILSPT  201 (738)
T ss_pred             HHHHhccCC--hHHHHHHHHHHHHHHHHHhcCCCccchhhhhhhheEEcC-CCCEEeCcccccccccCCCc
Confidence            888888874  55555545444433332 234556899999999999976 67899999988876655553


No 454
>KOG0586|consensus
Probab=74.54  E-value=1.5  Score=45.76  Aligned_cols=45  Identities=27%  Similarity=0.501  Sum_probs=35.9

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHHHhhC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFDEFAG   91 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~E~~~   91 (317)
                      ....+||+||+..||+++. +.++.+-||+++..    ||.+..+..||+
T Consensus       172 H~k~ivHrdLk~eNilL~~-~mnikIaDfgfS~~----~~~~~~lqt~cg  216 (596)
T KOG0586|consen  172 HSKNIVHRDLKAENILLDE-NMNIKIADFGFSTF----FDYGLMLQTFCG  216 (596)
T ss_pred             hhcceeccccchhhccccc-ccceeeecccccee----ecccccccccCC
Confidence            3468999999999999986 56699999999874    556666666665


No 455
>KOG0661|consensus
Probab=74.19  E-value=3  Score=42.71  Aligned_cols=53  Identities=25%  Similarity=0.294  Sum_probs=36.0

Q ss_pred             hhcCCCCHHHHHHHHHHHHHHHhcC--CCCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          16 QALFPGGVSQLQSDWQYIETALSKT--KSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        16 ~~~~p~~~~~L~~e~~~L~~~l~~~--~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...|+  ...++.-+   ...++..  -....|-|+|++|.|||+.. +.-|.+=||-.|.
T Consensus       104 ~r~fs--e~~irnim---~QilqGL~hiHk~GfFHRDlKPENiLi~~-~~~iKiaDFGLAR  158 (538)
T KOG0661|consen  104 NRLFS--ESDIRNIM---YQILQGLAHIHKHGFFHRDLKPENILISG-NDVIKIADFGLAR  158 (538)
T ss_pred             CCcCC--HHHHHHHH---HHHHHHHHHHHhcCcccccCChhheEecc-cceeEeccccccc
Confidence            55565  55555533   3333322  24678999999999999975 5678899997664


No 456
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=74.11  E-value=3  Score=39.19  Aligned_cols=28  Identities=11%  Similarity=0.214  Sum_probs=22.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEY   72 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEy   72 (317)
                      ..++|+|++|.||+++. .+.+.+.|+..
T Consensus       120 ~~ivHrDlkp~Nill~~-~~~~~~~~~~~  147 (328)
T cd08226         120 NGYIHRNIKASHILISG-DGLVSLSGLSH  147 (328)
T ss_pred             CCeecCCCCHHHEEEeC-CCcEEEechHH
Confidence            46899999999999976 57788887643


No 457
>KOG0663|consensus
Probab=73.63  E-value=2.1  Score=42.18  Aligned_cols=32  Identities=19%  Similarity=0.291  Sum_probs=27.4

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...-+.|+||++.|+|++. .|.+.+=||-.|.
T Consensus       194 H~~wilHRDLK~SNLLm~~-~G~lKiaDFGLAR  225 (419)
T KOG0663|consen  194 HDNWILHRDLKTSNLLLSH-KGILKIADFGLAR  225 (419)
T ss_pred             hhceeEecccchhheeecc-CCcEEecccchhh
Confidence            3568899999999999976 6889999997765


No 458
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=73.60  E-value=4.9  Score=36.64  Aligned_cols=31  Identities=13%  Similarity=0.091  Sum_probs=22.6

Q ss_pred             eeeeecCCCCCCeeeeCCC------CeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETE------DKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~------~~l~lIDfEya~   74 (317)
                      ..++|+||+|.||++++..      ..+.+.||..+.
T Consensus       136 ~~iiH~dlkp~Nill~~~~~~~~~~~~~kl~d~g~~~  172 (274)
T cd05076         136 KNLVHGNVCAKNILLARLGLAEGTSPFIKLSDPGVSF  172 (274)
T ss_pred             CCccCCCCCcccEEEeccCcccCccceeeecCCcccc
Confidence            4579999999999996421      236788887553


No 459
>KOG0585|consensus
Probab=72.60  E-value=2.3  Score=43.64  Aligned_cols=32  Identities=16%  Similarity=0.262  Sum_probs=27.3

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ..+.|+|++|.|+|+++ .|.|.+=||--+..-
T Consensus       229 QgiiHRDIKPsNLLl~~-~g~VKIsDFGVs~~~  260 (576)
T KOG0585|consen  229 QGIIHRDIKPSNLLLSS-DGTVKISDFGVSNEF  260 (576)
T ss_pred             cCeeccccchhheEEcC-CCcEEeeccceeeec
Confidence            57899999999999987 589999999766643


No 460
>KOG0192|consensus
Probab=72.35  E-value=5.6  Score=39.23  Aligned_cols=33  Identities=21%  Similarity=0.297  Sum_probs=26.4

Q ss_pred             eeecCCCCCCeeeeCCCCeEEEEeeccccCCch
Q psy8745          46 FCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQ   78 (317)
Q Consensus        46 ~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~   78 (317)
                      +.|+||++.|||++.+...+.+=||-.+..-..
T Consensus       164 iIHrDLK~~NiLv~~~~~~~KI~DFGlsr~~~~  196 (362)
T KOG0192|consen  164 IIHRDLKSDNILVDLKGKTLKIADFGLSREKVI  196 (362)
T ss_pred             eeecccChhhEEEcCCCCEEEECCCccceeecc
Confidence            999999999999987323788999988765443


No 461
>COG3281 Ble Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]
Probab=72.18  E-value=2.1  Score=42.33  Aligned_cols=44  Identities=25%  Similarity=0.417  Sum_probs=34.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccc---------cCCchhhhHHHHHHHh
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYA---------GVNYQAFDIANHFDEF   89 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya---------~~n~~~fDiAn~~~E~   89 (317)
                      +.=.|+||+-+-+|+.  +++.+|||||-=         -...|.-|+|..+..+
T Consensus       284 l~RvHGDLHLgQVLvt--~g~~~liDFEGEPsRpl~err~~~sPlrDvAgllRS~  336 (438)
T COG3281         284 LQRVHGDLHLGQVLVT--PGRALLIDFEGEPSRPLDERRAPDSPLRDVAGLLRSF  336 (438)
T ss_pred             HHHHhccceehheeee--CCcEEEEecCCCCCCChhhccCCCCchHHHHHHHHHh
Confidence            3457999999999996  589999999852         3456778888887753


No 462
>KOG0664|consensus
Probab=71.73  E-value=2.4  Score=40.88  Aligned_cols=30  Identities=20%  Similarity=0.356  Sum_probs=24.4

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ..+.|+|++|||+|+++ +--+.+-||-.|.
T Consensus       175 A~ILHRDIKPGNLLVNS-NCvLKICDFGLAR  204 (449)
T KOG0664|consen  175 ANILHRDIKPGNLLVNS-NCILKICDFGLAR  204 (449)
T ss_pred             cchhhccCCCccEEecc-CceEEeccccccc
Confidence            46789999999999986 4556688987765


No 463
>KOG0579|consensus
Probab=71.40  E-value=4  Score=43.58  Aligned_cols=32  Identities=25%  Similarity=0.431  Sum_probs=26.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      .-+.|+||+.||||+.- +|.|.|-||--+.-|
T Consensus       149 ~~iIHRDLKAGNiL~Tl-dGdirLADFGVSAKn  180 (1187)
T KOG0579|consen  149 QNIIHRDLKAGNILLTL-DGDIRLADFGVSAKN  180 (1187)
T ss_pred             cchhhhhccccceEEEe-cCcEeeecccccccc
Confidence            46799999999999975 688999999876543


No 464
>KOG3087|consensus
Probab=71.29  E-value=5.1  Score=36.72  Aligned_cols=59  Identities=19%  Similarity=0.326  Sum_probs=39.2

Q ss_pred             CcchhhhhcCC-CCceEEE--ecCceEEEeecCc---------cCCCCCCCC--cccHHHHHHHHHhhcccCC
Q psy8745         186 PSPQILHRAGL-APRLYAE--FDNGLVYQYVRGV---------TITPDSIRE--PHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       186 ~~~~~L~~~~~-gp~l~g~--F~nG~~e~fi~g~---------tL~~~~l~~--~~i~~~IA~~la~~H~~~~  244 (317)
                      +.+..+...|+ +|+||.+  -.|-..=|||+|-         ++.++.--.  ..+.+.|.+.++++|.-..
T Consensus        62 r~l~k~~~~GI~~P~l~~~D~~~~~i~ME~~~g~~~vk~~i~~~~~~~~~d~~~~~~~~~iG~~igklH~ndi  134 (229)
T KOG3087|consen   62 RLLAKCRALGIPAPRLIFIDTYGGQIYMEFIDGASTVKDFILSTMEDESEDEGLAELARRIGELIGKLHDNDI  134 (229)
T ss_pred             HHHHHHHHhCCCCceEEEEecCCCeEEEEeccchhHHHHHHHHHccCcccchhHHHHHHHHHHHHHHhhhCCe
Confidence            34456667788 8888874  3444566999992         233332222  2578899999999997653


No 465
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=70.59  E-value=2.5  Score=37.00  Aligned_cols=30  Identities=30%  Similarity=0.422  Sum_probs=25.4

Q ss_pred             eeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          45 VFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        45 v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      .++|+|+.|.||+++.....+.++||..+.
T Consensus       121 ~~~hrd~kp~nil~~~~~~~~~l~dfg~~~  150 (384)
T COG0515         121 GIIHRDIKPENILLDRDGRVVKLIDFGLAK  150 (384)
T ss_pred             CeeccCCCHHHeeecCCCCeEEEeccCcce
Confidence            499999999999998632369999999887


No 466
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with 
Probab=69.97  E-value=5.4  Score=37.64  Aligned_cols=32  Identities=25%  Similarity=0.279  Sum_probs=28.0

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ...++.=+|-+++|||++...|+++-|||.++
T Consensus       179 ~~YilglgDRH~~NIll~~~tG~v~HIDfg~~  210 (280)
T cd05169         179 VGYILGLGDRHPSNIMIDRLTGKVIHIDFGDC  210 (280)
T ss_pred             HHhheeccCCCcceEEEEcCCCCEEEEecHHH
Confidence            45788899999999999987899999999655


No 467
>KOG2268|consensus
Probab=69.92  E-value=7.2  Score=38.78  Aligned_cols=27  Identities=30%  Similarity=0.460  Sum_probs=23.9

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeec
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYE   71 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfE   71 (317)
                      ..+.|+|++.=|||+.+ .+.+++|||-
T Consensus       221 ~GlIHgDFNEFNimv~d-d~~i~vIDFP  247 (465)
T KOG2268|consen  221 HGLIHGDFNEFNIMVKD-DDKIVVIDFP  247 (465)
T ss_pred             cCceecccchheeEEec-CCCEEEeech
Confidence            47899999999999986 6789999994


No 468
>KOG0604|consensus
Probab=68.85  E-value=5.3  Score=39.02  Aligned_cols=42  Identities=21%  Similarity=0.401  Sum_probs=32.1

Q ss_pred             CeeeeecCCCCCCeeeeCC--CCeEEEEeeccccCCchhhhHHH
Q psy8745          43 PVVFCHNDLLLGNIIYDET--EDKVTFIDYEYAGVNYQAFDIAN   84 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~--~~~l~lIDfEya~~n~~~fDiAn   84 (317)
                      ..-+.|+|++|.|+|+.++  +-.+.|-||-||.-...-.|+-.
T Consensus       179 ~~nIAHRDlKpENLLyt~t~~na~lKLtDfGFAK~t~~~~~L~T  222 (400)
T KOG0604|consen  179 SMNIAHRDLKPENLLYTTTSPNAPLKLTDFGFAKETQEPGDLMT  222 (400)
T ss_pred             hcchhhccCChhheeeecCCCCcceEecccccccccCCCccccC
Confidence            3568999999999999653  23577999999987776555543


No 469
>KOG0591|consensus
Probab=68.64  E-value=7.3  Score=37.82  Aligned_cols=31  Identities=19%  Similarity=0.244  Sum_probs=25.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      ...+.|+|++|+||.++. +|.|.|=||-.+.
T Consensus       146 r~~VmHRDIKPaNIFl~~-~gvvKLGDfGL~r  176 (375)
T KOG0591|consen  146 RGTVMHRDIKPANIFLTA-NGVVKLGDFGLGR  176 (375)
T ss_pred             ccceeeccCcchheEEcC-CCceeeccchhHh
Confidence            356899999999999986 6888899986544


No 470
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the 
Probab=68.44  E-value=4.5  Score=36.82  Aligned_cols=39  Identities=21%  Similarity=0.243  Sum_probs=32.0

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAF   80 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~f   80 (317)
                      ...++.=+|-+++|||++..+|.+.-|||.++--..+.+
T Consensus       126 ~~YilglgDRh~~NIli~~~~G~~~hIDfg~~~~~~~~~  164 (219)
T cd00142         126 AGYILGIGDRHPDNIMIDLDTGKLFHIDFGFIFGKRKKF  164 (219)
T ss_pred             HHHHhccCCCCCccEEEECCCCeEEEEeeHHhhCcCcCC
Confidence            356888899999999999768999999998876555443


No 471
>KOG0607|consensus
Probab=68.21  E-value=7.5  Score=38.38  Aligned_cols=49  Identities=20%  Similarity=0.251  Sum_probs=32.6

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCC--CeEEEEeeccccC
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETE--DKVTFIDYEYAGV   75 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~--~~l~lIDfEya~~   75 (317)
                      ...+.+++..-.++|..    ..+.|+||+|.|||-.+.+  ..|.+-|||.++-
T Consensus       178 As~vvkdia~aLdFlH~----kgIAHRDlKPENiLC~~pn~vsPvKiCDfDLgSg  228 (463)
T KOG0607|consen  178 ASRVVKDIASALDFLHT----KGIAHRDLKPENILCESPNKVSPVKICDFDLGSG  228 (463)
T ss_pred             HHHHHHHHHHHHHHHhh----cCcccccCCccceeecCCCCcCceeeeccccccc
Confidence            33444455444445443    5699999999999975421  3578999988763


No 472
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=68.08  E-value=8.5  Score=35.63  Aligned_cols=35  Identities=23%  Similarity=0.134  Sum_probs=29.5

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++.=+|-+++|||++...|++.-|||.++--+
T Consensus       134 ~~YilglgDRH~~NIli~~~tG~v~HIDfg~~f~~  168 (235)
T cd05172         134 SHWILGIGDRHLSNFLVDLETGGLVGIDFGHAFGT  168 (235)
T ss_pred             HhheeeccCCCcccEEEECCCCcEEEEeeHhhhcc
Confidence            45789999999999999866799999999866533


No 473
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=67.96  E-value=5.5  Score=44.49  Aligned_cols=31  Identities=19%  Similarity=0.171  Sum_probs=23.8

Q ss_pred             eeeeecCCCCCCeeeeCC----------------CCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDET----------------EDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~----------------~~~l~lIDfEya~   74 (317)
                      ..++|+||+|.|||++..                ...+.|+||..+.
T Consensus       144 k~IVHRDLKPeNILL~s~~~~lg~i~~~~~n~ng~~iVKLsDFGlAr  190 (1021)
T PTZ00266        144 ERVLHRDLKPQNIFLSTGIRHIGKITAQANNLNGRPIAKIGDFGLSK  190 (1021)
T ss_pred             CCceeccCcHHHeEeecCccccccccccccccCCCCceEEccCCccc
Confidence            458999999999999531                1237899998765


No 474
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=67.93  E-value=4.6  Score=38.10  Aligned_cols=39  Identities=28%  Similarity=0.315  Sum_probs=31.7

Q ss_pred             EEecCceEEEeec-CccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         202 AEFDNGLVYQYVR-GVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       202 g~F~nG~~e~fi~-g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      +.+.++++.+|+. |++|+++    ..-...||..|+++|...+
T Consensus        59 ~~~~~~~~~q~~~~~~~l~~~----~~~~~~ia~~L~~lH~~~~   98 (269)
T COG0510          59 IANGGVLVAQYWENGRTLTPE----DMNLKKIAHILKKLHNSVP   98 (269)
T ss_pred             cccCCceEEeeeccccccCcc----ccchHHHHHHHHHhcCccc
Confidence            5677899999888 5788888    5567779999999999654


No 475
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=67.84  E-value=6.5  Score=37.02  Aligned_cols=47  Identities=17%  Similarity=0.208  Sum_probs=32.6

Q ss_pred             CceEEEecCceEEEeecCccCCCCCC-------------CCcccHHHHHHHHHhhcccCC
Q psy8745         198 PRLYAEFDNGLVYQYVRGVTITPDSI-------------REPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       198 p~l~g~F~nG~~e~fi~g~tL~~~~l-------------~~~~i~~~IA~~la~~H~~~~  244 (317)
                      |++++.-++..+|++|+|.++..-+.             ..+.+...+|+-|+++|.+..
T Consensus        71 P~~~~~~~~~~~y~~i~G~p~~~~~~~~~~~~~~~~~~~~~~~la~~la~~La~LH~i~~  130 (276)
T cd05152          71 PDWRVHTPELIAYPKLPGVPAATIDPEIGEYVWNFDHKNPPEVFIESLAKALAELHSIPQ  130 (276)
T ss_pred             CceeeecCceEEEeccCCCcccccCcccccceecccCCCcCHHHHHHHHHHHHHHhCCCh
Confidence            44444445567899999997753222             123477889999999999865


No 476
>KOG0671|consensus
Probab=67.77  E-value=9.4  Score=38.15  Aligned_cols=33  Identities=24%  Similarity=0.415  Sum_probs=24.5

Q ss_pred             CeeeeecCCCCCCeeeeCC-------------------CCeEEEEeeccccC
Q psy8745          43 PVVFCHNDLLLGNIIYDET-------------------EDKVTFIDYEYAGV   75 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~-------------------~~~l~lIDfEya~~   75 (317)
                      ...+.|=||+|.|||+-++                   .-.|.+|||--|.+
T Consensus       210 ~~kl~HTDLKPENILfvss~~~~~~~~k~~~~~~r~~ks~~I~vIDFGsAtf  261 (415)
T KOG0671|consen  210 DLKLTHTDLKPENILFVSSEYFKTYNPKKKVCFIRPLKSTAIKVIDFGSATF  261 (415)
T ss_pred             hcceeecCCChheEEEeccceEEEeccCCccceeccCCCcceEEEecCCcce
Confidence            4789999999999997321                   12478999866654


No 477
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=67.66  E-value=6.2  Score=36.64  Aligned_cols=39  Identities=13%  Similarity=0.256  Sum_probs=29.4

Q ss_pred             CceEEEeecCccCCCCCCCCcccHHHHHHHHHhhcccCC
Q psy8745         206 NGLVYQYVRGVTITPDSIREPHIHPLVARNMARLHKVHS  244 (317)
Q Consensus       206 nG~~e~fi~g~tL~~~~l~~~~i~~~IA~~la~~H~~~~  244 (317)
                      ..++.||++|.+|..-.-.+..+...|+..|+++|....
T Consensus       118 ~~lvmEyi~G~tL~~~~~~~~~~~~~i~~~l~~lH~~gi  156 (232)
T PRK10359        118 YIMLIEYIEGVELNDMPEISEDVKAKIKASIESLHQHGM  156 (232)
T ss_pred             eEEEEEEECCccHHHhhhccHHHHHHHHHHHHHHHHcCC
Confidence            346999999998855433345667799999999998654


No 478
>KOG4236|consensus
Probab=67.59  E-value=3.4  Score=43.14  Aligned_cols=32  Identities=22%  Similarity=0.407  Sum_probs=26.4

Q ss_pred             eeeeecCCCCCCeeeeCCC--CeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETE--DKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~--~~l~lIDfEya~~   75 (317)
                      .-+.|+||+|.|+|+.+..  -++.|-||-||..
T Consensus       683 knIvHCDLKPENVLLas~~~FPQvKlCDFGfARi  716 (888)
T KOG4236|consen  683 KNIVHCDLKPENVLLASASPFPQVKLCDFGFARI  716 (888)
T ss_pred             cceeeccCCchheeeccCCCCCceeeccccceee
Confidence            5689999999999996532  3799999999874


No 479
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=67.50  E-value=5.1  Score=38.00  Aligned_cols=31  Identities=29%  Similarity=0.332  Sum_probs=27.7

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ..++.=+|-+++|||++...|.|+-|||.++
T Consensus       180 ~yilglgDRh~~NIll~~~tG~v~hiDf~~~  210 (279)
T cd05171         180 GYILGLGDRHANNILIDEKTAEVVHIDLGIA  210 (279)
T ss_pred             HHhhccCCCCcccEEEEcCcCcEEEEechhh
Confidence            4688889999999999876799999999886


No 480
>PRK10593 hypothetical protein; Provisional
Probab=67.30  E-value=6.5  Score=37.35  Aligned_cols=58  Identities=22%  Similarity=0.512  Sum_probs=40.5

Q ss_pred             CcchhhhhcC-C-CCceEEEec-------CceEEEeecCccCCCCCCCCc----ccHHHHHHHHHhhcccCC
Q psy8745         186 PSPQILHRAG-L-APRLYAEFD-------NGLVYQYVRGVTITPDSIREP----HIHPLVARNMARLHKVHS  244 (317)
Q Consensus       186 ~~~~~L~~~~-~-gp~l~g~F~-------nG~~e~fi~g~tL~~~~l~~~----~i~~~IA~~la~~H~~~~  244 (317)
                      ..+..|.+.+ + -|++|+...       .+.|-|+|+|.++.... ..+    .+...+|+.||++|....
T Consensus        59 ~~L~~L~~~~~vpVP~V~~~~~~~~~~g~~~LVmE~i~G~~~~~~~-~~~~~~~~l~~~l~~~La~LH~~~~  129 (297)
T PRK10593         59 WKLSMLARSGTVRMPTVYGVMTHEQSPGPDVLLLERLRGVSVEAPA-RTPERWEQLKDQIVEGLLAWHRIDS  129 (297)
T ss_pred             HHHHHHccCCCCCcCcEEEEeccCCcCCCeEEEEeccCCEecCCCC-CCHHHHHHHHHHHHHHHHHHhCCCh
Confidence            4456677764 3 899998653       46899999999887522 222    234456799999999764


No 481
>KOG1152|consensus
Probab=66.69  E-value=4.7  Score=42.46  Aligned_cols=33  Identities=27%  Similarity=0.335  Sum_probs=29.0

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ....+.|+|++-.|+++++ +|-+.||||--|.|
T Consensus       687 h~~~ivhrdikdenvivd~-~g~~klidfgsaa~  719 (772)
T KOG1152|consen  687 HDQGIVHRDIKDENVIVDS-NGFVKLIDFGSAAY  719 (772)
T ss_pred             cccCceecccccccEEEec-CCeEEEeeccchhh
Confidence            5678999999999999987 68899999987765


No 482
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=66.38  E-value=6.9  Score=37.52  Aligned_cols=31  Identities=19%  Similarity=0.242  Sum_probs=22.1

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccC
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGV   75 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~   75 (317)
                      ..++|+|+.+.|++++. +|.+.|=||..+-.
T Consensus       164 ~GlVHgdi~~~nfll~~-~G~v~Lg~F~~~~r  194 (288)
T PF14531_consen  164 YGLVHGDIKPENFLLDQ-DGGVFLGDFSSLVR  194 (288)
T ss_dssp             TTEEEST-SGGGEEE-T-TS-EEE--GGGEEE
T ss_pred             cceEecccceeeEEEcC-CCCEEEcChHHHee
Confidence            46999999999999987 68999999987653


No 483
>KOG0590|consensus
Probab=66.15  E-value=4.9  Score=42.31  Aligned_cols=39  Identities=26%  Similarity=0.410  Sum_probs=32.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFD   81 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fD   81 (317)
                      ...+++|+|+++.|+++.. .+.+.++||--+...--.++
T Consensus       437 h~~GiahrdlK~enll~~~-~g~lki~Dfg~~~vf~~~~e  475 (601)
T KOG0590|consen  437 HSMGLAHRDLKLENLLVTE-NGILKIIDFGAASVFRYPWE  475 (601)
T ss_pred             HhcCceeccCccccEEEec-CCceEEeecCcceeeccCcc
Confidence            4579999999999999986 57899999988886655554


No 484
>KOG0695|consensus
Probab=64.59  E-value=5.8  Score=39.33  Aligned_cols=79  Identities=22%  Similarity=0.280  Sum_probs=60.9

Q ss_pred             cccchhhcchhhhhcCCCCHHH-HHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhH
Q psy8745           4 QSGAGLMFSSRFQALFPGGVSQ-LQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDI   82 (317)
Q Consensus         4 ~~~~~~~~~~~~~~~~p~~~~~-L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDi   82 (317)
                      +-|--+||+-+-+..+|..-+. ...|+.....+|..    -.+.-+||+-.|+|++. +|.+.|-||-.|.-|-.-=|.
T Consensus       333 v~ggdlmfhmqrqrklpeeharfys~ei~lal~flh~----rgiiyrdlkldnvllda-eghikltdygmcke~l~~gd~  407 (593)
T KOG0695|consen  333 VNGGDLMFHMQRQRKLPEEHARFYSAEICLALNFLHE----RGIIYRDLKLDNVLLDA-EGHIKLTDYGMCKEGLGPGDT  407 (593)
T ss_pred             ecCcceeeehhhhhcCcHHHhhhhhHHHHHHHHHHhh----cCeeeeeccccceEEcc-CCceeecccchhhcCCCCCcc
Confidence            4577889987778888854333 34466555555544    46788999999999986 799999999999988888888


Q ss_pred             HHHHH
Q psy8745          83 ANHFD   87 (317)
Q Consensus        83 An~~~   87 (317)
                      ...||
T Consensus       408 tstfc  412 (593)
T KOG0695|consen  408 TSTFC  412 (593)
T ss_pred             ccccc
Confidence            88766


No 485
>KOG0193|consensus
Probab=64.58  E-value=5.6  Score=41.86  Aligned_cols=35  Identities=31%  Similarity=0.310  Sum_probs=30.7

Q ss_pred             eeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          44 VVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      .-+.|.||+.+||++.+ ++.|++=||-.++..-++
T Consensus       507 K~IIHrDLKSnNIFl~~-~~kVkIgDFGLatvk~~w  541 (678)
T KOG0193|consen  507 KNIIHRDLKSNNIFLHE-DLKVKIGDFGLATVKTRW  541 (678)
T ss_pred             hhhhhhhccccceEEcc-CCcEEEecccceeeeeee
Confidence            57899999999999976 588999999999987766


No 486
>KOG0666|consensus
Probab=63.98  E-value=5  Score=39.42  Aligned_cols=31  Identities=26%  Similarity=0.247  Sum_probs=23.8

Q ss_pred             eeeeecCCCCCCeeeeCC---CCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDET---EDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~---~~~l~lIDfEya~   74 (317)
                      .-+.|+||+|.|||+..+   .|.|.+=|+-+|.
T Consensus       151 NWvlHRDLKPaNIlvmgdgperG~VKIaDlGlaR  184 (438)
T KOG0666|consen  151 NWVLHRDLKPANILVMGDGPERGRVKIADLGLAR  184 (438)
T ss_pred             hheeeccCCcceEEEeccCCccCeeEeecccHHH
Confidence            456899999999998642   3678888877653


No 487
>KOG0694|consensus
Probab=63.09  E-value=4.9  Score=42.65  Aligned_cols=60  Identities=18%  Similarity=0.141  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchhhhHHHHHH
Q psy8745          23 VSQLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQAFDIANHFD   87 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~fDiAn~~~   87 (317)
                      .-...+|+-.-..+|..    ..+.++||+-.|||+|. +|.+.|.||-.|.-+--.-|-+..||
T Consensus       470 arfyaAev~l~L~fLH~----~~IIYRDlKLdNiLLD~-eGh~kiADFGlcKe~m~~g~~TsTfC  529 (694)
T KOG0694|consen  470 ARFYAAEVVLGLQFLHE----NGIIYRDLKLDNLLLDT-EGHVKIADFGLCKEGMGQGDRTSTFC  529 (694)
T ss_pred             HHHHHHHHHHHHHHHHh----cCceeeecchhheEEcc-cCcEEecccccccccCCCCCcccccc
Confidence            44455666655556654    57899999999999987 79999999999987766666666655


No 488
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=62.97  E-value=5.7  Score=38.25  Aligned_cols=31  Identities=29%  Similarity=0.380  Sum_probs=27.4

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ..|+.=+|-+++|||++...|+++-|||.++
T Consensus       208 ~yilglgDRh~~NIli~~~tG~v~hiDf~~~  238 (307)
T cd05170         208 GYVIGLGDRHLDNVLIDLKTGEVVHIDYNVC  238 (307)
T ss_pred             HHHccCCCCCCccEEEEcCCCcEEEEeeHhh
Confidence            4688889999999999976899999999875


No 489
>PF10707 YrbL-PhoP_reg:  PhoP regulatory network protein YrbL;  InterPro: IPR019647  This entry represents proteins that are activated by the protein PhoP. PhoP controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multi-component loop in Salmonella sp., where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner []. 
Probab=61.62  E-value=16  Score=32.91  Aligned_cols=42  Identities=19%  Similarity=0.214  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHhcCCCCeeeeecCCCCCCeeeeCC--CC-eEEEEee
Q psy8745          25 QLQSDWQYIETALSKTKSPVVFCHNDLLLGNIIYDET--ED-KVTFIDY   70 (317)
Q Consensus        25 ~L~~e~~~L~~~l~~~~~~~v~CHnDl~~~NiL~~~~--~~-~l~lIDf   70 (317)
                      .+.+.++.+.+.+-    ..-++.+|+.++||++...  +. ++++||-
T Consensus       122 ~~~~~L~~f~~~l~----~~~Iv~~dl~~~NIv~~~~~~~~~~lvlIDG  166 (199)
T PF10707_consen  122 ELRQALDEFKRYLL----DHHIVIRDLNPHNIVVQRRDSGEFRLVLIDG  166 (199)
T ss_pred             HHHHHHHHHHHHHH----HcCCeecCCCcccEEEEecCCCceEEEEEeC
Confidence            34444444444442    2345566999999998532  23 6889997


No 490
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central 
Probab=61.54  E-value=6.9  Score=36.26  Aligned_cols=35  Identities=17%  Similarity=0.221  Sum_probs=29.2

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++.=+|-+++|||++...|.+.-|||.++--+
T Consensus       137 ~~YilgigDRh~~NIli~~~tG~~~HIDfg~~~~~  171 (237)
T cd00892         137 VGYILGLGDRHGENILFDSNTGDVVHVDFNCLFDK  171 (237)
T ss_pred             HHHHhccCCCCcccEEEEcCCCcEEEEehHhhhcc
Confidence            35688889999999999976899999999776543


No 491
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes,  including cell motility, the Ras pathway, vesicle trafficking and  secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=61.51  E-value=6.6  Score=35.23  Aligned_cols=37  Identities=19%  Similarity=0.187  Sum_probs=30.3

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCCchh
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVNYQA   79 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n~~~   79 (317)
                      ...++.=+|-+++|||++ +.|++.-|||.++--..+.
T Consensus        99 ~~YilglgDRh~~NIli~-~~G~v~hIDfg~~~~~~~~  135 (202)
T smart00146       99 ITYILGLGDRHNDNIMLD-KTGHLFHIDFGFILGNGPK  135 (202)
T ss_pred             HHHHhcCCCCCCCcEEEe-CCCCEEEEechhhhCcccc
Confidence            346778899999999999 5899999999887655543


No 492
>KOG0584|consensus
Probab=59.90  E-value=12  Score=39.58  Aligned_cols=52  Identities=21%  Similarity=0.170  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHHHHHHhc-CCCCeeeeecCCCCCCeeeeCCCCeEEEEeecccc
Q psy8745          23 VSQLQSDWQYIETALSK-TKSPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAG   74 (317)
Q Consensus        23 ~~~L~~e~~~L~~~l~~-~~~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~   74 (317)
                      +-.++.+...|.+-|.- .....=+.|+||++.||.++++.|.|.+=|.-.|.
T Consensus       142 ~kaik~W~RQILkGL~yLHs~~PPIIHRDLKCDNIFinG~~G~VKIGDLGLAt  194 (632)
T KOG0584|consen  142 IKAIKSWCRQILKGLVYLHSQDPPIIHRDLKCDNIFVNGNLGEVKIGDLGLAT  194 (632)
T ss_pred             HHHHHHHHHHHHHHhhhhhcCCCCccccccccceEEEcCCcCceeecchhHHH
Confidence            34555555444333321 11223458999999999999888999998876654


No 493
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=59.59  E-value=6.2  Score=36.15  Aligned_cols=35  Identities=23%  Similarity=0.263  Sum_probs=29.2

Q ss_pred             CCeeeeecCCCCCCeeeeCCCCeEEEEeeccccCC
Q psy8745          42 SPVVFCHNDLLLGNIIYDETEDKVTFIDYEYAGVN   76 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya~~n   76 (317)
                      ...++.=+|-+++|||++...|.+.-|||.++--.
T Consensus       129 ~~YvlglgDRh~~NIli~~~tG~v~hIDf~~~~~~  163 (222)
T cd05164         129 VGYILGLGDRHLDNILIDRETGEVVHIDFGCIFEK  163 (222)
T ss_pred             HHHHhccCCCCCceEEEECCCCcEEEEccHHhhcc
Confidence            35688889999999999987899999999776433


No 494
>KOG1027|consensus
Probab=58.88  E-value=9.3  Score=41.63  Aligned_cols=31  Identities=19%  Similarity=0.284  Sum_probs=24.4

Q ss_pred             eeeeecCCCCCCeeeeCC----CCeEEEEeecccc
Q psy8745          44 VVFCHNDLLLGNIIYDET----EDKVTFIDYEYAG   74 (317)
Q Consensus        44 ~v~CHnDl~~~NiL~~~~----~~~l~lIDfEya~   74 (317)
                      .-+.|+||+|.|||+...    ..+..+=||..|-
T Consensus       625 l~iVHRDLkPQNILI~~~~~~~~~ra~iSDfglsK  659 (903)
T KOG1027|consen  625 LKIVHRDLKPQNILISVPSADGTLRAKISDFGLSK  659 (903)
T ss_pred             cccccccCCCceEEEEccCCCcceeEEeccccccc
Confidence            788999999999999652    2356788987764


No 495
>PRK14705 glycogen branching enzyme; Provisional
Probab=58.41  E-value=19  Score=41.14  Aligned_cols=49  Identities=20%  Similarity=0.330  Sum_probs=37.3

Q ss_pred             CCeeeeecCCCCCCeeeeCC----CCeEEEEeecc---------ccCCchhhhHHHHHHHhh
Q psy8745          42 SPVVFCHNDLLLGNIIYDET----EDKVTFIDYEY---------AGVNYQAFDIANHFDEFA   90 (317)
Q Consensus        42 ~~~v~CHnDl~~~NiL~~~~----~~~l~lIDfEy---------a~~n~~~fDiAn~~~E~~   90 (317)
                      .+..=||+|++-|.+|+..+    .+..+|||||=         -....|.-|+|-.+..+-
T Consensus       329 ~~~~RIHGD~HLGQVL~t~~D~~~~~~~~IIDFEGEP~RpL~ERR~k~sPLRDVAGMLRSFd  390 (1224)
T PRK14705        329 GQLQRIHGDLHLGQILQVPGAEGQPERWAILDFEGEPLRPIDERNSPDVPLRDVTGMLRSFD  390 (1224)
T ss_pred             cceEEEecccccccEEEecCCCCccCCEEEEecCCCCCCChhhhccCCChHHHHHHHHHHHH
Confidence            46677999999999999642    24599999985         234567888888887653


No 496
>PF05445 Pox_ser-thr_kin:  Poxvirus serine/threonine protein kinase;  InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly. ; GO: 0004672 protein kinase activity, 0005524 ATP binding
Probab=58.20  E-value=8.2  Score=38.50  Aligned_cols=20  Identities=30%  Similarity=0.268  Sum_probs=16.6

Q ss_pred             CCCeeeeecCCCCCCeeeeC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDE   60 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~   60 (317)
                      +...-|.|+||+|+|||+-+
T Consensus       295 p~c~nF~H~DLKPdNILiFd  314 (434)
T PF05445_consen  295 PCCTNFLHVDLKPDNILIFD  314 (434)
T ss_pred             CCcceeeecccCcCcEEEec
Confidence            44578999999999999754


No 497
>cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat
Probab=57.50  E-value=10  Score=35.57  Aligned_cols=31  Identities=13%  Similarity=0.050  Sum_probs=27.2

Q ss_pred             CeeeeecCCCCCCeeeeCCCCeEEEEeeccc
Q psy8745          43 PVVFCHNDLLLGNIIYDETEDKVTFIDYEYA   73 (317)
Q Consensus        43 ~~v~CHnDl~~~NiL~~~~~~~l~lIDfEya   73 (317)
                      ..++.=+|-+++||+++.+.|+|+-|||..+
T Consensus       153 gYilglgdRh~~nili~~~tG~v~hiDf~~~  183 (253)
T cd05163         153 TYILSINNRNPDKIFISRDTGNVYQSDLLPS  183 (253)
T ss_pred             HHHhcCCCCCchhEEEEcCCCcEEEEeeeee
Confidence            4678889999999999987899999999754


No 498
>PHA03111 Ser/Thr kinase; Provisional
Probab=57.45  E-value=17  Score=36.16  Aligned_cols=21  Identities=29%  Similarity=0.233  Sum_probs=17.0

Q ss_pred             CCCeeeeecCCCCCCeeeeCC
Q psy8745          41 KSPVVFCHNDLLLGNIIYDET   61 (317)
Q Consensus        41 ~~~~v~CHnDl~~~NiL~~~~   61 (317)
                      +...-|.|+||+|+|||+-++
T Consensus       299 p~c~nF~H~DLKPdNILiFds  319 (444)
T PHA03111        299 PCCDNFLHVDLKPDNILIFDS  319 (444)
T ss_pred             CCcceeeeccCCCCcEEEecC
Confidence            445789999999999998543


No 499
>smart00090 RIO RIO-like kinase.
Probab=56.59  E-value=18  Score=33.21  Aligned_cols=55  Identities=24%  Similarity=0.309  Sum_probs=37.0

Q ss_pred             hhhhhcCC-CCceEEEecCceEEEeecCccCCCCCCCCc--------ccHHHHHHHHHhhcccC
Q psy8745         189 QILHRAGL-APRLYAEFDNGLVYQYVRGVTITPDSIREP--------HIHPLVARNMARLHKVH  243 (317)
Q Consensus       189 ~~L~~~~~-gp~l~g~F~nG~~e~fi~g~tL~~~~l~~~--------~i~~~IA~~la~~H~~~  243 (317)
                      ..|...++ -|++++.-....|.||++|.+|....+.++        .+...|+..|+.+|...
T Consensus       105 ~~L~~~~i~~p~~~~~~~~~lV~E~~~g~~L~~~~~~~~~~~~~~~~~i~~qi~~~l~~LH~~g  168 (237)
T smart00090      105 QRLYEAGVPVPKPIAWRRNVLVMEFIGGDGLPAPRLKDVEPEEEEEFELYDDILEEMRKLYKEG  168 (237)
T ss_pred             HHHHhcCCCCCeeeEecCceEEEEEecCCcccccccccCCcchHHHHHHHHHHHHHHHHHHhcC
Confidence            33444343 366666556789999999987754333322        57778888889999766


No 500
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=56.49  E-value=6.8  Score=35.51  Aligned_cols=39  Identities=18%  Similarity=0.342  Sum_probs=28.8

Q ss_pred             eeeeecCCCCC--CeeeeCCCCeEEEEeeccccCCchhhhHHH
Q psy8745          44 VVFCHNDLLLG--NIIYDETEDKVTFIDYEYAGVNYQAFDIAN   84 (317)
Q Consensus        44 ~v~CHnDl~~~--NiL~~~~~~~l~lIDfEya~~n~~~fDiAn   84 (317)
                      ..+-|+.++-.  |+++++  +++++||||-|.++...=-+..
T Consensus       124 ~GI~H~El~~~~k~vlv~~--~~~~iIDFd~At~k~~p~N~Tq  164 (201)
T COG2112         124 LGIEHGELSRPWKNVLVND--RDVYIIDFDSATFKKKPRNVTQ  164 (201)
T ss_pred             hccchhhhcCCceeEEecC--CcEEEEEccchhhccCCchHHH
Confidence            57788888765  888853  5899999999996655444433


Done!