Query         psy8783
Match_columns 74
No_of_seqs    40 out of 42
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 19:11:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8783.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8783hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4659|consensus               99.7 3.1E-18 6.7E-23  150.2   3.8   70    2-72   1727-1803(1899)
  2 PF00735 Septin:  Septin;  Inte  53.8      14  0.0003   27.7   2.7   28   26-53    117-145 (281)
  3 TIGR00466 kdsB 3-deoxy-D-manno  49.9      14 0.00031   26.3   2.2   27   32-58    197-223 (238)
  4 PF04074 DUF386:  Domain of unk  45.3      26 0.00057   23.6   2.8   21   13-33     68-89  (153)
  5 COG1212 KdsB CMP-2-keto-3-deox  39.2      22 0.00047   27.5   1.8   28   31-58    194-221 (247)
  6 TIGR00022 uncharacterized prot  35.3      36 0.00079   22.8   2.3   18   13-30     68-85  (142)
  7 KOG1681|consensus               30.8      31 0.00067   27.3   1.5   29   22-50    153-181 (292)
  8 PLN02599 dihydroorotase         24.8      48   0.001   25.9   1.6   28   23-51    231-259 (364)
  9 COG2731 EbgC Beta-galactosidas  23.4      91   0.002   22.1   2.7   27   13-39     68-94  (154)
 10 COG1550 Uncharacterized protei  22.9      49  0.0011   22.3   1.2   20   39-58     20-43  (95)
 11 COG1888 Uncharacterized protei  22.7   1E+02  0.0022   21.0   2.6   27   44-70     28-58  (97)
 12 PF09320 DUF1977:  Domain of un  22.3      31 0.00068   22.2   0.1   28   23-51     28-55  (107)
 13 PF04126 Cyclophil_like:  Cyclo  20.7      67  0.0015   21.2   1.5   19   37-55    101-119 (120)

No 1  
>KOG4659|consensus
Probab=99.72  E-value=3.1e-18  Score=150.23  Aligned_cols=70  Identities=29%  Similarity=0.446  Sum_probs=60.9

Q ss_pred             cceEEeeecCeeEe-eeeEEeeccceEEEEe-cCCccccccHHHHhhhCCcceeEEEeeec--CCe---eeEEecccc
Q psy8783           2 QDVVTSVFNNSHFL-DVHFSHQDQDLFYFVK-ELPQKIRDDLDELKRLGSMFNITTHETAT--DGK---ELRLQKAHS   72 (74)
Q Consensus         2 rdv~asV~N~a~~L-~lhfti~gqDtfYFVK-~~~~~~~~D~~~Lr~L~~gvNvt~sq~~~--~g~---dv~l~~~~~   72 (74)
                      |+| +|++||++|| +|||+|||+|+||||| +++++..++.+++|+|++|||||+||++.  +|+   ||+||+|.+
T Consensus      1727 r~V-as~Lfna~ylldlhfti~g~dthyfvk~e~dl~~~~~~~grr~le~g~nvsvsq~s~~~ngrtk~~veLq~g~l 1803 (1899)
T KOG4659|consen 1727 REV-ASKLFNAVYLLDLHFTIEGPDTHYFVKPEGDLVLLGLTGGRRRLESGVNVSVSQISHFTNGRTKDDVELQNGAL 1803 (1899)
T ss_pred             HHH-HHHHhcceEeeeeEEEEecCceEEEEeccCceeecccccchhhhcCceEEEEeeehhhccccccceeEEecCcE
Confidence            556 5567777666 5999999999999999 89999999999999999999999999944  774   999999864


No 2  
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=53.75  E-value=14  Score=27.67  Aligned_cols=28  Identities=25%  Similarity=0.409  Sum_probs=21.5

Q ss_pred             eEEEEecCCcc-ccccHHHHhhhCCccee
Q psy8783          26 LFYFVKELPQK-IRDDLDELKRLGSMFNI   53 (74)
Q Consensus        26 tfYFVK~~~~~-~~~D~~~Lr~L~~gvNv   53 (74)
                      +.||+.|..-+ -.-|.+.+|+|..-+||
T Consensus       117 cLYfI~pt~~~L~~~Di~~mk~Ls~~vNv  145 (281)
T PF00735_consen  117 CLYFIPPTGHGLKPLDIEFMKRLSKRVNV  145 (281)
T ss_dssp             EEEEE-TTSSSS-HHHHHHHHHHTTTSEE
T ss_pred             EEEEEcCCCccchHHHHHHHHHhcccccE
Confidence            68999985421 15799999999999998


No 3  
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase.
Probab=49.93  E-value=14  Score=26.31  Aligned_cols=27  Identities=15%  Similarity=0.011  Sum_probs=22.3

Q ss_pred             cCCccccccHHHHhhhCCcceeEEEee
Q psy8783          32 ELPQKIRDDLDELKRLGSMFNITTHET   58 (74)
Q Consensus        32 ~~~~~~~~D~~~Lr~L~~gvNvt~sq~   58 (74)
                      ++++-..+.++|||.|++|.-|-+..+
T Consensus       197 ~~~le~~e~leqlr~le~g~~i~~~~~  223 (238)
T TIGR00466       197 PCVLEEIEKLEQLRVLYYGEKIHVKIA  223 (238)
T ss_pred             CCcccccchhHHHhhhhcCCceEEEEe
Confidence            677777799999999999998866554


No 4  
>PF04074 DUF386:  Domain of unknown function (DUF386);  InterPro: IPR004375 This family consists of conserved hypothetical proteins, about 150 amino acids in length, with no known function. The family is restricted to the bacteria. It includes three members in Escherichia coli (strain K12) and three in Streptococcus pneumoniae.; PDB: 1S4C_B 1JOP_B.
Probab=45.32  E-value=26  Score=23.55  Aligned_cols=21  Identities=5%  Similarity=0.309  Sum_probs=15.5

Q ss_pred             eEeeeeEEeeccceEEE-EecC
Q psy8783          13 HFLDVHFSHQDQDLFYF-VKEL   33 (74)
Q Consensus        13 ~~L~lhfti~gqDtfYF-VK~~   33 (74)
                      .|+|+|+.++|...+.| ....
T Consensus        68 kyiDiq~~l~G~E~i~~~~~~~   89 (153)
T PF04074_consen   68 KYIDIQYVLEGEERIGWSADIE   89 (153)
T ss_dssp             SEEEEEEEEES-EEEEEE-S--
T ss_pred             cEEEEEeeccccEEEEEEcCcc
Confidence            68899999999999999 4433


No 5  
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]
Probab=39.23  E-value=22  Score=27.55  Aligned_cols=28  Identities=21%  Similarity=0.222  Sum_probs=22.9

Q ss_pred             ecCCccccccHHHHhhhCCcceeEEEee
Q psy8783          31 KELPQKIRDDLDELKRLGSMFNITTHET   58 (74)
Q Consensus        31 K~~~~~~~~D~~~Lr~L~~gvNvt~sq~   58 (74)
                      ||+++--.++++|||.|+.|.-|-+..+
T Consensus       194 ~ps~LE~~E~LEQLR~Le~G~kI~v~i~  221 (247)
T COG1212         194 KPSPLEKIESLEQLRVLENGEKIHVEIV  221 (247)
T ss_pred             CCchhHHHHHHHHHHHHHcCCeeEEEEe
Confidence            3777777799999999999998766544


No 6  
>TIGR00022 uncharacterized protein, YhcH/YjgK/YiaL family. This family consists of conserved hypothetical proteins, about 150 amino acids in length. Members with limited information include YhcH, a possible sugar isomerase of sialic acid catabolism, and YjgK.
Probab=35.26  E-value=36  Score=22.81  Aligned_cols=18  Identities=11%  Similarity=0.276  Sum_probs=16.6

Q ss_pred             eEeeeeEEeeccceEEEE
Q psy8783          13 HFLDVHFSHQDQDLFYFV   30 (74)
Q Consensus        13 ~~L~lhfti~gqDtfYFV   30 (74)
                      .|+|+||.++|..++-+.
T Consensus        68 ~YiDIq~~l~G~E~i~~~   85 (142)
T TIGR00022        68 RYLDIQLLLRGEENIEVG   85 (142)
T ss_pred             heEEEEEeecceEEEEEe
Confidence            689999999999999985


No 7  
>KOG1681|consensus
Probab=30.83  E-value=31  Score=27.25  Aligned_cols=29  Identities=34%  Similarity=0.510  Sum_probs=24.6

Q ss_pred             eccceEEEEecCCccccccHHHHhhhCCc
Q psy8783          22 QDQDLFYFVKELPQKIRDDLDELKRLGSM   50 (74)
Q Consensus        22 ~gqDtfYFVK~~~~~~~~D~~~Lr~L~~g   50 (74)
                      --||.||=|||=+....-|.+.|.||..-
T Consensus       153 csqDAffsvkEVDvglaADvGTL~Rlpkv  181 (292)
T KOG1681|consen  153 CSQDAFFSVKEVDVGLAADVGTLNRLPKV  181 (292)
T ss_pred             ecccceeeeeeeeeehhhchhhHhhhhHH
Confidence            36999999999999999999999886543


No 8  
>PLN02599 dihydroorotase
Probab=24.78  E-value=48  Score=25.86  Aligned_cols=28  Identities=11%  Similarity=-0.097  Sum_probs=22.7

Q ss_pred             ccceEEEEecCCccccccHHHHhh-hCCcc
Q psy8783          23 DQDLFYFVKELPQKIRDDLDELKR-LGSMF   51 (74)
Q Consensus        23 gqDtfYFVK~~~~~~~~D~~~Lr~-L~~gv   51 (74)
                      |.+++|+++| ++|..+|++.|.. |.+|.
T Consensus       231 ~~~~~~k~~P-PlR~~~dr~aL~~al~~G~  259 (364)
T PLN02599        231 GLQPHNYCLP-VLKREIHREALVKAATSGS  259 (364)
T ss_pred             CCCCCeEEEC-CCCCHHHHHHHHHHHHcCC
Confidence            4578999999 8888999999955 66655


No 9  
>COG2731 EbgC Beta-galactosidase, beta subunit [Carbohydrate transport and metabolism]
Probab=23.44  E-value=91  Score=22.13  Aligned_cols=27  Identities=7%  Similarity=0.337  Sum_probs=20.9

Q ss_pred             eEeeeeEEeeccceEEEEecCCccccc
Q psy8783          13 HFLDVHFSHQDQDLFYFVKELPQKIRD   39 (74)
Q Consensus        13 ~~L~lhfti~gqDtfYFVK~~~~~~~~   39 (74)
                      .|+|+|+.+.|+.-..|.=.......+
T Consensus        68 kYiDiqill~G~E~i~~s~~~~~~~~e   94 (154)
T COG2731          68 KYIDIQILLKGQEGIEYSPKETAQVKE   94 (154)
T ss_pred             heEEEEEEEeceeeeEEccCcCCcccc
Confidence            799999999999999987654443333


No 10 
>COG1550 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.89  E-value=49  Score=22.30  Aligned_cols=20  Identities=35%  Similarity=0.556  Sum_probs=15.3

Q ss_pred             ccHHHHh----hhCCcceeEEEee
Q psy8783          39 DDLDELK----RLGSMFNITTHET   58 (74)
Q Consensus        39 ~D~~~Lr----~L~~gvNvt~sq~   58 (74)
                      +.+..||    +|.+.||||++++
T Consensus        20 eKRavlr~iv~rLk~KFnvSvaE~   43 (95)
T COG1550          20 EKRAVLRPIVTRLKNKFNVSVAET   43 (95)
T ss_pred             HHHHHHHHHHHHHHHhcceeeeec
Confidence            4454554    4999999999987


No 11 
>COG1888 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.71  E-value=1e+02  Score=20.95  Aligned_cols=27  Identities=22%  Similarity=0.353  Sum_probs=16.8

Q ss_pred             HhhhCC--cceeEEEeeec--CCeeeEEecc
Q psy8783          44 LKRLGS--MFNITTHETAT--DGKELRLQKA   70 (74)
Q Consensus        44 Lr~L~~--gvNvt~sq~~~--~g~dv~l~~~   70 (74)
                      |-.|+|  |||+|+.++..  .|-.|.+.+.
T Consensus        28 lskl~gVegVNItv~eiD~et~~~~itIeG~   58 (97)
T COG1888          28 LSKLEGVEGVNITVTEIDVETENLKITIEGT   58 (97)
T ss_pred             HhhcCCcceEEEEEEEeeehhcceEEEEEcC
Confidence            344665  89999999832  4444444443


No 12 
>PF09320 DUF1977:  Domain of unknown function (DUF1977);  InterPro: IPR015399 This C-terminal domain is functionally uncharacterised and predominantly found in Dnaj-like proteins. 
Probab=22.25  E-value=31  Score=22.16  Aligned_cols=28  Identities=14%  Similarity=0.218  Sum_probs=17.5

Q ss_pred             ccceEEEEecCCccccccHHHHhhhCCcc
Q psy8783          23 DQDLFYFVKELPQKIRDDLDELKRLGSMF   51 (74)
Q Consensus        23 gqDtfYFVK~~~~~~~~D~~~Lr~L~~gv   51 (74)
                      .-.+-||||+.... .-....|++||..|
T Consensus        28 ~~~V~YYV~~~f~~-~y~~~~l~~lE~~V   55 (107)
T PF09320_consen   28 NLKVPYYVNPDFVQ-KYSSSKLRQLERQV   55 (107)
T ss_pred             CCCcceeECchhhh-hcCHHHHHHHHHHH
Confidence            44688999995532 22345577777655


No 13 
>PF04126 Cyclophil_like:  Cyclophilin-like;  InterPro: IPR007256 Proteins of this family have no known function.; PDB: 2KA0_A 1ZX8_C 2NNZ_A.
Probab=20.65  E-value=67  Score=21.24  Aligned_cols=19  Identities=26%  Similarity=0.338  Sum_probs=11.6

Q ss_pred             ccccHHHHhhhCCcceeEE
Q psy8783          37 IRDDLDELKRLGSMFNITT   55 (74)
Q Consensus        37 ~~~D~~~Lr~L~~gvNvt~   55 (74)
                      +.+|.+.|+.+.+|..|++
T Consensus       101 i~~~~~~l~~~~~~~~V~i  119 (120)
T PF04126_consen  101 IVSDLENLKEVKGGEKVRI  119 (120)
T ss_dssp             EEC-GGGGGG--TTEEEEE
T ss_pred             ECCCHHHHhhCCCCCeEEe
Confidence            3467778888888887775


Done!