Diaphorina citri psyllid: psy8794


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MWLPGPSVAIVTGASTGIGYNVVQDLVRFYDGTVYMTCINETAGLAAVDQIKKIYENETIPTKRYYQEKIKFYRVDVSNESQVENFTQHIAQQHGGVDVLINNAAVHLDYAGHLTKSEKLNRTMEVNYFGLLRICHFLFPLLRQSARVIHVTSQCGHVSQIRNGTELQEKFLNDTLTEEELTQLMRQYVEDYQQGRHLEKGKYPGIQVHQSGVDVLINNAAVHLDYAGHLTKSEKDNQDKIEPALQERFLNDTLTEEELTQLMHQYVEDYQQGRHLEKGWPESPYTVSKIGVSKLAMVQQNQHFQNGTADLSVNAVNPGYAKTQMSNFSGLMEADEAGDPILYLASIQPYQPEPRGRLIWNNKEEQAWNATPPKTFDHPSKCAKYW
cccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHcccCEEECcccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEECcccccccccccccccccHHHHHHHHHHHHHccccccccccCEEccccEEEcccccccccccccccccccc
****GPSVAIVTGASTGIGYNVVQDLVRFYDGTVYMTCINETAGLAAVDQIKKIYENETIPTKRYYQEKIKFYRVDVSNESQVENFTQHIAQQHGGVDVLINNAAVHLDYAGHLTKSEKLNRTMEVNYFGLLRICHFLFPLLRQSARVIHVTSQCGHVSQIRNGTELQEKFLNDTLTEEELTQLMRQYVEDYQQGRHLEKGKYPGIQVHQSGVDVLINNAAVHLDYAGHLTKSEKDNQDKIEPALQERFLNDTLTEEELTQLMHQYVEDYQQGRHLEKGWPESPYTVSKIGVSKLAMVQQNQHFQNGTADLSVNAVNPGYAKTQMSNFSGLMEADEAGDPILYLASIQPYQPEPRGRLIWNNKEEQAWNATPPKTFDHPSKCAKYW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLPGPSVAIVTGASTGIGYNVVQDLVRFYDGTVYMTCINETAGLAAVDQIKKIYENETIPTKRYYQEKIKFYRVDVSNESQVENFTQHIAQQHGGVDVLINNAAVHLDYAGHLTKSEKLNRTMEVNYFGLLRICHFLFPLLRQSARVIHVTSQCGHVSQIRNGTELQEKFLNDTLTEEELTQLMRQYVEDYQQGRHLEKGKYPGIQVHQSGVDVLINNAAVHLDYAGHLTKSEKDNQDKIEPALQERFLNDTLTEEELTQLMHQYVEDYQQGRHLEKGWPESPYTVSKIGVSKLAMVQQNQHFQNGTADLSVNAVNPGYAKTQMSNFSGLMEADEAGDPILYLASIQPYQPEPRGRLIWNNKEEQAWNATPPKTFDHPSKCAKYW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:1901661 [BP]quinone metabolic processprobableGO:0044710, GO:0042180, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0044281, GO:0008152
GO:0016616 [MF]oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptorprobableGO:0003824, GO:0003674, GO:0016614, GO:0016491
GO:0042375 [BP]quinone cofactor metabolic processprobableGO:0009987, GO:0051186, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WMA, chain A
Confidence level:very confident
Coverage over the Query: 4-56,69-163,242-368
View the alignment between query and template
View the model in PyMOL
Template: 3RD5, chain A
Confidence level:very confident
Coverage over the Query: 1-55,68-167,198-199,276-386
View the alignment between query and template
View the model in PyMOL
Template: 3VTZ, chain A
Confidence level:confident
Coverage over the Query: 171-192,211-277
View the alignment between query and template
View the model in PyMOL
Template: 2PFG, chain A
Confidence level:confident
Coverage over the Query: 5-241
View the alignment between query and template
View the model in PyMOL