Query         psy88
Match_columns 75
No_of_seqs    156 out of 1278
Neff          8.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:34:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy88.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/88hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07732 Cu-oxidase_3:  Multico 100.0 5.6E-32 1.2E-36  159.0   6.3   73    2-75     25-99  (117)
  2 PLN02835 oxidoreductase        100.0 9.6E-30 2.1E-34  178.8   9.2   73    1-75     58-132 (539)
  3 PLN02168 copper ion binding /  100.0 1.5E-29 3.2E-34  178.0   9.0   73    1-75     55-129 (545)
  4 PLN02792 oxidoreductase        100.0 2.1E-29 4.5E-34  177.1   8.7   73    1-75     45-119 (536)
  5 PLN02354 copper ion binding /  100.0 1.6E-29 3.5E-34  178.1   8.1   73    1-75     56-130 (552)
  6 TIGR03389 laccase laccase, pla 100.0 3.4E-29 7.4E-34  175.9   9.1   74    1-75     32-107 (539)
  7 PLN00044 multi-copper oxidase- 100.0 3.3E-29 7.1E-34  177.6   8.9   73    1-75     58-132 (596)
  8 PLN02991 oxidoreductase        100.0 3.2E-29 6.9E-34  176.3   8.4   73    1-75     57-131 (543)
  9 TIGR03390 ascorbOXfungal L-asc 100.0 5.9E-29 1.3E-33  174.8   9.2   75    1-75     37-114 (538)
 10 PLN02191 L-ascorbate oxidase   100.0 1.3E-28 2.9E-33  174.1   9.3   75    1-75     52-127 (574)
 11 TIGR03388 ascorbase L-ascorbat  99.9 2.6E-27 5.6E-32  166.6   9.5   75    1-75     30-105 (541)
 12 PLN02604 oxidoreductase         99.9 1.1E-26 2.4E-31  164.1   9.5   74    2-75     54-128 (566)
 13 TIGR01480 copper_res_A copper-  99.9 8.3E-27 1.8E-31  165.3   8.8   72    1-75     74-146 (587)
 14 KOG1263|consensus               99.9   9E-27   2E-31  164.2   8.9   73    1-75     57-131 (563)
 15 PRK10965 multicopper oxidase;   99.9 3.4E-25 7.3E-30  155.5   8.7   69    1-75     75-145 (523)
 16 PRK10883 FtsI repressor; Provi  99.9   5E-23 1.1E-27  143.2   8.9   69    1-75     75-145 (471)
 17 TIGR02376 Cu_nitrite_red nitri  99.8 2.1E-20 4.6E-25  124.6   8.6   66    2-74     58-125 (311)
 18 TIGR01480 copper_res_A copper-  99.8 2.9E-19 6.4E-24  127.0   7.9   71    3-75    499-572 (587)
 19 COG2132 SufI Putative multicop  99.8 4.2E-19 9.1E-24  122.7   8.2   72    1-75     62-134 (451)
 20 TIGR03095 rusti_cyanin rusticy  99.7 4.1E-17 8.9E-22   99.3   8.5   74    2-75     51-133 (148)
 21 PF07731 Cu-oxidase_2:  Multico  99.5   3E-14 6.6E-19   84.5   6.0   72    2-75     33-120 (138)
 22 TIGR03096 nitroso_cyanin nitro  99.3 6.5E-12 1.4E-16   75.4   7.3   59    2-74     60-119 (135)
 23 PLN02835 oxidoreductase         99.1 2.2E-10 4.7E-15   81.4   6.1   71    4-75    412-497 (539)
 24 COG2132 SufI Putative multicop  99.0 1.4E-09 3.1E-14   75.6   6.5   71    3-75    357-434 (451)
 25 TIGR03388 ascorbase L-ascorbat  99.0 1.7E-09 3.7E-14   76.8   6.6   72    4-75    417-509 (541)
 26 TIGR03389 laccase laccase, pla  99.0 2.3E-09 5.1E-14   76.1   6.8   72    4-75    416-505 (539)
 27 PLN02604 oxidoreductase         98.9 3.3E-09 7.1E-14   75.8   6.6   72    4-75    440-532 (566)
 28 PLN02168 copper ion binding /   98.9 5.7E-09 1.2E-13   74.4   6.9   71    4-75    416-501 (545)
 29 PLN02354 copper ion binding /   98.9 3.9E-09 8.5E-14   75.3   5.9   71    4-75    419-504 (552)
 30 PF13473 Cupredoxin_1:  Cupredo  98.9   1E-08 2.2E-13   58.7   6.4   59    2-74     34-93  (104)
 31 PRK10965 multicopper oxidase;   98.8 9.8E-09 2.1E-13   72.9   6.2   70    4-75    427-508 (523)
 32 PLN02991 oxidoreductase         98.8 1.2E-08 2.6E-13   72.7   6.4   71    4-75    411-496 (543)
 33 PLN02792 oxidoreductase         98.8 1.8E-08 3.8E-13   71.8   6.5   71    4-75    404-489 (536)
 34 PLN02191 L-ascorbate oxidase    98.8 2.5E-08 5.3E-13   71.5   7.2   72    4-75    440-532 (574)
 35 TIGR03390 ascorbOXfungal L-asc  98.8 2.3E-08   5E-13   71.1   6.8   72    4-75    413-517 (538)
 36 TIGR02656 cyanin_plasto plasto  98.7 1.4E-07   3E-12   53.7   7.7   67    2-73     16-84  (99)
 37 PLN00044 multi-copper oxidase-  98.7 5.4E-08 1.2E-12   70.1   5.9   70    4-74    434-518 (596)
 38 PRK02888 nitrous-oxide reducta  98.6 1.3E-07 2.9E-12   68.2   7.1   62    2-74    554-616 (635)
 39 TIGR02657 amicyanin amicyanin.  98.6 5.9E-07 1.3E-11   49.6   7.4   62    2-74     10-71  (83)
 40 TIGR02376 Cu_nitrite_red nitri  98.5 1.9E-07 4.1E-12   62.7   5.4   71    4-75    203-280 (311)
 41 PRK02710 plastocyanin; Provisi  98.4 2.7E-06 5.9E-11   49.9   7.7   59    2-73     46-104 (119)
 42 PF00394 Cu-oxidase:  Multicopp  98.4 8.4E-07 1.8E-11   54.1   5.1   71    2-73     59-135 (159)
 43 PRK10883 FtsI repressor; Provi  98.3 1.1E-06 2.5E-11   61.8   5.6   66    4-75    376-453 (471)
 44 PF00127 Copper-bind:  Copper b  98.3 1.8E-06 3.9E-11   49.0   4.8   68    2-73     16-84  (99)
 45 KOG1263|consensus               98.1 6.4E-06 1.4E-10   59.2   5.8   72    4-75    431-521 (563)
 46 TIGR03102 halo_cynanin halocya  98.0  0.0001 2.2E-09   43.3   7.8   60    2-73     41-100 (115)
 47 TIGR02375 pseudoazurin pseudoa  97.8  0.0001 2.2E-09   43.4   5.5   58    2-73     14-72  (116)
 48 COG3794 PetE Plastocyanin [Ene  97.6 0.00051 1.1E-08   41.1   7.0   60    2-73     53-112 (128)
 49 PF00116 COX2:  Cytochrome C ox  97.4  0.0016 3.4E-08   38.3   6.8   58    2-74     45-103 (120)
 50 TIGR03094 sulfo_cyanin sulfocy  97.2  0.0055 1.2E-07   38.8   7.8   69    2-73     84-168 (195)
 51 PF06525 SoxE:  Sulfocyanin (So  97.1  0.0059 1.3E-07   38.9   8.0   71    2-73     85-169 (196)
 52 COG4263 NosZ Nitrous oxide red  96.7  0.0034 7.3E-08   44.9   4.5   60    3-73    558-618 (637)
 53 TIGR02695 azurin azurin. Azuri  96.7   0.015 3.3E-07   34.6   6.6   70    4-74     17-111 (125)
 54 TIGR02866 CoxB cytochrome c ox  95.4    0.12 2.7E-06   32.7   6.8   57    3-74    117-174 (201)
 55 PRK13202 ureB urease subunit b  95.1    0.13 2.9E-06   29.7   5.5   60    3-63     11-83  (104)
 56 PRK13203 ureB urease subunit b  94.3    0.28   6E-06   28.3   5.6   60    3-63     11-82  (102)
 57 TIGR00192 urease_beta urease,   94.3    0.28 6.2E-06   28.2   5.6   60    3-63     11-82  (101)
 58 PF12690 BsuPI:  Intracellular   93.9    0.34 7.4E-06   26.6   5.3   32   40-71     41-80  (82)
 59 cd00407 Urease_beta Urease bet  93.9    0.42 9.2E-06   27.5   5.8   60    3-63     11-82  (101)
 60 PRK10378 inactive ferrous ion   93.3    0.59 1.3E-05   32.6   6.8   60    2-73     43-103 (375)
 61 PRK13201 ureB urease subunit b  93.0     0.6 1.3E-05   28.2   5.7   60    3-63     11-82  (136)
 62 PRK13198 ureB urease subunit b  93.0    0.54 1.2E-05   29.0   5.5   60    3-63     39-110 (158)
 63 PRK13205 ureB urease subunit b  92.9    0.57 1.2E-05   28.9   5.6   60    3-63     11-82  (162)
 64 PRK13204 ureB urease subunit b  92.9    0.56 1.2E-05   29.0   5.5   60    3-63     34-105 (159)
 65 COG4263 NosZ Nitrous oxide red  92.8    0.37   8E-06   34.9   5.2   60    3-73    548-608 (637)
 66 COG1622 CyoA Heme/copper-type   89.8     2.9 6.4E-05   27.6   6.9   57    3-74    137-194 (247)
 67 PRK13192 bifunctional urease s  89.4     2.1 4.5E-05   27.7   5.7   60    3-63    120-191 (208)
 68 PF05938 Self-incomp_S1:  Plant  88.7       3 6.4E-05   23.7   5.9   52   14-74      2-54  (110)
 69 PF00699 Urease_beta:  Urease b  88.6    0.64 1.4E-05   26.7   2.8   59    4-63     11-81  (100)
 70 PF10989 DUF2808:  Protein of u  87.6    0.89 1.9E-05   27.4   3.2   25   49-73     96-125 (146)
 71 PRK13986 urease subunit alpha;  86.4     3.6 7.8E-05   26.9   5.6   59    4-63    117-187 (225)
 72 COG4454 Uncharacterized copper  85.6     5.8 0.00013   24.6   6.0   67    2-73     62-140 (158)
 73 COG0832 UreB Urea amidohydrola  85.1     5.3 0.00012   23.1   5.3   59    4-63     12-82  (106)
 74 TIGR03079 CH4_NH3mon_ox_B meth  83.6     2.2 4.8E-05   29.9   3.9   21   43-63    331-351 (399)
 75 PF04744 Monooxygenase_B:  Mono  82.5     2.2 4.7E-05   29.9   3.5   15   49-63    318-332 (381)
 76 PF05506 DUF756:  Domain of unk  82.4     6.1 0.00013   21.6   5.7   46   10-63     19-64  (89)
 77 cd00918 Der-p2_like Several gr  80.9       9 0.00019   22.5   6.3   57    6-63     23-86  (120)
 78 PF10633 NPCBM_assoc:  NPCBM-as  80.3     4.2   9E-05   21.6   3.5   20   51-70     45-70  (78)
 79 MTH00047 COX2 cytochrome c oxi  79.1      14  0.0003   23.5   6.5   57    3-74    116-173 (194)
 80 COG2967 ApaG Uncharacterized p  78.6     3.3 7.3E-05   24.6   3.0   48   14-63     33-86  (126)
 81 MTH00140 COX2 cytochrome c oxi  77.4      17 0.00036   23.6   6.3   56    4-74    141-197 (228)
 82 PF00386 C1q:  C1q domain;  Int  77.4     3.2   7E-05   23.9   2.7   18    3-20     91-108 (127)
 83 PLN02303 urease                 74.8      10 0.00022   29.3   5.3   59    4-63    142-212 (837)
 84 PRK05461 apaG CO2+/MG2+ efflux  73.6     8.7 0.00019   22.9   3.9   15   49-63     73-87  (127)
 85 PF09394 Inhibitor_I42:  Chagas  73.6      11 0.00025   20.3   4.2   18    5-22      1-18  (92)
 86 cd05468 pVHL von Hippel-Landau  72.6      14 0.00031   22.2   4.7   43    8-60      4-46  (141)
 87 cd00916 Npc2_like Niemann-Pick  71.3      18 0.00039   21.1   5.5   58    6-63     25-90  (123)
 88 MTH00098 COX2 cytochrome c oxi  71.2      25 0.00055   22.8   6.8   56    4-74    141-197 (227)
 89 smart00110 C1Q Complement comp  68.7     6.1 0.00013   23.5   2.5   16    3-18     96-111 (135)
 90 PF09962 DUF2196:  Uncharacteri  65.7     6.1 0.00013   20.8   1.8   36    7-45      9-56  (62)
 91 MTH00129 COX2 cytochrome c oxi  65.6      35 0.00075   22.2   6.8   56    4-74    141-197 (230)
 92 MTH00051 COX2 cytochrome c oxi  65.1      36 0.00078   22.2   6.0   55    4-73    145-200 (234)
 93 TIGR00008 infA translation ini  64.6     7.7 0.00017   20.7   2.1   16    4-19     42-57  (68)
 94 TIGR03833 conserved hypothetic  63.2     8.2 0.00018   20.3   2.0   37    6-45      7-55  (62)
 95 PRK12442 translation initiatio  62.7     8.6 0.00019   21.6   2.2   28    4-31     44-71  (87)
 96 KOG4387|consensus               62.6     3.4 7.3E-05   26.3   0.6   30    5-35     71-100 (191)
 97 KOG4063|consensus               61.3      35 0.00075   21.2   4.8   16   48-63    106-121 (158)
 98 MTH00008 COX2 cytochrome c oxi  61.2      43 0.00092   21.8   6.7   55    4-73    141-196 (228)
 99 COG0361 InfA Translation initi  60.9     9.9 0.00021   20.7   2.2   17    4-20     44-60  (75)
100 KOG2500|consensus               59.5     7.3 0.00016   25.7   1.7   18    4-21    149-166 (253)
101 COG1188 Ribosome-associated he  58.9     6.3 0.00014   22.7   1.2   17    6-22     48-64  (100)
102 PF12306 PixA:  Inclusion body   58.4      42 0.00091   20.8   6.7   18    3-20     58-75  (172)
103 cd08058 MPN_euk_mb Mpr1p, Pad1  57.9     5.1 0.00011   23.0   0.8    7   69-75     69-75  (119)
104 PRK12791 flbT flagellar biosyn  57.4     9.7 0.00021   22.9   1.9   27    1-29      1-30  (131)
105 PF00927 Transglut_C:  Transglu  57.2     7.3 0.00016   21.8   1.3   19   50-68     60-81  (107)
106 COG2880 Uncharacterized protei  55.0      11 0.00023   20.2   1.6   19    1-19     18-36  (67)
107 PF05688 DUF824:  Salmonella re  54.6      14 0.00031   18.3   2.0   15    5-19      7-21  (47)
108 PF07653 SH3_2:  Variant SH3 do  51.4     9.4  0.0002   18.8   1.0   15    2-16     13-27  (55)
109 cd00912 ML The ML (MD-2-relate  51.3      14 0.00031   21.3   1.9   16   48-63     78-93  (127)
110 cd04456 S1_IF1A_like S1_IF1A_l  50.4      19 0.00041   19.6   2.2   17    4-20     36-52  (78)
111 cd05793 S1_IF1A S1_IF1A: Trans  50.0      19 0.00042   19.5   2.2   17    4-20     36-52  (77)
112 TIGR01432 QOXA cytochrome aa3   49.9      66  0.0014   20.6   5.7   56    3-73    130-186 (217)
113 MTH00185 COX2 cytochrome c oxi  49.7      71  0.0015   20.8   6.6   56    4-74    141-197 (230)
114 PF01847 VHL:  von Hippel-Linda  49.6      35 0.00075   21.2   3.5   45    7-61      9-53  (156)
115 PF05753 TRAP_beta:  Translocon  49.2      65  0.0014   20.2   5.1   21   49-69     80-103 (181)
116 PRK09838 periplasmic copper-bi  49.1      26 0.00056   20.5   2.8   17    6-22     88-104 (115)
117 cd07700 IgV_CD8_beta Immunoglo  49.1      33 0.00072   19.0   3.2   27    5-31      1-27  (107)
118 PF14646 MYCBPAP:  MYCBP-associ  48.7      63  0.0014   22.8   5.1   61    4-69    240-317 (426)
119 TIGR01433 CyoA cytochrome o ub  48.5      74  0.0016   20.7   5.9   56    3-73    139-195 (226)
120 PF14326 DUF4384:  Domain of un  47.9      25 0.00054   18.9   2.5   16    7-22      3-18  (83)
121 PF04744 Monooxygenase_B:  Mono  47.4      18 0.00039   25.5   2.2   34   40-73     71-107 (381)
122 PF00207 A2M:  Alpha-2-macroglo  47.3      37  0.0008   18.4   3.1   19    4-22     63-83  (92)
123 cd08067 MPN_2A_DUB Mov34/MPN/P  47.0     8.8 0.00019   24.2   0.6    7   69-75     83-89  (187)
124 PRK00794 flbT flagellar biosyn  47.0      19  0.0004   21.7   2.0   29    1-32      2-33  (132)
125 smart00207 TNF Tumour necrosis  46.8      19 0.00042   20.8   2.0   16    4-19     92-107 (125)
126 PF02221 E1_DerP2_DerF2:  ML do  45.8      16 0.00035   20.9   1.6   16   48-63     84-99  (134)
127 cd08068 MPN_BRCC36 Mov34/MPN/P  45.1      10 0.00023   25.0   0.8    8   68-75     92-99  (244)
128 smart00652 eIF1a eukaryotic tr  44.8      26 0.00056   19.2   2.2   17    4-20     41-57  (83)
129 COG4895 Uncharacterized conser  44.2      28 0.00061   18.0   2.1   37    7-46      9-57  (63)
130 PRK04012 translation initiatio  44.1      26 0.00056   20.0   2.2   16    4-19     57-72  (100)
131 PF04246 RseC_MucC:  Positive r  43.7      14  0.0003   21.7   1.1   17    4-20     49-65  (135)
132 COG0186 RpsQ Ribosomal protein  43.6      16 0.00034   20.5   1.2   15    4-18     53-67  (87)
133 TIGR03396 PC_PLC phospholipase  42.3 1.6E+02  0.0034   22.7   7.0   46   10-63    604-649 (690)
134 PF01176 eIF-1a:  Translation i  41.8      17 0.00036   18.8   1.1   15    4-18     39-53  (65)
135 PF14796 AP3B1_C:  Clathrin-ada  41.7      82  0.0018   19.2   5.3   47   12-63     88-137 (145)
136 PF07705 CARDB:  CARDB;  InterP  41.3      25 0.00054   18.7   1.9   20   51-70     56-78  (101)
137 PF08234 Spindle_Spc25:  Chromo  41.2      27 0.00058   18.5   1.9   18    5-22      1-18  (74)
138 cd00175 SNc Staphylococcal nuc  41.2      27 0.00059   19.9   2.1   65    6-73      1-78  (129)
139 smart00737 ML Domain involved   40.8      26 0.00056   19.8   1.9   15   49-63     71-85  (118)
140 cd00164 S1_like S1_like: Ribos  40.8      41 0.00089   15.9   2.5   16    6-21     41-56  (65)
141 PF02563 Poly_export:  Polysacc  40.3      25 0.00054   18.8   1.7   20    3-22      9-28  (82)
142 PF04379 DUF525:  Protein of un  39.9      17 0.00038   20.2   1.1   14   50-63     57-70  (90)
143 PF04014 Antitoxin-MazE:  Antid  39.6      21 0.00045   17.1   1.2   15    6-20     20-34  (47)
144 PF08496 Peptidase_S49_N:  Pept  39.1      35 0.00077   21.0   2.4   24    6-33    127-150 (155)
145 KOG1555|consensus               39.0      12 0.00026   25.8   0.4    8   68-75    118-125 (316)
146 cd04980 IgV_L_kappa Immunoglob  39.0      67  0.0015   17.5   3.7   29    2-30      7-35  (106)
147 PF11604 CusF_Ec:  Copper bindi  38.9      28 0.00062   18.3   1.8   17    6-22     42-58  (70)
148 MTH00038 COX2 cytochrome c oxi  38.9 1.1E+02  0.0024   19.9   6.4   55    4-73    141-196 (229)
149 cd04983 IgV_TCR_alpha_like Imm  38.7      67  0.0015   17.4   4.0   28    2-30      5-32  (109)
150 cd05720 Ig_CD8_alpha Immunoglo  38.5      59  0.0013   17.9   3.2   24    6-30      2-25  (104)
151 cd08961 GH64-TLP-SF glycoside   38.5      95  0.0021   19.1   5.5   21   51-71     30-51  (153)
152 cd05737 Ig_Myomesin_like_C C-t  38.1      65  0.0014   17.1   3.7   28    2-30      8-35  (92)
153 PF01954 DUF104:  Protein of un  37.9      21 0.00045   18.5   1.1   19    2-20     17-35  (60)
154 cd04462 S1_RNAPII_Rpb7 S1_RNAP  37.8      53  0.0011   18.0   2.8   18    4-21     53-70  (88)
155 PF12988 DUF3872:  Domain of un  37.8      15 0.00032   22.4   0.6   18    1-18     38-55  (137)
156 PF14250 AbrB-like:  AbrB-like   37.6      19  0.0004   19.5   0.9   15    5-19     51-65  (71)
157 PF00229 TNF:  TNF(Tumour Necro  37.3      22 0.00047   20.3   1.3   15    4-18     93-107 (127)
158 PF03658 Ub-RnfH:  RnfH family   37.1      22 0.00047   19.8   1.1   11    6-16     61-71  (84)
159 cd03696 selB_II selB_II: this   36.4      36 0.00077   18.0   1.9   15    6-20     56-70  (83)
160 COG5004 P2-like prophage tail   36.3      13 0.00028   19.8   0.2   14    1-14      1-14  (70)
161 TIGR03635 S17_bact 30S ribosom  36.2      23 0.00051   18.9   1.2   11    6-16     48-58  (71)
162 PF04151 PPC:  Bacterial pre-pe  36.1      64  0.0014   16.4   5.9   18    4-21      6-23  (70)
163 PF00868 Transglut_N:  Transglu  36.0      56  0.0012   18.9   2.8   16    3-18     25-40  (118)
164 PF07679 I-set:  Immunoglobulin  35.8      67  0.0014   16.5   3.6   28    2-30      7-34  (90)
165 cd05708 S1_Rrp5_repeat_sc12 S1  35.7      53  0.0011   16.6   2.5   16    6-21     47-62  (77)
166 smart00232 JAB_MPN JAB/MPN dom  35.6      19  0.0004   20.5   0.8    7   69-75     80-86  (135)
167 PTZ00047 cytochrome c oxidase   35.5 1.1E+02  0.0025   19.1   6.7   23   52-74    107-130 (162)
168 cd00184 TNF Tumor Necrosis Fac  35.4      35 0.00077   20.0   2.0   16    4-19    106-121 (137)
169 cd07701 Ig1_Necl-3 First (N-te  35.1      79  0.0017   17.1   3.9   28    2-30      4-31  (95)
170 CHL00084 rpl19 ribosomal prote  35.0      34 0.00073   20.2   1.8   16    5-20     21-36  (117)
171 PRK05659 sulfur carrier protei  35.0      25 0.00054   17.8   1.1   13    4-16     48-60  (66)
172 smart00739 KOW KOW (Kyprides,   34.8      30 0.00065   14.1   1.2   10    7-16      2-11  (28)
173 COG1310 Predicted metal-depend  34.7      18 0.00039   21.1   0.6    8   68-75     72-79  (134)
174 TIGR01451 B_ant_repeat conserv  34.6      35 0.00076   16.9   1.6   17   52-68      8-25  (53)
175 TIGR01024 rplS_bact ribosomal   34.3      39 0.00085   19.8   2.0   17    5-21     17-33  (113)
176 PF03459 TOBE:  TOBE domain;  I  34.0      19 0.00042   17.9   0.6   14    6-19     46-59  (64)
177 PF14874 PapD-like:  Flagellar-  33.5      84  0.0018   17.0   4.9   46   12-63     23-70  (102)
178 PF07385 DUF1498:  Protein of u  33.5 1.1E+02  0.0024   20.2   4.1   50    5-61    112-167 (225)
179 KOG4680|consensus               33.5      43 0.00092   20.6   2.1   23   48-70     95-122 (153)
180 cd07767 MPN Mpr1p, Pad1p N-ter  33.3      21 0.00046   19.7   0.8    7   69-75     67-73  (116)
181 COG4013 Uncharacterized protei  33.2      32 0.00069   19.3   1.4   13    6-18     20-32  (91)
182 COG1917 Uncharacterized conser  33.0      59  0.0013   18.6   2.6   24    2-33     81-104 (131)
183 PF00018 SH3_1:  SH3 domain;  I  32.9      19 0.00041   17.1   0.4   14    3-16     12-25  (48)
184 cd03698 eRF3_II_like eRF3_II_l  32.8      43 0.00092   17.8   1.9   14    6-19     56-69  (83)
185 cd08066 MPN_AMSH_like Mov34/MP  32.8      21 0.00046   22.2   0.7    7   69-75     79-85  (173)
186 PRK11347 antitoxin ChpS; Provi  32.7      33 0.00072   18.8   1.4   16    5-20     24-39  (83)
187 PRK12281 rplX 50S ribosomal pr  32.7      30 0.00065   18.7   1.2   13    5-17      5-17  (76)
188 TIGR03000 plancto_dom_1 Planct  32.6      50  0.0011   18.0   2.1   16   48-63     32-47  (75)
189 CHL00142 rps17 ribosomal prote  32.6      25 0.00055   19.5   0.9   11    6-16     50-60  (84)
190 smart00318 SNc Staphylococcal   32.3      80  0.0017   18.1   3.2   33    3-38      6-38  (138)
191 cd05794 S1_EF-P_repeat_2 S1_EF  32.1      41 0.00089   17.2   1.6   13    4-16     35-47  (56)
192 PF01398 JAB:  JAB1/Mov34/MPN/P  31.9      19  0.0004   20.2   0.4    6   69-74     85-90  (114)
193 cd08069 MPN_RPN11_CSN5 Mov34/M  31.8      22 0.00047   23.6   0.7    8   68-75     90-97  (268)
194 PHA03189 UL14 tegument protein  31.8      90  0.0019   21.8   3.6   18   52-69    128-148 (348)
195 PF07610 DUF1573:  Protein of u  31.7      50  0.0011   15.7   1.8   42   15-62      2-43  (45)
196 PF14604 SH3_9:  Variant SH3 do  31.6      30 0.00065   16.7   1.0   14    3-16     11-24  (49)
197 PLN00208 translation initiatio  31.5      46   0.001   20.4   2.0   17    4-20     68-84  (145)
198 PF11302 DUF3104:  Protein of u  31.3      39 0.00084   18.4   1.5   20    2-21      1-20  (75)
199 PF11614 FixG_C:  IG-like fold   31.1      88  0.0019   17.6   3.1   45   13-63     35-81  (118)
200 cd05689 S1_RPS1_repeat_ec4 S1_  31.1      71  0.0015   16.1   2.5   16    6-21     48-63  (72)
201 PTZ00329 eukaryotic translatio  30.9      45 0.00097   20.7   1.9   16    4-19     68-83  (155)
202 cd05690 S1_RPS1_repeat_ec5 S1_  30.6      75  0.0016   15.7   2.5   15    6-20     45-59  (69)
203 smart00205 THN Thaumatin famil  30.4 1.6E+02  0.0034   19.2   4.4   20   51-70     29-50  (218)
204 cd05891 Ig_M-protein_C C-termi  30.3      94   0.002   16.6   3.7   28    2-30      8-35  (92)
205 smart00326 SH3 Src homology 3   30.1      34 0.00073   15.9   1.1   17    3-19     17-33  (58)
206 PRK00276 infA translation init  30.0      54  0.0012   17.2   2.0   17    5-21     45-61  (72)
207 cd05688 S1_RPS1_repeat_ec3 S1_  30.0      76  0.0017   15.4   2.6   15    6-20     44-58  (68)
208 PF03423 CBM_25:  Carbohydrate   30.0      76  0.0016   17.3   2.6   24   10-34      1-27  (87)
209 cd04451 S1_IF1 S1_IF1: Transla  29.8      74  0.0016   16.1   2.4   14    6-19     40-53  (64)
210 PF06030 DUF916:  Bacterial pro  29.8 1.2E+02  0.0026   17.6   3.7   14   50-63     87-100 (121)
211 KOG4792|consensus               29.7      34 0.00074   22.9   1.3   19    4-22    245-263 (293)
212 KOG4458|consensus               29.6      39 0.00084   18.1   1.3   28    2-30      9-36  (78)
213 PF05896 NQRA:  Na(+)-transloca  29.5      44 0.00095   22.4   1.8   14    1-14     39-52  (257)
214 PRK05610 rpsQ 30S ribosomal pr  29.4      31 0.00067   19.1   0.9   11    6-16     53-63  (84)
215 PF01828 Peptidase_A4:  Peptida  29.4      46 0.00099   21.4   1.9   18    5-22     89-106 (208)
216 MTH00023 COX2 cytochrome c oxi  29.3 1.7E+02  0.0037   19.2   6.3   56    4-74    152-208 (240)
217 cd04089 eRF3_II eRF3_II: domai  29.2      53  0.0011   17.4   1.9   14    6-19     55-68  (82)
218 PF08940 DUF1918:  Domain of un  29.2      29 0.00064   18.0   0.8   12    5-16      1-12  (58)
219 PF13218 DUF4026:  Protein of u  29.1      62  0.0013   22.4   2.5   25   50-74    147-179 (323)
220 cd04975 Ig4_SCFR_like Fourth i  29.1 1.1E+02  0.0024   16.9   3.4   27    3-30     11-38  (101)
221 PF09478 CBM49:  Carbohydrate b  29.0      57  0.0012   17.4   2.0   13   51-63     66-78  (80)
222 cd05762 Ig8_MLCK Eighth immuno  29.0 1.1E+02  0.0023   16.7   4.1   28    2-30      7-34  (98)
223 CHL00141 rpl24 ribosomal prote  28.8      36 0.00077   18.7   1.1   15    4-18      6-20  (83)
224 PRK13855 type IV secretion sys  28.8      70  0.0015   22.7   2.8   21    2-22    336-356 (376)
225 PF08363 GbpC:  Glucan-binding   28.7      72  0.0016   21.6   2.7   17    5-21     85-101 (283)
226 cd05899 IgV_TCR_beta Immunoglo  28.6 1.1E+02  0.0024   16.8   3.9   27    2-30      5-31  (110)
227 TIGR01003 PTS_HPr_family Phosp  28.4      32  0.0007   18.5   0.9   18    3-20     51-68  (82)
228 TIGR00523 eIF-1A eukaryotic/ar  28.3      56  0.0012   18.6   1.9   17    4-20     55-71  (99)
229 KOG1554|consensus               28.3      25 0.00055   24.2   0.6    8   68-75    134-141 (347)
230 PF00431 CUB:  CUB domain CUB d  28.3      60  0.0013   17.3   2.0   17    4-20     30-46  (110)
231 COG2336 MazE Growth regulator   28.2      32 0.00069   19.1   0.8   17    4-20     23-39  (82)
232 cd00367 PTS-HPr_like Histidine  28.1      35 0.00075   17.9   1.0   18    3-20     47-64  (77)
233 PF00254 FKBP_C:  FKBP-type pep  28.1      48   0.001   17.7   1.6   15    7-21      5-19  (94)
234 PRK05338 rplS 50S ribosomal pr  28.0      48   0.001   19.5   1.6   14    5-18     17-30  (116)
235 cd05685 S1_Tex S1_Tex: The C-t  28.0      58  0.0013   15.8   1.8   15    7-21     45-59  (68)
236 cd04472 S1_PNPase S1_PNPase: P  27.7      70  0.0015   15.6   2.1   14    7-20     45-58  (68)
237 KOG4795|consensus               27.7      58  0.0013   21.8   2.1   19    4-22     50-68  (264)
238 cd03693 EF1_alpha_II EF1_alpha  27.4      57  0.0012   17.7   1.8   14    6-19     60-73  (91)
239 TIGR01080 rplX_A_E ribosomal p  27.4      52  0.0011   19.3   1.7   13    4-16     39-51  (114)
240 PRK10525 cytochrome o ubiquino  27.4 2.1E+02  0.0046   19.7   6.0   56    3-73    151-207 (315)
241 PRK10850 PTS system phosphohis  27.4      34 0.00075   18.7   0.9   17    3-19     51-67  (85)
242 COG0335 RplS Ribosomal protein  27.0      51  0.0011   19.4   1.6   14    6-19     20-33  (115)
243 COG4118 Phd Antitoxin of toxin  27.0      24 0.00052   19.5   0.2   15    6-20     20-34  (84)
244 cd04452 S1_IF2_alpha S1_IF2_al  26.9      86  0.0019   15.8   2.4   15    7-21     50-64  (76)
245 cd05687 S1_RPS1_repeat_ec1_hs1  26.8      66  0.0014   16.1   1.9   15    7-21     45-59  (70)
246 cd05860 Ig4_SCFR Fourth immuno  26.7      95  0.0021   17.7   2.7   30    2-31     10-39  (101)
247 PF13533 Biotin_lipoyl_2:  Biot  26.6      47   0.001   16.1   1.2   10    5-14     16-25  (50)
248 KOG1151|consensus               26.6      39 0.00085   25.2   1.3   21   52-72    622-647 (775)
249 TIGR03170 flgA_cterm flagella   26.6      86  0.0019   17.8   2.6   26    4-33     63-88  (122)
250 cd04471 S1_RNase_R S1_RNase_R:  26.5      96  0.0021   15.9   2.6   16    6-21     57-72  (83)
251 MTH00076 COX2 cytochrome c oxi  26.5 1.9E+02  0.0041   18.8   6.3   55    4-73    141-196 (228)
252 MTH00154 COX2 cytochrome c oxi  26.3 1.9E+02  0.0041   18.8   6.1   55    4-73    141-196 (227)
253 PF07452 CHRD:  CHRD domain;  I  26.3   1E+02  0.0022   17.3   2.8   18   14-32     38-55  (119)
254 TIGR02609 doc_partner putative  26.1      52  0.0011   17.4   1.5   16    5-20     22-37  (74)
255 PRK06518 hypothetical protein;  25.9 1.5E+02  0.0032   18.6   3.7   69    4-73     27-107 (177)
256 COG0198 RplX Ribosomal protein  25.9      55  0.0012   18.9   1.6   15    4-18      2-16  (104)
257 smart00841 Elong-fact-P_C Elon  25.9      54  0.0012   16.8   1.4   13    4-16     35-47  (56)
258 PF01557 FAA_hydrolase:  Fumary  25.7      91   0.002   19.6   2.8   16    2-17    191-206 (218)
259 smart00316 S1 Ribosomal protei  25.7      92   0.002   14.9   2.5   16    6-21     46-61  (72)
260 PRK06944 sulfur carrier protei  25.5      39 0.00085   16.9   0.9   12    5-16     48-59  (65)
261 CHL00010 infA translation init  25.4      76  0.0017   17.0   2.1   16    5-20     45-60  (78)
262 cd00174 SH3 Src homology 3 dom  25.3      41 0.00089   15.4   0.9   15    4-18     15-29  (54)
263 PF01345 DUF11:  Domain of unkn  25.2      60  0.0013   16.8   1.6   17   51-67     36-53  (76)
264 PRK10897 phosphohistidinoprote  25.2      37  0.0008   18.8   0.8   18    3-20     53-70  (90)
265 PTZ00241 40S ribosomal protein  25.1      37  0.0008   21.1   0.8   16    4-19    114-129 (158)
266 cd05686 S1_pNO40 S1_pNO40: pNO  25.0      93   0.002   15.9   2.3   15    7-21     49-63  (73)
267 PRK01191 rpl24p 50S ribosomal   24.8      64  0.0014   19.2   1.8   15    4-18     43-57  (120)
268 PRK05863 sulfur carrier protei  24.8      47   0.001   17.0   1.1   10    7-16     50-59  (65)
269 cd05705 S1_Rrp5_repeat_hs14 S1  24.7      60  0.0013   17.0   1.5   16    7-22      1-16  (74)
270 TIGR00638 Mop molybdenum-pteri  24.6      50  0.0011   16.5   1.2   15    5-19     47-61  (69)
271 TIGR01646 vgr_GE Rhs element V  24.4      96  0.0021   22.0   2.9   24    5-28    406-429 (483)
272 TIGR01683 thiS thiamine biosyn  24.4      62  0.0013   16.3   1.5   12    5-16     47-58  (64)
273 PF05489 Phage_tail_X:  Phage T  24.4      35 0.00075   17.5   0.5   12    3-14      1-12  (60)
274 cd00565 ThiS ThiaminS ubiquiti  24.3      62  0.0013   16.4   1.5   12    5-16     48-59  (65)
275 COG3269 Predicted RNA-binding   24.3      61  0.0013   17.6   1.5   17    6-22     45-61  (73)
276 MTH00168 COX2 cytochrome c oxi  24.3 2.1E+02  0.0045   18.5   6.7   55    4-73    141-196 (225)
277 PF06205 GT36_AF:  Glycosyltran  24.1 1.1E+02  0.0024   16.8   2.6   16    4-19     67-82  (90)
278 cd05716 Ig_pIgR Immunoglobulin  24.0      88  0.0019   16.7   2.2   14    4-17      1-14  (98)
279 PRK13831 conjugal transfer pro  24.0      99  0.0021   22.4   2.8   21    2-22    406-426 (432)
280 PRK13881 conjugal transfer pro  24.0      86  0.0019   22.9   2.5   21    2-22    442-462 (472)
281 PF11325 DUF3127:  Domain of un  23.9      71  0.0015   17.7   1.7   14    6-19     52-65  (84)
282 cd03697 EFTU_II EFTU_II: Elong  23.8      77  0.0017   17.0   1.9   14    6-19     58-71  (87)
283 PF03712 Cu2_monoox_C:  Copper   23.7      74  0.0016   19.3   2.0   16    3-18     85-100 (156)
284 COG2847 Copper(I)-binding prot  23.6      59  0.0013   20.1   1.5   15    4-18    113-127 (151)
285 PF09347 DUF1989:  Domain of un  23.5      79  0.0017   19.6   2.1   13    4-16     11-23  (166)
286 PF10610 Tafi-CsgC:  Thin aggre  23.5      93   0.002   18.1   2.2   18    3-20     71-88  (106)
287 TIGR00046 RNA methyltransferas  23.4      44 0.00095   21.6   1.0   14    4-17     29-42  (240)
288 TIGR03361 VI_Rhs_Vgr type VI s  23.3      96  0.0021   22.2   2.7   23    6-28    418-440 (513)
289 PRK10862 SoxR reducing system   23.3      37 0.00081   20.7   0.6   16    5-20     57-72  (154)
290 cd05692 S1_RPS1_repeat_hs4 S1_  23.3      88  0.0019   15.1   2.0   14    7-20     45-58  (69)
291 PRK01777 hypothetical protein;  23.3      46   0.001   18.7   1.0   11    6-16     64-74  (95)
292 PF09285 Elong-fact-P_C:  Elong  23.2      64  0.0014   16.5   1.4   11    6-16     37-47  (56)
293 PF11797 DUF3324:  Protein of u  23.2   1E+02  0.0022   18.3   2.5   22   51-72     85-111 (140)
294 PRK09798 antitoxin MazE; Provi  23.0      61  0.0013   17.7   1.4   16    5-20     25-40  (82)
295 COG1596 Wza Periplasmic protei  22.9      92   0.002   20.2   2.4   19    3-21     44-62  (239)
296 cd05752 Ig1_FcgammaR_like Frst  22.8      90  0.0019   16.3   2.0   29    2-30      7-35  (78)
297 cd05691 S1_RPS1_repeat_ec6 S1_  22.7      95  0.0021   15.4   2.1   15    7-21     45-59  (73)
298 cd05706 S1_Rrp5_repeat_sc10 S1  22.6      93   0.002   15.7   2.0   15    7-21     48-62  (73)
299 TIGR03027 pepcterm_export puta  22.4      69  0.0015   19.4   1.7   17    6-22      2-18  (165)
300 PRK08053 sulfur carrier protei  22.2      56  0.0012   16.7   1.1   12    5-16     49-60  (66)
301 cd05707 S1_Rrp5_repeat_sc11 S1  22.2      96  0.0021   15.4   2.0   16    7-22     45-60  (68)
302 cd04486 YhcR_OBF_like YhcR_OBF  22.2      59  0.0013   17.4   1.2   11    6-16     44-54  (78)
303 cd05696 S1_Rrp5_repeat_hs4 S1_  22.1      93   0.002   15.9   2.0   16    7-22     47-62  (71)
304 cd05754 Ig3_Perlecan_like Thir  22.1 1.3E+02  0.0028   15.5   4.0   29    2-30      8-36  (85)
305 PF12790 T6SS-SciN:  Type VI se  22.0      92   0.002   18.4   2.1   17   49-65     82-99  (142)
306 PF12945 YcgR_2:  Flagellar pro  22.0      99  0.0022   16.1   2.1   60    7-72      1-68  (87)
307 PF13157 DUF3992:  Protein of u  21.9      77  0.0017   17.9   1.7   13   51-63     57-69  (92)
308 cd09219 TLP-F thaumatin-like p  21.9 2.5E+02  0.0054   18.5   4.6   21   50-70     32-54  (229)
309 TIGR02756 TraK_Ftype type-F co  21.9 1.1E+02  0.0024   19.9   2.6   21    2-22     19-39  (232)
310 cd09218 TLP-PA allergenic/anti  21.8 2.4E+02  0.0052   18.4   4.4   22   50-71     30-52  (219)
311 cd05894 Ig_C5_MyBP-C C5 immuno  21.8 1.4E+02  0.0031   15.7   3.8   27    3-30      3-29  (86)
312 PRK00004 rplX 50S ribosomal pr  21.8      59  0.0013   18.6   1.2   15    5-19      3-17  (105)
313 smart00042 CUB Domain first fo  21.8      86  0.0019   16.5   1.9   16    4-19     21-36  (102)
314 cd05698 S1_Rrp5_repeat_hs6_sc5  21.7   1E+02  0.0022   15.4   2.0   15    7-21     45-59  (70)
315 PRK06488 sulfur carrier protei  21.7      59  0.0013   16.4   1.1   12    5-16     48-59  (65)
316 cd09215 Thaumatin-like the swe  21.7 2.1E+02  0.0046   17.6   4.6   21   50-70     28-49  (157)
317 PF13509 S1_2:  S1 domain; PDB:  21.6 1.3E+02  0.0028   15.1   2.4   17    6-22     37-53  (61)
318 PF04225 OapA:  Opacity-associa  21.4      50  0.0011   18.1   0.8   15    6-20     42-56  (85)
319 PF08206 OB_RNB:  Ribonuclease   21.2      77  0.0017   15.8   1.5   13    7-19     32-44  (58)
320 PRK13782 phosphocarrier protei  21.2      50  0.0011   17.7   0.8   17    3-19     51-67  (82)
321 TIGR03630 arch_S17P archaeal r  21.1      56  0.0012   18.8   1.0   13    5-17     74-86  (102)
322 PF02933 CDC48_2:  Cell divisio  21.1 1.1E+02  0.0023   15.4   2.0   14    5-18     17-30  (64)
323 cd05684 S1_DHX8_helicase S1_DH  21.0 1.3E+02  0.0028   15.5   2.4   15    6-20     48-62  (79)
324 PRK08572 rps17p 30S ribosomal   21.0      55  0.0012   19.1   0.9   13    5-17     76-88  (108)
325 cd00915 MD-1_MD-2 MD-1 and MD-  20.9 1.1E+02  0.0024   18.3   2.3   14   48-61     81-94  (130)
326 PF14801 GCD14_N:  tRNA methylt  20.8      78  0.0017   16.2   1.4   10    7-16      6-15  (54)
327 cd00041 CUB CUB domain; extrac  20.8 1.1E+02  0.0024   16.2   2.2   17    4-20     31-47  (113)
328 cd00305 Cu-Zn_Superoxide_Dismu  20.6   2E+02  0.0044   17.0   3.5   24   10-34     26-49  (144)
329 cd05704 S1_Rrp5_repeat_hs13 S1  20.6   1E+02  0.0022   15.8   1.9   15    7-21     49-63  (72)
330 cd05695 S1_Rrp5_repeat_hs3 S1_  20.5 1.1E+02  0.0023   15.5   2.0   17    6-22     42-58  (66)
331 PF04693 DDE_Tnp_2:  Archaeal p  20.5      48   0.001   23.0   0.7   12   64-75    105-116 (327)
332 cd04454 S1_Rrp4_like S1_Rrp4_l  20.4      99  0.0021   16.1   1.9   16    7-22     51-66  (82)
333 PTZ00194 60S ribosomal protein  20.4      85  0.0018   19.2   1.7   16    4-19     44-59  (143)
334 cd08548 Type_I_cohesin_like Ty  20.3 1.3E+02  0.0029   17.7   2.6   15    4-18      7-21  (135)
335 PF00963 Cohesin:  Cohesin doma  20.3 1.2E+02  0.0027   17.5   2.4   14    5-18      8-21  (141)
336 cd07690 Ig1_CD4 First immunogl  20.2 1.7E+02  0.0037   16.0   3.8   26    5-31      2-27  (94)
337 COG1278 CspC Cold shock protei  20.2      95  0.0021   16.5   1.7   17    6-22     41-57  (67)
338 cd05717 Ig1_Necl-1-3_like Firs  20.1 1.6E+02  0.0034   15.6   4.0   28    3-31      5-32  (95)
339 PRK13780 phosphocarrier protei  20.0      56  0.0012   18.0   0.8   18    3-20     51-68  (88)
340 cd05749 Ig2_Tyro3_like Second   20.0 1.6E+02  0.0034   15.6   3.6   29    2-30      5-33  (81)

No 1  
>PF07732 Cu-oxidase_3:  Multicopper oxidase;  InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08.  This entry represents multicopper oxidase type 3 (or coupled binuclear) domains. ; GO: 0005507 copper ion binding; PDB: 2QT6_B 3KW7_B 2R7E_A 3CDZ_A 1SDD_A 3G5W_D 3UAC_A 2YXV_A 3OD3_A 3NSY_A ....
Probab=99.97  E-value=5.6e-32  Score=159.01  Aligned_cols=73  Identities=48%  Similarity=0.865  Sum_probs=69.0

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CC-CeeeEEccCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-AN-AGTHFWHAHT   75 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~-~Gt~~YH~H~   75 (75)
                      .++||+++||+|+|+|+|.++ .+++|||||+.++..+++||++..++++|.||++++|+|+ .+ +||||||||+
T Consensus        25 GPtI~v~~Gd~v~i~~~N~l~-~~~siH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~Y~~~~~~~~Gt~wYH~H~   99 (117)
T PF07732_consen   25 GPTIRVREGDTVRITVTNNLD-EPTSIHWHGLHQPPSPWMDGVPGVTQCPIAPGESFTYEFTANQQAGTYWYHSHV   99 (117)
T ss_dssp             EEEEEEETTEEEEEEEEEESS-SGBSEEEETSBSTTGGGGSGGTTTSGSSBSTTEEEEEEEEESSCSEEEEEEECS
T ss_pred             CCEEEEEcCCeeEEEEEeccc-cccccccceeeeeeeeecCCcccccceeEEeecceeeeEeeeccccceeEeeCC
Confidence            579999999999999999998 8999999999998887899999999999999999999999 55 9999999995


No 2  
>PLN02835 oxidoreductase
Probab=99.96  E-value=9.6e-30  Score=178.84  Aligned_cols=73  Identities=29%  Similarity=0.559  Sum_probs=69.2

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+++|+++ ++++|||||+.+...+|+||+++ +||||+||++|+|+|+  +++||||||||.
T Consensus        58 PGP~I~~~~GD~v~v~v~N~L~-~~ttiHWHGl~~~~~~~~DGv~~-tQ~pI~PG~sf~Y~F~~~~q~GT~WYHsH~  132 (539)
T PLN02835         58 PGPRLDVVTNDNIILNLINKLD-QPFLLTWNGIKQRKNSWQDGVLG-TNCPIPPNSNYTYKFQTKDQIGTFTYFPST  132 (539)
T ss_pred             CCCCEEEECCCEEEEEEEeCCC-CCCcEEeCCcccCCCCCCCCCcc-CcCCCCCCCcEEEEEEECCCCEeEEEEeCc
Confidence            4689999999999999999999 89999999999998889999998 8999999999999998  689999999994


No 3  
>PLN02168 copper ion binding / pectinesterase
Probab=99.96  E-value=1.5e-29  Score=178.04  Aligned_cols=73  Identities=26%  Similarity=0.501  Sum_probs=69.4

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|++.|+++ ++++|||||+.+...+|+||+++ +||||+||++|+|+|+  +++||||||||.
T Consensus        55 PGP~I~~~~GD~v~V~v~N~L~-~~ttiHWHGl~~~~~~~~DGv~g-tQcpI~PG~sftY~F~~~~q~GT~WYHsH~  129 (545)
T PLN02168         55 PGPLLNATANDVINVNIFNNLT-EPFLMTWNGLQLRKNSWQDGVRG-TNCPILPGTNWTYRFQVKDQIGSYFYFPSL  129 (545)
T ss_pred             CCCcEEEECCCEEEEEEEeCCC-CCccEeeCCccCCCCCCcCCCCC-CcCCCCCCCcEEEEEEeCCCCceEEEecCh
Confidence            4689999999999999999999 89999999999998889999999 9999999999999999  589999999994


No 4  
>PLN02792 oxidoreductase
Probab=99.96  E-value=2.1e-29  Score=177.08  Aligned_cols=73  Identities=30%  Similarity=0.598  Sum_probs=69.2

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+|.|+++ ++++|||||+.++..+|+||+++ +||||+||++|+|+|+  +++||||||||.
T Consensus        45 PGP~I~~~~GD~v~V~v~N~L~-~~ttiHWHGl~q~~~~~~DGv~~-tqcPI~PG~sftY~F~~~~q~GT~WYHsH~  119 (536)
T PLN02792         45 PGPEIRSLTNDNLVINVHNDLD-EPFLLSWNGVHMRKNSYQDGVYG-TTCPIPPGKNYTYDFQVKDQVGSYFYFPSL  119 (536)
T ss_pred             CCCcEEEECCCEEEEEEEeCCC-CCcCEeCCCcccCCCCccCCCCC-CcCccCCCCcEEEEEEeCCCccceEEecCc
Confidence            4689999999999999999999 89999999999999899999987 8999999999999999  589999999995


No 5  
>PLN02354 copper ion binding / oxidoreductase
Probab=99.96  E-value=1.6e-29  Score=178.06  Aligned_cols=73  Identities=34%  Similarity=0.636  Sum_probs=69.5

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|++.|+++ ++++|||||+.+...+|+||+++ +||||+||++|+|+|+  +++||||||||.
T Consensus        56 PGP~I~~~~GD~v~V~v~N~l~-~~ttiHWHGi~q~~~~~~DGv~~-TQcpI~PG~sf~Y~F~~~~q~GT~WYHsH~  130 (552)
T PLN02354         56 PGPNINSTSNNNIVINVFNNLD-EPFLLTWSGIQQRKNSWQDGVPG-TNCPIPPGTNFTYHFQPKDQIGSYFYYPST  130 (552)
T ss_pred             cCCcEEEeCCCEEEEEEEECCC-CCcccccccccCCCCcccCCCcC-CcCCCCCCCcEEEEEEeCCCCcceEEecCc
Confidence            4689999999999999999998 89999999999998889999999 9999999999999999  589999999995


No 6  
>TIGR03389 laccase laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
Probab=99.96  E-value=3.4e-29  Score=175.94  Aligned_cols=74  Identities=42%  Similarity=0.824  Sum_probs=70.3

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++|++++||+|+|+++|+++ .+++|||||+.+...+++||+++++||||+||++++|+|+  +++||||||||.
T Consensus        32 PGP~i~~~~GD~v~v~v~N~l~-~~tsiHwHGl~q~~~~~~DGv~~vTq~pI~PG~s~~Y~f~~~~~~GT~WYHsH~  107 (539)
T TIGR03389        32 PGPTLYAREGDTVIVNVTNNVQ-YNVTIHWHGVRQLRNGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLWWHAHI  107 (539)
T ss_pred             cCCEEEEEcCCEEEEEEEeCCC-CCeeEecCCCCCCCCCCCCCCcccccCCcCCCCeEEEEEEecCCCeeEEEecCc
Confidence            4689999999999999999999 8999999999998888999999999999999999999999  599999999994


No 7  
>PLN00044 multi-copper oxidase-related protein; Provisional
Probab=99.96  E-value=3.3e-29  Score=177.56  Aligned_cols=73  Identities=36%  Similarity=0.604  Sum_probs=69.4

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+|.|+++ .+++|||||+.+...+|+||+++ +||||+||++|+|+|+  +++||||||||+
T Consensus        58 PGPtI~~~~GD~v~V~V~N~L~-~~ttIHWHGl~q~~t~w~DGv~~-TQcPI~PG~sftY~F~~~dq~GT~WYHsH~  132 (596)
T PLN00044         58 PGPALNVTTNWNLVVNVRNALD-EPLLLTWHGVQQRKSAWQDGVGG-TNCAIPAGWNWTYQFQVKDQVGSFFYAPST  132 (596)
T ss_pred             CCCcEEEECCCEEEEEEEeCCC-CCccEEECCccCCCCccccCCCC-CcCCcCCCCcEEEEEEeCCCCceeEeeccc
Confidence            4689999999999999999999 89999999999999899999987 9999999999999999  699999999995


No 8  
>PLN02991 oxidoreductase
Probab=99.96  E-value=3.2e-29  Score=176.30  Aligned_cols=73  Identities=26%  Similarity=0.495  Sum_probs=69.1

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++|++++||+|+|+++|+++ ++++|||||+.+...+|+||+++ +||||+||++|+|+|+  +++||||||||.
T Consensus        57 PGP~I~~~~GD~v~V~V~N~L~-~~ttiHWHGi~q~~~~~~DGv~~-tQcpI~PG~sftY~F~~~~q~GT~WYHsH~  131 (543)
T PLN02991         57 PGPDIISVTNDNLIINVFNHLD-EPFLISWSGIRNWRNSYQDGVYG-TTCPIPPGKNYTYALQVKDQIGSFYYFPSL  131 (543)
T ss_pred             CCCcEEEECCCEEEEEecCCCC-CCccEEECCcccCCCccccCCCC-CCCccCCCCcEEEEEEeCCCCcceEEecCc
Confidence            4689999999999999999999 89999999999988889999988 8999999999999999  589999999994


No 9  
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
Probab=99.96  E-value=5.9e-29  Score=174.80  Aligned_cols=75  Identities=35%  Similarity=0.666  Sum_probs=70.0

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc---CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT---ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~---~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+|.|+++..+++|||||+.+...+|+||+++++||||+||++|+|+|+   +++||||||||.
T Consensus        37 PGP~I~~~~GD~v~V~v~N~L~~~~ttiHwHGi~~~~~~~~DGvp~vTQcpI~PG~sf~Y~f~~~~~q~GT~WYHsH~  114 (538)
T TIGR03390        37 PGPEIRLQEGQTTWIRVYNDIPDNNVTMHWHGLTQRTAPFSDGTPLASQWPIPPGHFFDYEIKPEPGDAGSYFYHSHV  114 (538)
T ss_pred             CCCeEEEeCCCEEEEEEEECCCCCCceEECCCCCCCCCCCCCCCcccccCCCCCCCcEEEEEEecCCCCeeeEEecCC
Confidence            468999999999999999998646899999999998888999999999999999999999998   389999999995


No 10 
>PLN02191 L-ascorbate oxidase
Probab=99.96  E-value=1.3e-28  Score=174.06  Aligned_cols=75  Identities=43%  Similarity=0.787  Sum_probs=70.7

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|++.|+++..+++|||||+.+...+|+||+++++||||+||++|+|+|+ +++||||||||.
T Consensus        52 pGP~i~~~~Gd~v~v~v~N~l~~~~tsiHwHGl~~~~~~~~DGv~gvtq~pI~PG~s~~Y~f~~~~~GT~wYHsH~  127 (574)
T PLN02191         52 PGPTIDAVAGDTIVVHLTNKLTTEGLVIHWHGIRQKGSPWADGAAGVTQCAINPGETFTYKFTVEKPGTHFYHGHY  127 (574)
T ss_pred             CCCeEEEEcCCEEEEEEEECCCCCCccEECCCCCCCCCccccCCCccccCCcCCCCeEEEEEECCCCeEEEEeeCc
Confidence            468999999999999999998746899999999999888999999999999999999999999 999999999995


No 11 
>TIGR03388 ascorbase L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
Probab=99.95  E-value=2.6e-27  Score=166.58  Aligned_cols=75  Identities=41%  Similarity=0.700  Sum_probs=70.0

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+|.|++...+++|||||+.+...+|+||+++++||+|+||++++|+|+ +++||||||||.
T Consensus        30 pGP~i~~~~Gd~v~v~v~N~l~~~~t~iHwHGl~~~~~~~~DG~~~vtq~~I~PG~s~~y~f~~~~~Gt~wyH~H~  105 (541)
T TIGR03388        30 PGPTIRAQAGDTIVVELTNKLHTEGVVIHWHGIRQIGTPWADGTAGVTQCAINPGETFIYNFVVDRPGTYFYHGHY  105 (541)
T ss_pred             CCCeEEEEcCCEEEEEEEECCCCCCccEEecCcCCcCCcccCCCCccccCCcCCCCEEEEEEEcCCCEEEEEEecc
Confidence            368999999999999999998546899999999988888899999999999999999999999 999999999994


No 12 
>PLN02604 oxidoreductase
Probab=99.94  E-value=1.1e-26  Score=164.13  Aligned_cols=74  Identities=45%  Similarity=0.730  Sum_probs=69.1

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      .++||+++||+|+|+|+|++..++++|||||+.+...+++||+++++||+|+||++++|+|+ +++||||||||.
T Consensus        54 gP~i~~~~Gd~v~v~v~N~l~~~~~~iH~HG~~~~~~~~~DG~~~~tq~~i~pg~s~~y~f~~~~~Gt~wyH~H~  128 (566)
T PLN02604         54 GPTILAQQGDTVIVELKNSLLTENVAIHWHGIRQIGTPWFDGTEGVTQCPILPGETFTYEFVVDRPGTYLYHAHY  128 (566)
T ss_pred             CCcEEEECCCEEEEEEEeCCCCCCCCEEeCCCCCCCCccccCCCccccCccCCCCeEEEEEEcCCCEEEEEeeCc
Confidence            57899999999999999998437899999999988778899999999999999999999999 999999999995


No 13 
>TIGR01480 copper_res_A copper-resistance protein, CopA family. This model represents the CopA copper resistance protein family. CopA is related to laccase (benzenediol:oxygen oxidoreductase) and L-ascorbate oxidase, both copper-containing enzymes. Most members have a typical TAT (twin-arginine translocation) signal sequence with an Arg-Arg pair. Twin-arginine translocation is observed for a large number of periplasmic proteins that cross the inner membrane with metal-containing cofactors already bound. The combination of copper-binding sites and TAT translocation motif suggests a mechansism of resistance by packaging and export.
Probab=99.94  E-value=8.3e-27  Score=165.26  Aligned_cols=72  Identities=38%  Similarity=0.582  Sum_probs=67.6

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+|+|+++ .+++|||||+..+.  .+||+|+++|++|+||++++|+|+ .++||||||||.
T Consensus        74 PGP~ir~~~Gd~v~v~v~N~l~-~~tsiHwHGl~~~~--~~DGvP~vt~~~I~PG~s~~Y~f~~~~~GTyWYHsH~  146 (587)
T TIGR01480        74 PGPLLRWREGDTVRLRVTNTLP-EDTSIHWHGILLPF--QMDGVPGVSFAGIAPGETFTYRFPVRQSGTYWYHSHS  146 (587)
T ss_pred             CCceEEEECCCEEEEEEEcCCC-CCceEEcCCCcCCc--cccCCCcccccccCCCCeEEEEEECCCCeeEEEecCc
Confidence            4689999999999999999999 89999999998864  589999999999999999999999 999999999995


No 14 
>KOG1263|consensus
Probab=99.94  E-value=9e-27  Score=164.24  Aligned_cols=73  Identities=44%  Similarity=0.830  Sum_probs=70.0

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++|++++||+|.|.+.|.++ ++.+|||||+++...+|+|| +.++||||+||++|+|+|+  ++.||||||+|+
T Consensus        57 PGP~I~~~~gD~ivV~v~N~~~-~~~sihWhGv~q~kn~w~DG-~~~TqCPI~Pg~~~tY~F~v~~q~GT~~yh~h~  131 (563)
T KOG1263|consen   57 PGPTINAEEGDTIVVNVVNRLD-EPFSIHWHGVRQRKNPWQDG-VYITQCPIQPGENFTYRFTVKDQIGTLWYHSHV  131 (563)
T ss_pred             CCCeEEEEeCCEEEEEEEeCCC-CceEEEeccccccCCccccC-CccccCCcCCCCeEEEEEEeCCcceeEEEeecc
Confidence            4689999999999999999999 89999999999999999999 9999999999999999999  699999999995


No 15 
>PRK10965 multicopper oxidase; Provisional
Probab=99.92  E-value=3.4e-25  Score=155.54  Aligned_cols=69  Identities=35%  Similarity=0.564  Sum_probs=63.1

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-C-CCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-A-NAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~-~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|+++|.++ .+++|||||+.++.  .+||+|   ||+|+||++++|+|+ + ++||||||||.
T Consensus        75 PGPtIr~~~Gd~v~v~~~N~L~-~~ttiHwHGl~~~~--~~DG~p---q~~I~PG~s~~Y~f~~~q~aGT~WYH~H~  145 (523)
T PRK10965         75 LGPAVRLQRGKAVTVDITNQLP-EETTLHWHGLEVPG--EVDGGP---QGIIAPGGKRTVTFTVDQPAATCWFHPHQ  145 (523)
T ss_pred             CCceEEEECCCEEEEEEEECCC-CCccEEcccccCCC--ccCCCC---CCCCCCCCEEEEEeccCCCCceEEEecCC
Confidence            4689999999999999999999 89999999999875  389987   789999999999999 5 58999999994


No 16 
>PRK10883 FtsI repressor; Provisional
Probab=99.89  E-value=5e-23  Score=143.21  Aligned_cols=69  Identities=20%  Similarity=0.264  Sum_probs=60.0

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H~   75 (75)
                      ++++||+++||+|+|++.|.++ ++++|||||+.++.. ..||++    ++|+||++++|.|+  +++||||||||.
T Consensus        75 pGPtir~~~Gd~v~v~v~N~L~-~~ttiHwHGl~~~~~-~~~g~~----~~I~PG~~~~y~f~~~~~aGT~WYH~H~  145 (471)
T PRK10883         75 LGPTIRVWKGDDVKLIYSNRLT-EPVSMTVSGLQVPGP-LMGGPA----RMMSPNADWAPVLPIRQNAATCWYHANT  145 (471)
T ss_pred             cCCeEEEECCCEEEEEEEeCCC-CCCceeECCccCCCC-CCCCcc----ccCCCCCeEEEEEecCCCceeeEEccCC
Confidence            3579999999999999999999 899999999998754 355543    46999999999998  569999999994


No 17 
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing. This family consists of copper-type nitrite reductase. It reduces nitrite to nitric oxide, the first step in denitrification.
Probab=99.83  E-value=2.1e-20  Score=124.60  Aligned_cols=66  Identities=23%  Similarity=0.325  Sum_probs=57.0

Q ss_pred             cccEEEecCCEEEEEEEeCCCC-CCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDG-LENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~-~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .++||+++||+|+|+|+|.+.. .++++||||..     +.||.+..++  |+||++++|+|. +++||||||||
T Consensus        58 GP~irv~~Gd~v~v~v~N~~~~~~~h~~h~H~~~-----~~dg~~~~~~--I~PG~t~ty~F~~~~~Gty~YH~H  125 (311)
T TIGR02376        58 GPLIRVHEGDYVELTLINPPTNTMPHNVDFHAAT-----GALGGAALTQ--VNPGETATLRFKATRPGAFVYHCA  125 (311)
T ss_pred             CceEEEECCCEEEEEEEeCCCCCCceeeeecCCC-----ccCCCCccee--ECCCCeEEEEEEcCCCEEEEEEcC
Confidence            5789999999999999999741 48999999963     3577766554  899999999999 99999999999


No 18 
>TIGR01480 copper_res_A copper-resistance protein, CopA family. This model represents the CopA copper resistance protein family. CopA is related to laccase (benzenediol:oxygen oxidoreductase) and L-ascorbate oxidase, both copper-containing enzymes. Most members have a typical TAT (twin-arginine translocation) signal sequence with an Arg-Arg pair. Twin-arginine translocation is observed for a large number of periplasmic proteins that cross the inner membrane with metal-containing cofactors already bound. The combination of copper-binding sites and TAT translocation motif suggests a mechansism of resistance by packaging and export.
Probab=99.79  E-value=2.9e-19  Score=127.03  Aligned_cols=71  Identities=21%  Similarity=0.307  Sum_probs=59.7

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCC--cccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVP--FVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~--~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      .+|++++||+|+|+|.|.+. ++|+|||||+.+... ..||..  ...+..|+||++++|+|. +++|+||||||.
T Consensus       499 ~pl~v~~Gervri~l~N~t~-~~HpmHlHG~~f~v~-~~~G~~~~~~dTv~V~Pg~t~~~~f~ad~pG~w~~HCH~  572 (587)
T TIGR01480       499 TPLRFNYGERLRVVLVNDTM-MAHPIHLHGMWSELE-DGQGEFQVRKHTVDVPPGGKRSFRVTADALGRWAYHCHM  572 (587)
T ss_pred             CceEecCCCEEEEEEECCCC-CCcceeEcCceeeee-cCCCcccccCCceeeCCCCEEEEEEECCCCeEEEEcCCC
Confidence            47999999999999999998 899999999987643 235532  123467999999999999 999999999994


No 19 
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=99.79  E-value=4.2e-19  Score=122.73  Aligned_cols=72  Identities=38%  Similarity=0.604  Sum_probs=65.0

Q ss_pred             CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      +.++||+++||+|+|.++|.+. .++++||||+..+  ...||++..+++++.||++++|.|+ +.+||||||+|.
T Consensus        62 ~gP~i~~~~Gd~v~l~~~N~l~-~~t~vh~HG~~~p--~~~dG~~~~~~~~~~~~~~~~y~f~~~~~gT~wyh~H~  134 (451)
T COG2132          62 PGPTIRVKKGDTVTLDLTNRLL-VDTSVHWHGLPVP--GEMDGVPPLTQIPPGPGETPTYTFTQDVPGTYWYHPHT  134 (451)
T ss_pred             cCceEEEecCCEEEEEEEeCCC-CCceEEEcCcccC--ccccCCCcccccCCCCCCcEEEeecCCCCcceEeccCC
Confidence            3689999999999999999987 4599999998776  4589998888999999999999999 888899999995


No 20 
>TIGR03095 rusti_cyanin rusticyanin. Rusticyanin is a blue copper protein, described in an obligate acidophilic chemolithoautroph, Acidithiobacillus ferrooxidans, as an electron transfer protein. It can constitute up to 5 percent of protein in cells grown on Fe(II) and is thought to be part of an electron chain for Fe(II) oxidation, with two c-type cytochromes, an aa3-type cytochrome oxidase, and 02 as terminal electron acceptor. It is rather closely related to sulfocyanin (TIGR03094).
Probab=99.72  E-value=4.1e-17  Score=99.29  Aligned_cols=74  Identities=19%  Similarity=0.123  Sum_probs=55.9

Q ss_pred             cccEEEecCCEEEEEEEeCCCC--CCceEEeCCccccCCCCCCCCCcccccccCCC----CE--EEEEEc-CCCeeeEEc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDG--LENTIHWHGIHQRGTQYSDGVPFVTQCPITQG----NT--FRYQFT-ANAGTHFWH   72 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~--~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG----~~--~~y~~~-~~~Gt~~YH   72 (75)
                      .++|++++||+|+|.+.|..+.  -...||++|...+..+.+||++..+++++.|+    +.  .++.|+ .++|+||||
T Consensus        51 ~P~I~v~~Gd~V~v~v~N~~~~~~H~~~I~~~g~~~~~~p~mdG~~~~~~~~i~p~~~~g~~~~~~~tf~f~~aGtywyh  130 (148)
T TIGR03095        51 NPTIVIPEGVTVHFTVINTDTDSGHNFDISKRGPPYPYMPGMDGLGFVAGTGFLPPPKSGKFGYTDFTYHFSTAGTYWYL  130 (148)
T ss_pred             CCEEEEcCCCEEEEEEEeCCCCccccEEeecCCCccccccccCCCCccccCcccCCCCCCccceeEEEEECCCCeEEEEE
Confidence            4678999999999999999641  23567777765554455899988888888773    22  355666 789999999


Q ss_pred             cCC
Q psy88            73 AHT   75 (75)
Q Consensus        73 ~H~   75 (75)
                      ||.
T Consensus       131 C~~  133 (148)
T TIGR03095       131 CTY  133 (148)
T ss_pred             cCC
Confidence            984


No 21 
>PF07731 Cu-oxidase_2:  Multicopper oxidase;  InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08.  This entry represents multicopper oxidase type 2 domains.; GO: 0005507 copper ion binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3GDC_C 3ZX1_A 2YAH_A 2YAR_A 2YAQ_A 2YAO_A 2YAM_A 2YAF_A 2YAP_A 2XU9_A ....
Probab=99.52  E-value=3e-14  Score=84.54  Aligned_cols=72  Identities=22%  Similarity=0.339  Sum_probs=58.5

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCc---------------ccccccCCCCEEEEEEc-CC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPF---------------VTQCPITQGNTFRYQFT-AN   65 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~---------------~~~~~i~pG~~~~y~~~-~~   65 (75)
                      ...++++.|+.+++.+.|... .++++|+||..+.... .++...               .....|+||+..+.+|. +.
T Consensus        33 ~~~~~~~~g~~v~~~l~N~~~-~~Hp~HlHG~~F~vl~-~~~~~~~~~~~~~~~~~~~~~~DTv~v~~~~~~~i~~~~~~  110 (138)
T PF07731_consen   33 TPVIEVKNGDVVEIVLQNNGS-MPHPFHLHGHSFQVLG-RGGGPWNPDDTQSYNPENPGWRDTVLVPPGGWVVIRFRADN  110 (138)
T ss_dssp             TSEEEEETTSEEEEEEEECTT-SSEEEEETTSEEEEEE-ETTEESTTHCGGCCCSSSSSEESEEEEETTEEEEEEEEETS
T ss_pred             cceEEEeCCCEEEEEEECCCC-CccceEEEeeEEEeee-cCCcccccccccccccccCcccccccccceeEEEEEEEeec
Confidence            357899999999999999988 8999999998875332 222221               23566899999999999 99


Q ss_pred             CeeeEEccCC
Q psy88            66 AGTHFWHAHT   75 (75)
Q Consensus        66 ~Gt~~YH~H~   75 (75)
                      +|.|.||||.
T Consensus       111 ~G~w~~HCHi  120 (138)
T PF07731_consen  111 PGPWLFHCHI  120 (138)
T ss_dssp             TEEEEEEESS
T ss_pred             ceEEEEEEch
Confidence            9999999994


No 22 
>TIGR03096 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as described from the obligate chemolithoautotroph Nitrosomonas europaea, is a red copper protein of unknown function with sequence similarity to a number of blue copper redox proteins.
Probab=99.34  E-value=6.5e-12  Score=75.39  Aligned_cols=59  Identities=24%  Similarity=0.253  Sum_probs=45.9

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      +..|++++||+|++++.|..+ .+     |++....    .|.    ...++||++.+++|+ +++|+|+|||-
T Consensus        60 P~~I~VkaGD~Vtl~vtN~d~-~~-----H~f~i~~----~gi----s~~I~pGet~TitF~adKpG~Y~y~C~  119 (135)
T TIGR03096        60 PEALVVKKGTPVKVTVENKSP-IS-----EGFSIDA----YGI----SEVIKAGETKTISFKADKAGAFTIWCQ  119 (135)
T ss_pred             CCEEEECCCCEEEEEEEeCCC-Cc-----cceEECC----CCc----ceEECCCCeEEEEEECCCCEEEEEeCC
Confidence            568999999999999999876 44     4433321    122    224899999999999 99999999994


No 23 
>PLN02835 oxidoreductase
Probab=99.10  E-value=2.2e-10  Score=81.43  Aligned_cols=71  Identities=13%  Similarity=0.042  Sum_probs=55.5

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      +++++.|+.|+|.+.|... .+|.||+||..+......+|              .+...+..|++++....+|. ++||.
T Consensus       412 ~~~~~~~~~Veivi~N~~~-~~HP~HLHGh~F~Vlg~G~g~~~~~~~~~~nl~nP~~RDTv~vp~~gw~~IrF~aDNPG~  490 (539)
T PLN02835        412 VMQTSLHDFLEVVFQNNEK-TMQSWHLDGYDFWVVGYGSGQWTPAKRSLYNLVDALTRHTAQVYPKSWTTILVSLDNQGM  490 (539)
T ss_pred             EEEcCCCCEEEEEEECCCC-CCCCCCCCCccEEEEeccCCCCCcccccccCCCCCCccceEEeCCCCEEEEEEECcCCEE
Confidence            4677889999999999987 79999999988654322233              11123455788999999999 99999


Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      |++|||.
T Consensus       491 Wl~HCHi  497 (539)
T PLN02835        491 WNMRSAI  497 (539)
T ss_pred             eeeeecc
Confidence            9999994


No 24 
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=98.99  E-value=1.4e-09  Score=75.55  Aligned_cols=71  Identities=17%  Similarity=0.264  Sum_probs=57.3

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCC-----CC-CcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSD-----GV-PFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~D-----G~-~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      .++.++.||..++.+.|... +.+.+|.||..+.... .|     .. ..-....+.||++..++|. +.+|.|.||||.
T Consensus       357 ~~~~~~~G~~~~~~i~n~~~-~~HP~HlHg~~F~v~~-~~~~~~~~~~~~kDTv~v~~~~~~~v~~~a~~~g~~~~HCH~  434 (451)
T COG2132         357 VTLIAKAGTRERWVLTNDTP-MPHPFHLHGHFFQVLS-GDAPAPGAAPGWKDTVLVAPGERLLVRFDADYPGPWMFHCHI  434 (451)
T ss_pred             CceeecCCCEEEEEEECCCC-CccCeEEcCceEEEEe-cCCCcccccCccceEEEeCCCeEEEEEEeCCCCCceEEeccc
Confidence            57799999999999999998 8999999998876432 21     01 1112455899999999999 999999999994


No 25 
>TIGR03388 ascorbase L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
Probab=98.98  E-value=1.7e-09  Score=76.79  Aligned_cols=72  Identities=21%  Similarity=0.212  Sum_probs=53.8

Q ss_pred             cEEEecCCEEEEEEEeCCC-----CCCceEEeCCccccCCCCCCC---------------CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEGDRVVVDVRNSMD-----GLENTIHWHGIHQRGTQYSDG---------------VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~-----~~~~~iH~HG~~~~~~~~~DG---------------~~~~~~~~i~pG~~~~y~~~   63 (75)
                      +++++.|+.|+|.|.|...     ..+|.||+||..+.......|               .+...+..|+|++....+|.
T Consensus       417 ~~~~~~g~~Vdivi~n~~~~~~~~~~~HP~HLHGh~F~vlg~g~g~~~~~~~~~~~n~~nP~~RDTv~vp~~gwvvIRF~  496 (541)
T TIGR03388       417 IYRLKFNTTVDVILQNANTLNGNNSETHPWHLHGHDFWVLGYGEGKFRPGVDEKSYNLKNPPLRNTVVIFPYGWTALRFV  496 (541)
T ss_pred             EEEecCCCeEEEEEECCccccCCCCCCCcEEecCCceEEEeeccCCCCcccCcccccCCCCCEeceEEeCCCceEEEEEE
Confidence            4788999999999999741     257999999987653321111               12223455789999999999


Q ss_pred             -CCCeeeEEccCC
Q psy88            64 -ANAGTHFWHAHT   75 (75)
Q Consensus        64 -~~~Gt~~YH~H~   75 (75)
                       ++||.|++|||.
T Consensus       497 adNPG~W~~HCHi  509 (541)
T TIGR03388       497 ADNPGVWAFHCHI  509 (541)
T ss_pred             CCCCeEeeeeccc
Confidence             999999999994


No 26 
>TIGR03389 laccase laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
Probab=98.96  E-value=2.3e-09  Score=76.06  Aligned_cols=72  Identities=19%  Similarity=0.207  Sum_probs=54.1

Q ss_pred             cEEEecCCEEEEEEEeCCC--CCCceEEeCCccccCCCCCCCC---------------CcccccccCCCCEEEEEEc-CC
Q psy88             4 PKNVCEGDRVVVDVRNSMD--GLENTIHWHGIHQRGTQYSDGV---------------PFVTQCPITQGNTFRYQFT-AN   65 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~--~~~~~iH~HG~~~~~~~~~DG~---------------~~~~~~~i~pG~~~~y~~~-~~   65 (75)
                      +++++.|+.|+|.+.|...  ..+|.||+||..+.......|.               +...+..+++++....+|+ ++
T Consensus       416 v~~~~~~~~V~ivi~n~~~~~~~~HP~HLHGh~F~Vlg~g~g~~~~~~~~~~~nl~nP~rRDTv~vp~~g~vvirf~adN  495 (539)
T TIGR03389       416 VVRLKFNSTVELVLQDTSILGSENHPIHLHGYNFFVVGTGFGNFDPKKDPAKFNLVDPPERNTVGVPTGGWAAIRFVADN  495 (539)
T ss_pred             EEEecCCCEEEEEEecCCcCCCCCCcEeEcCCceEEEEeccCCCCcccCccccccCCCCeeeeEEcCCCceEEEEEecCC
Confidence            4788999999999999742  1489999999876533222221               1112455789999999999 99


Q ss_pred             CeeeEEccCC
Q psy88            66 AGTHFWHAHT   75 (75)
Q Consensus        66 ~Gt~~YH~H~   75 (75)
                      ||.|++|||.
T Consensus       496 PG~W~~HCHi  505 (539)
T TIGR03389       496 PGVWFMHCHL  505 (539)
T ss_pred             CeEEEEEecc
Confidence            9999999994


No 27 
>PLN02604 oxidoreductase
Probab=98.93  E-value=3.3e-09  Score=75.76  Aligned_cols=72  Identities=18%  Similarity=0.214  Sum_probs=53.8

Q ss_pred             cEEEecCCEEEEEEEeCCC-----CCCceEEeCCccccCCCCCCC---------------CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEGDRVVVDVRNSMD-----GLENTIHWHGIHQRGTQYSDG---------------VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~-----~~~~~iH~HG~~~~~~~~~DG---------------~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .++++.|+.|+|.|.|...     ..+|.||+||..+.......|               .+...+..|+|++....+|.
T Consensus       440 v~~~~~~~~Vdivi~n~~~~~~~~~~~HP~HLHGH~F~Vlg~G~G~~~~~~~~~~~nl~nP~rRDTv~vp~~gwvvIRF~  519 (566)
T PLN02604        440 IYRLQFNSTVDIILQNANTMNANNSETHPWHLHGHDFWVLGYGEGKFNMSSDPKKYNLVDPIMKNTVPVHPYGWTALRFR  519 (566)
T ss_pred             EEEccCCCeEEEEEECCccccCCCCCCCCEEecCCceEEEEecCCCCCccccccccCCCCCCccceEEeCCCceEEEEEE
Confidence            3788999999999999742     257999999987653321112               11123455789999999999


Q ss_pred             -CCCeeeEEccCC
Q psy88            64 -ANAGTHFWHAHT   75 (75)
Q Consensus        64 -~~~Gt~~YH~H~   75 (75)
                       ++||.|++|||.
T Consensus       520 aDNPG~WlfHCHI  532 (566)
T PLN02604        520 ADNPGVWAFHCHI  532 (566)
T ss_pred             CCCCeEeeEeecc
Confidence             999999999994


No 28 
>PLN02168 copper ion binding / pectinesterase
Probab=98.90  E-value=5.7e-09  Score=74.40  Aligned_cols=71  Identities=11%  Similarity=0.001  Sum_probs=54.4

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      .++++.|+.|+|.+.|... .+|.||+||..+.......|              .+...+..+++|+-...+|+ ++||.
T Consensus       416 v~~~~~~~~VeiViqn~~~-~~HP~HLHGh~F~Vvg~g~g~~~~~~~~~~Nl~nP~rRDTv~vp~~Gw~vIRF~aDNPG~  494 (545)
T PLN02168        416 VVDIHYKDFYHIVFQNPLF-SLESYHIDGYNFFVVGYGFGAWSESKKAGYNLVDAVSRSTVQVYPYSWTAILIAMDNQGM  494 (545)
T ss_pred             EEEecCCCEEEEEEeCCCC-CCCCeeeCCCceEEEECCCCCCCccccccCCCCCCCccceEEeCCCCEEEEEEEccCCeE
Confidence            3688999999999999876 79999999987653211111              11112445789999999999 99999


Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      |++|||.
T Consensus       495 Wl~HCHi  501 (545)
T PLN02168        495 WNVRSQK  501 (545)
T ss_pred             EeeeecC
Confidence            9999993


No 29 
>PLN02354 copper ion binding / oxidoreductase
Probab=98.89  E-value=3.9e-09  Score=75.27  Aligned_cols=71  Identities=14%  Similarity=0.019  Sum_probs=54.5

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      .++++.|+.|+|.+.|..+ .+|.||+||..+......+|              .+...+..|++++-...+|+ ++||.
T Consensus       419 v~~~~~~~~VeiVi~n~~~-~~HP~HLHGh~F~Vlg~G~G~~~~~~~~~~nl~nP~rRDTv~vp~~Gw~vIRF~aDNPGv  497 (552)
T PLN02354        419 VLNITFRTFVEIIFENHEK-SMQSWHLDGYSFFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKSWAAILLTFDNAGM  497 (552)
T ss_pred             eEEcCCCCEEEEEEeCCCC-CCCCCcCCCccEEEEeecCCCCCccccccCCcCCCCccceEEeCCCCeEEEEEEecCCeE
Confidence            4677889999999999876 79999999988653322222              11112455788999999999 99999


Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      |++|||.
T Consensus       498 W~~HCHi  504 (552)
T PLN02354        498 WNIRSEN  504 (552)
T ss_pred             Eeeeccc
Confidence            9999994


No 30 
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=98.88  E-value=1e-08  Score=58.65  Aligned_cols=59  Identities=15%  Similarity=0.109  Sum_probs=39.8

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      +..|+++.|+.++|++.|... .++.+..-++..             ...+.||++.++.|. +.+|+|-|+|-
T Consensus        34 P~~i~v~~G~~v~l~~~N~~~-~~h~~~i~~~~~-------------~~~l~~g~~~~~~f~~~~~G~y~~~C~   93 (104)
T PF13473_consen   34 PSTITVKAGQPVTLTFTNNDS-RPHEFVIPDLGI-------------SKVLPPGETATVTFTPLKPGEYEFYCT   93 (104)
T ss_dssp             S-EEEEETTCEEEEEEEE-SS-S-EEEEEGGGTE-------------EEEE-TT-EEEEEEEE-S-EEEEEB-S
T ss_pred             cCEEEEcCCCeEEEEEEECCC-CcEEEEECCCce-------------EEEECCCCEEEEEEcCCCCEEEEEEcC
Confidence            568999999999999999977 565544433211             134899999999999 99999999994


No 31 
>PRK10965 multicopper oxidase; Provisional
Probab=98.83  E-value=9.8e-09  Score=72.86  Aligned_cols=70  Identities=14%  Similarity=0.088  Sum_probs=50.3

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCc-------ccccccCCCCEEEEEEc-----CCCeeeEE
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPF-------VTQCPITQGNTFRYQFT-----ANAGTHFW   71 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~-------~~~~~i~pG~~~~y~~~-----~~~Gt~~Y   71 (75)
                      .++++.|++.+++|.|......|.+|+||..+.... .||.+.       ..+..|+| ++.++.++     +..|.|.|
T Consensus       427 ~~~~~~G~~e~w~i~N~~~~~~Hp~HlHg~~F~Vl~-~~g~~~~~~~~~wkDTv~v~~-~~~~i~~~f~~~~~~~g~~~~  504 (523)
T PRK10965        427 MFAAKKGQYERWVISGVGDMMLHPFHIHGTQFRILS-ENGKPPAAHRAGWKDTVRVEG-GRSEVLVKFDHDAPKEHAYMA  504 (523)
T ss_pred             ceecCCCCEEEEEEEeCCCCCccCeEEeCcEEEEEE-ecCCCCCccccccccEEEECC-cEEEEEEEecCCCCCCCCEEE
Confidence            368999999999999997435899999999876542 455431       12344666 55555554     35679999


Q ss_pred             ccCC
Q psy88            72 HAHT   75 (75)
Q Consensus        72 H~H~   75 (75)
                      |||.
T Consensus       505 HCHi  508 (523)
T PRK10965        505 HCHL  508 (523)
T ss_pred             EeCc
Confidence            9994


No 32 
>PLN02991 oxidoreductase
Probab=98.82  E-value=1.2e-08  Score=72.73  Aligned_cols=71  Identities=13%  Similarity=-0.033  Sum_probs=54.2

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      .+.++.|+.|+|.|.|... .+|.||+||..+......+|              .+...+..|++++....+|. ++||.
T Consensus       411 v~~~~~~~~VeiViqn~~~-~~HP~HLHGh~F~Vvg~G~G~f~~~~~~~~Nl~nP~rRDTv~vp~~Gw~vIRF~aDNPG~  489 (543)
T PLN02991        411 VMQTDYKAFVEIVFENWED-IVQTWHLDGYSFYVVGMELGKWSAASRKVYNLNDAVSRCTVQVYPRSWTAIYVSLDNVGM  489 (543)
T ss_pred             EEEcCCCCEEEEEEeCCCC-CCCCeeeCCcceEEEEeCCCCCCcccccccCCCCCCcccEEEECCCCEEEEEEECCCCEE
Confidence            3577889999999999877 79999999987653321111              11122455788999999999 99999


Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      |++|||.
T Consensus       490 W~~HCHi  496 (543)
T PLN02991        490 WNLRSEL  496 (543)
T ss_pred             eeeeeCc
Confidence            9999994


No 33 
>PLN02792 oxidoreductase
Probab=98.80  E-value=1.8e-08  Score=71.80  Aligned_cols=71  Identities=8%  Similarity=0.012  Sum_probs=54.3

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      .++++.|+.|+|.|.|... ..|++|+||..+......+|              .+...+..|+|++-...+|. ++||.
T Consensus       404 v~~~~~~~~VeiViqn~~~-~~HP~HLHGh~F~Vvg~G~G~~~~~~~~~~Nl~nP~~RdTv~v~~~gw~aIRf~aDNPGv  482 (536)
T PLN02792        404 VMGAHHNAFLEIIFQNREK-IVQSYHLDGYNFWVVGINKGIWSRASRREYNLKDAISRSTTQVYPESWTAVYVALDNVGM  482 (536)
T ss_pred             EEEcCCCCEEEEEEECCCC-CCCCeeeCCCceEEEeecCCCCCcccccccCcCCCCccceEEECCCCEEEEEEEeeCCEE
Confidence            4678899999999999866 68999999987653321122              11122455788999999999 99999


Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      |++|||.
T Consensus       483 W~~HCh~  489 (536)
T PLN02792        483 WNLRSQF  489 (536)
T ss_pred             EeeeEcc
Confidence            9999993


No 34 
>PLN02191 L-ascorbate oxidase
Probab=98.79  E-value=2.5e-08  Score=71.50  Aligned_cols=72  Identities=22%  Similarity=0.201  Sum_probs=53.1

Q ss_pred             cEEEecCCEEEEEEEeCC-----CCCCceEEeCCccccCCCCCCC---------------CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEGDRVVVDVRNSM-----DGLENTIHWHGIHQRGTQYSDG---------------VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~-----~~~~~~iH~HG~~~~~~~~~DG---------------~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .++++.|+.|+|.|.|..     ...+|.||+||..+......+|               .+...+..++|++....+|+
T Consensus       440 v~~~~~~~~Vdivi~n~~~~~~~~~~~HP~HLHGh~F~Vlg~G~g~~~~~~~~~~~nl~nP~rRDTv~vp~~Gw~vIRf~  519 (574)
T PLN02191        440 IYVFPFNVTVDVIIQNANVLKGVVSEIHPWHLHGHDFWVLGYGDGKFKPGIDEKTYNLKNPPLRNTAILYPYGWTAIRFV  519 (574)
T ss_pred             eEEecCCCEEEEEEECCCcccCCCCCCCCEEeCCCCeEEEEecCCCCCcccCcccccCCCCCcCCeEEeCCCCEEEEEEE
Confidence            356777999999999975     1268999999987653211122               11223455789999999999


Q ss_pred             -CCCeeeEEccCC
Q psy88            64 -ANAGTHFWHAHT   75 (75)
Q Consensus        64 -~~~Gt~~YH~H~   75 (75)
                       ++||.|.+|||.
T Consensus       520 aDNPG~Wl~HCHi  532 (574)
T PLN02191        520 TDNPGVWFFHCHI  532 (574)
T ss_pred             CCCCEEEEEecCc
Confidence             999999999994


No 35 
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
Probab=98.78  E-value=2.3e-08  Score=71.11  Aligned_cols=72  Identities=18%  Similarity=0.206  Sum_probs=50.9

Q ss_pred             cEEEecCCEEEEEEEeCC-------CCCCceEEeCCccccCCCCCCCC--------------C-ccccccc---------
Q psy88             4 PKNVCEGDRVVVDVRNSM-------DGLENTIHWHGIHQRGTQYSDGV--------------P-FVTQCPI---------   52 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~-------~~~~~~iH~HG~~~~~~~~~DG~--------------~-~~~~~~i---------   52 (75)
                      +++++.|+.|+|.|.|..       ...+|+||+||..+......+|.              | ...+..+         
T Consensus       413 ~~~~~~~~~V~ivi~n~~~~~~~~~~~~~HP~HlHGh~F~vlg~G~G~~~~~~~~~~~nl~nP~rRDTv~vp~~~~~~~~  492 (538)
T TIGR03390       413 AFPAKVGEVLEIVWQNTGSYTGPNGGVDTHPFHAHGRHFYDIGGGDGEYNATANEAKLENYTPVLRDTTMLYRYAVKVVP  492 (538)
T ss_pred             EEEcCCCCEEEEEEECCcccccCCCCCCCCCeeecCCcEEEEcccccccCCccChhhhccCCCCeecceeeccccccccc
Confidence            467899999999999974       12689999999775533222331              1 1112223         


Q ss_pred             -CCCCEEEEEEc-CCCeeeEEccCC
Q psy88            53 -TQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus        53 -~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                       .|+.....+|. ++||.|.+|||.
T Consensus       493 ~~~~~~~~ir~~~dNPG~W~~HCHi  517 (538)
T TIGR03390       493 GAPAGWRAWRIRVTNPGVWMMHCHI  517 (538)
T ss_pred             cCCCceEEEEEEcCCCeeEEEeccc
Confidence             36778888899 999999999994


No 36 
>TIGR02656 cyanin_plasto plastocyanin. Members of this family are plastocyanin, a blue copper protein related to pseudoazurin, halocyanin, amicyanin, etc. This protein, located in the thylakoid luman, performs electron transport to photosystem I in Cyanobacteria and chloroplasts.
Probab=98.73  E-value=1.4e-07  Score=53.73  Aligned_cols=67  Identities=12%  Similarity=0.115  Sum_probs=42.9

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcc--cccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFV--TQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~--~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..|++++||+|+  ++|... .+|++.+.....+... .+..+..  +...+.||+++++.|.. +|+|.|+|
T Consensus        16 P~~i~v~~G~~V~--~~N~~~-~~H~~~~~~~~~~~~~-~~~~~~~~~~~~~~~pG~t~~~tF~~-~G~y~y~C   84 (99)
T TIGR02656        16 PAKISIAAGDTVE--WVNNKG-GPHNVVFDEDAVPAGV-KELAKSLSHKDLLNSPGESYEVTFST-PGTYTFYC   84 (99)
T ss_pred             CCEEEECCCCEEE--EEECCC-CCceEEECCCCCccch-hhhcccccccccccCCCCEEEEEeCC-CEEEEEEc
Confidence            4679999999865  558765 6888776543222110 0000001  12246899999887775 89999999


No 37 
>PLN00044 multi-copper oxidase-related protein; Provisional
Probab=98.67  E-value=5.4e-08  Score=70.08  Aligned_cols=70  Identities=13%  Similarity=-0.045  Sum_probs=53.6

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCC--------------CCcccccccCCCCEEEEEEc-CCCee
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDG--------------VPFVTQCPITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG--------------~~~~~~~~i~pG~~~~y~~~-~~~Gt   68 (75)
                      .++++.++.|+|.|.|... .+|+||+||..+.......|              .+...+..+++|+-...+|. ++||.
T Consensus       434 v~~~~~n~~VeiV~qn~~~-~~HP~HLHGh~F~Vvg~G~G~~~~~~~~~~Nl~nPp~RdTv~vp~~gW~aIRF~aDNPG~  512 (596)
T PLN00044        434 IINGTYKGFMEIIFQNNAT-NVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVARSTIQVFPGAWTAILVFLDNAGI  512 (596)
T ss_pred             EEEcCCCCEEEEEEeCCCC-CCCCeeEcCccEEEEeecCCCCCCCcccccccCCCCccceEEeCCCCeEEEEEecCCCEE
Confidence            3577889999999999865 69999999987653221121              11223455789999999999 99999


Q ss_pred             eEEccC
Q psy88            69 HFWHAH   74 (75)
Q Consensus        69 ~~YH~H   74 (75)
                      |+.|||
T Consensus       513 W~lHCH  518 (596)
T PLN00044        513 WNLRVE  518 (596)
T ss_pred             ehhhcc
Confidence            999999


No 38 
>PRK02888 nitrous-oxide reductase; Validated
Probab=98.64  E-value=1.3e-07  Score=68.25  Aligned_cols=62  Identities=27%  Similarity=0.290  Sum_probs=47.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      +..|++++||+|++.++|....+..+   ||+..+.    .|...    -+.||++.+..|+ ++||.|||+|.
T Consensus       554 p~~i~Vk~GDeVt~~lTN~d~~~DVi---HGF~Ip~----~nI~~----dv~PG~t~svtF~adkPGvy~~~Ct  616 (635)
T PRK02888        554 LREFTVKQGDEVTVIVTNLDKVEDLT---HGFAIPN----YGVNM----EVAPQATASVTFTADKPGVYWYYCT  616 (635)
T ss_pred             CceEEecCCCEEEEEEEeCCcccccc---cceeecc----cCccE----EEcCCceEEEEEEcCCCEEEEEECC
Confidence            56799999999999999963312233   7776643    22222    3789999999999 99999999995


No 39 
>TIGR02657 amicyanin amicyanin. Members of this family are amicyanin, a type I blue copper protein that accepts electrons from the tryptophan tryptophylquinone (TTQ) cofactor of the methylamine dehydrogenase light chain and then transfers them to the heme group of cytochrome c-551i. Amicyanin, methylamine dehydrogenase, and cytochrome c-551i are periplasmic and form a complex. This system has been studied primarily in Paracoccus denitrificans and Methylobacterium extorquens. Related type I blue copper proteins include plastocyanin, pseudoazurin, halocyanin, etc.
Probab=98.59  E-value=5.9e-07  Score=49.58  Aligned_cols=62  Identities=18%  Similarity=0.208  Sum_probs=40.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEcCCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~H   74 (75)
                      +..|+++.||+|+  +.|... .+|++++..-....   .+    .....+.||+++++.| +.+|+|-|+|=
T Consensus        10 P~~i~v~~GdtVt--~~N~d~-~~Hnv~~~~g~~~~---~~----~~~~~~~~g~~~~~tf-~~~G~y~y~C~   71 (83)
T TIGR02657        10 TPELHVKVGDTVT--WINREA-MPHNVHFVAGVLGE---AA----LKGPMMKKEQAYSLTF-TEAGTYDYHCT   71 (83)
T ss_pred             CCEEEECCCCEEE--EEECCC-CCccEEecCCCCcc---cc----ccccccCCCCEEEEEC-CCCEEEEEEcC
Confidence            5679999999975  578866 68888765421110   11    0111256777777655 56899999993


No 40 
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing. This family consists of copper-type nitrite reductase. It reduces nitrite to nitric oxide, the first step in denitrification.
Probab=98.54  E-value=1.9e-07  Score=62.66  Aligned_cols=71  Identities=18%  Similarity=0.133  Sum_probs=56.6

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCc------ccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPF------VTQCPITQGNTFRYQFT-ANAGTHFWHAHT   75 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~------~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~   75 (75)
                      .+.++.|+.+++++.|........+|.+|...... ..||.+.      .....|.||+++...++ +++|.|+.+||.
T Consensus       203 ~~~v~~G~~~RlRiiNa~~~~~~~~~~~g~~~~~v-~~DG~~~~~~~~~~~~~~i~PG~R~dv~v~~~~pG~y~~~~~~  280 (311)
T TIGR02376       203 DNALTAGVGERVLFVHSQPNRDSRPHLIGGHGDYV-WVTGKFANPPNRDVETWFIPGGSAAAALYTFEQPGVYAYVDHN  280 (311)
T ss_pred             CcccccCCcEEEEEEcCCCCCCCCCeEecCCceEE-EECCcccCCCCCCcceEEECCCceEEEEEEeCCCeEEEEECcH
Confidence            46799999999999998764668899999776533 3577532      23456899999999999 889999999983


No 41 
>PRK02710 plastocyanin; Provisional
Probab=98.43  E-value=2.7e-06  Score=49.91  Aligned_cols=59  Identities=17%  Similarity=0.220  Sum_probs=41.4

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..|+++.||+|+  +.|... .+|++.+.|..        +.. .+...+.||+++++.|.. +|+|-|+|
T Consensus        46 P~~i~v~~Gd~V~--~~N~~~-~~H~v~~~~~~--------~~~-~~~~~~~pg~t~~~tF~~-~G~y~y~C  104 (119)
T PRK02710         46 PSTLTIKAGDTVK--WVNNKL-APHNAVFDGAK--------ELS-HKDLAFAPGESWEETFSE-AGTYTYYC  104 (119)
T ss_pred             CCEEEEcCCCEEE--EEECCC-CCceEEecCCc--------ccc-ccccccCCCCEEEEEecC-CEEEEEEc
Confidence            4679999999855  568766 68887765421        100 011237899999988886 89999999


No 42 
>PF00394 Cu-oxidase:  Multicopper oxidase;  InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties. Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include:   Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase.  Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ].   In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08. This entry represents multicopper oxidase type 1 (blue) domains. These domains are also present in proteins that have lost the ability to bind copper.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1RZP_A 2AVF_D 1NIA_A 1KCB_A 2NRD_A 1NIB_A 2BW4_A 1RZQ_C 2BWD_A 2BWI_A ....
Probab=98.39  E-value=8.4e-07  Score=54.10  Aligned_cols=71  Identities=18%  Similarity=0.191  Sum_probs=55.7

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcc----cccccCCCCEEEEEEc-CC-CeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFV----TQCPITQGNTFRYQFT-AN-AGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~----~~~~i~pG~~~~y~~~-~~-~Gt~~YH~   73 (75)
                      ..+|.+++|++++++|.|........++..|..+... ..||.+..    ....|.||++++..++ ++ +|.||..+
T Consensus        59 ~~~~~v~~g~~~rlRliNa~~~~~~~~~i~gh~~~Vi-a~DG~~v~p~~~~~l~l~~G~R~dvlv~~~~~~g~y~i~~  135 (159)
T PF00394_consen   59 PPVIKVKPGERYRLRLINAGASTSFNFSIDGHPMTVI-AADGVPVEPYKVDTLVLAPGQRYDVLVTADQPPGNYWIRA  135 (159)
T ss_dssp             SGEEEEETTTEEEEEEEEESSS-BEEEEETTBCEEEE-EETTEEEEEEEESBEEE-TTEEEEEEEEECSCSSEEEEEE
T ss_pred             cceEEEcCCcEEEEEEEeccCCeeEEEEeeccceeEe-eeccccccccccceEEeeCCeEEEEEEEeCCCCCeEEEEE
Confidence            4689999999999999999875567889999866543 47886532    3455899999999999 65 99999876


No 43 
>PRK10883 FtsI repressor; Provisional
Probab=98.35  E-value=1.1e-06  Score=61.77  Aligned_cols=66  Identities=11%  Similarity=0.102  Sum_probs=46.6

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCc-------ccccccCCCCEEEEEEc-CCCe----eeEE
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPF-------VTQCPITQGNTFRYQFT-ANAG----THFW   71 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~-------~~~~~i~pG~~~~y~~~-~~~G----t~~Y   71 (75)
                      .++++.|++.++++.|.   .+|.||.||..+.... .||.+.       -.+..| + ++.+..++ +..+    .|+|
T Consensus       376 ~~~~~~g~~e~W~~~n~---~~HP~HlHg~~FqVl~-~~G~~~~~~~~gwkDTV~v-~-~~v~i~~~f~~~~~~~~~~m~  449 (471)
T PRK10883        376 DVTAQQGTWERWTVRAD---MPQAFHIEGVMFLIRN-VNGAMPFPEDRGWKDTVWV-D-GQVELLVYFGQPSWAHFPFLF  449 (471)
T ss_pred             eeecCCCCEEEEEEECC---CCcCEeECCccEEEEE-ecCCCCCccccCcCcEEEc-C-CeEEEEEEecCCCCCCCcEEe
Confidence            35799999999999996   4799999999877542 455421       123334 3 45777777 5444    7999


Q ss_pred             ccCC
Q psy88            72 HAHT   75 (75)
Q Consensus        72 H~H~   75 (75)
                      |||.
T Consensus       450 HCHi  453 (471)
T PRK10883        450 YSQT  453 (471)
T ss_pred             eccc
Confidence            9994


No 44 
>PF00127 Copper-bind:  Copper binding proteins, plastocyanin/azurin family;  InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. This pollen protein is evolutionary related to the above proteins, but seems to have lost the ability to bind copper. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1UAT_A 1CUO_A 1PLC_A 4PCY_A 3PCY_A 1PND_A 1PNC_A 1JXG_A 6PCY_A 1TKW_A ....
Probab=98.30  E-value=1.8e-06  Score=48.98  Aligned_cols=68  Identities=21%  Similarity=0.179  Sum_probs=40.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCC-CCCcccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSD-GVPFVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~D-G~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..|++++||+|+  +.|... .+|++.+=--..+.....+ ..+......+.||+++++.|. .+|+|.|+|
T Consensus        16 P~~i~V~~G~tV~--~~n~~~-~~Hnv~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~tF~-~~G~y~y~C   84 (99)
T PF00127_consen   16 PSEITVKAGDTVT--FVNNDS-MPHNVVFVADGMPAGADSDYVPPGDSSPLLAPGETYSVTFT-KPGTYEYYC   84 (99)
T ss_dssp             SSEEEEETTEEEE--EEEESS-SSBEEEEETTSSHTTGGHCHHSTTCEEEEBSTTEEEEEEEE-SSEEEEEEE
T ss_pred             CCEEEECCCCEEE--EEECCC-CCceEEEecccccccccccccCccccceecCCCCEEEEEeC-CCeEEEEEc
Confidence            4679999999865  555444 6777765221000000000 000001234779999888887 889999999


No 45 
>KOG1263|consensus
Probab=98.14  E-value=6.4e-06  Score=59.25  Aligned_cols=72  Identities=17%  Similarity=0.186  Sum_probs=52.9

Q ss_pred             cEEEecCCEEEEEEEeCCCC--CCceEEeCCccccCCC-----CCC---C--------CCcccccccCCCCEEEEEEc-C
Q psy88             4 PKNVCEGDRVVVDVRNSMDG--LENTIHWHGIHQRGTQ-----YSD---G--------VPFVTQCPITQGNTFRYQFT-A   64 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~--~~~~iH~HG~~~~~~~-----~~D---G--------~~~~~~~~i~pG~~~~y~~~-~   64 (75)
                      .++++-++.|+|.+.|....  ..+++|+||..+....     |..   -        .+...+.-|+||.-...+|. +
T Consensus       431 v~~~~~~~~veIVlqN~~~~~~~~hp~HLHG~~F~Vvg~g~G~~~~~~d~~~~yNl~dp~~R~Tv~V~pggw~aIrf~ad  510 (563)
T KOG1263|consen  431 VMKLEFNSFVEIVLQNTSTGTQENHPNHLHGYNFYVVGYGFGNWDPAKDPRKKYNLVDPVSRDTVQVPPGGWTAIRFVAD  510 (563)
T ss_pred             EEEeecCCEEEEEEeCCccccCCCCccceeceEEEEEEecccccCcCcChhhhcccCCCcccceEEeCCCCEEEEEEEcC
Confidence            36888999999999998652  3577799998754221     111   1        01112455899999999999 9


Q ss_pred             CCeeeEEccCC
Q psy88            65 NAGTHFWHAHT   75 (75)
Q Consensus        65 ~~Gt~~YH~H~   75 (75)
                      +||.|.+|||.
T Consensus       511 NPG~W~~HCHi  521 (563)
T KOG1263|consen  511 NPGVWLMHCHI  521 (563)
T ss_pred             CCcEEEEEEec
Confidence            99999999994


No 46 
>TIGR03102 halo_cynanin halocyanin domain. Halocyanins are blue (type I) copper redox proteins found in halophilic archaea such as Natronobacterium pharaonis. This model represents a domain duplicated in some halocyanins, while appearing once in others. This domain includes the characteristic copper ligand residues. This family does not include plastocyanins, and does not include certain divergent paralogs of halocyanin.
Probab=97.98  E-value=0.0001  Score=43.28  Aligned_cols=60  Identities=18%  Similarity=0.212  Sum_probs=37.9

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..|+++.||+|+  ++|+.+..+|++..-+    ... .|    .......+|+++++.| +.+|+|-|+|
T Consensus        41 P~~ltV~~GdTVt--w~~~~d~~~HnV~s~~----~~~-f~----s~~~~~~~G~t~s~Tf-~~~G~Y~Y~C  100 (115)
T TIGR03102        41 PPAIRVDPGTTVV--WEWTGEGGGHNVVSDG----DGD-LD----ESERVSEEGTTYEHTF-EEPGIYLYVC  100 (115)
T ss_pred             CCEEEECCCCEEE--EEECCCCCCEEEEECC----CCC-cc----ccccccCCCCEEEEEe-cCCcEEEEEc
Confidence            4678999999977  5554332566665311    000 11    0111257899998888 5689999999


No 47 
>TIGR02375 pseudoazurin pseudoazurin. Pseudoazurin, also called cupredoxin, is a small, blue periplasmic protein with a single bound copper atom. Pseudoazurin is related plastocyanins. Several examples of pseudoazurin are encoded by a neighboring gene for, or have been shown to transfer electrons to, copper-containing nitrite reductases (TIGR02376) of the same species.
Probab=97.79  E-value=0.0001  Score=43.37  Aligned_cols=58  Identities=10%  Similarity=0.116  Sum_probs=33.7

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe-CCccccCCCCCCCCCcccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW-HGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~-HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..|+++.||+|++...|.    +++..+ -+.      ..+|....   ...+|+++++.| +.+|+|-|.|
T Consensus        14 P~~v~V~~GdTV~f~n~d~----~Hnv~~~~~~------~p~g~~~~---~s~~g~~~~~tF-~~~G~Y~Y~C   72 (116)
T TIGR02375        14 PAYIRAAPGDTVTFVPTDK----GHNVETIKGM------IPEGAEAF---KSKINEEYTVTV-TEEGVYGVKC   72 (116)
T ss_pred             CCEEEECCCCEEEEEECCC----CeeEEEccCC------CcCCcccc---cCCCCCEEEEEe-CCCEEEEEEc
Confidence            5679999999977765543    455443 111      11332211   123455544444 6789999999


No 48 
>COG3794 PetE Plastocyanin [Energy production and conversion]
Probab=97.63  E-value=0.00051  Score=41.10  Aligned_cols=60  Identities=17%  Similarity=0.131  Sum_probs=36.7

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +-.|+++.||+|+  +.|... ..|+++.=+..     ..+|...   ....+|+++++.| +.+|.|-|.|
T Consensus        53 PA~v~v~pGDTVt--w~~~d~-~~Hnv~~~~~~-----~~~g~~~---~~~~~~~s~~~Tf-e~~G~Y~Y~C  112 (128)
T COG3794          53 PAEVTVKPGDTVT--WVNTDS-VGHNVTAVGGM-----DPEGSGT---LKAGINESFTHTF-ETPGEYTYYC  112 (128)
T ss_pred             CcEEEECCCCEEE--EEECCC-CCceEEEeCCC-----Ccccccc---cccCCCcceEEEe-cccceEEEEe
Confidence            4578999999965  567765 57777653332     1122221   1233445555555 4589999999


No 49 
>PF00116 COX2:  Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o.;  InterPro: IPR002429 Cytochrome c oxidase (1.9.3.1 from EC) [, ] is an oligomeric enzymatic complex which is a component of the respiratory chain and is involved in the transfer of electrons from cytochrome c to oxygen. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. The number of polypeptides in the complex ranges from 3-4 (prokaryotes), up to 13(mammals). Subunit 2 (CO II) transfers the electrons from cytochrome c to the catalytic subunit 1. It contains two adjacent transmembrane regions in its N terminus and the major part of the protein is exposed to the periplasmic or to the mitochondrial intermembrane space, respectively. CO II provides the substrate-binding site and contains a copper centre called Cu(A), probably the primary acceptor in cytochrome c oxidase. An exception is the corresponding subunit of the cbb3-type oxidase which lacks the copper A redox-centre. Several bacterial CO II have a C-terminal extension that contains a covalently bound haem c.; GO: 0004129 cytochrome-c oxidase activity, 0005507 copper ion binding, 0016020 membrane; PDB: 3OMN_D 3OMA_B 3OMI_D 3OM3_B 3EHB_B 1AR1_B 1QLE_B 3HB3_B 2IWK_B 2IWF_A ....
Probab=97.38  E-value=0.0016  Score=38.34  Aligned_cols=58  Identities=17%  Similarity=0.173  Sum_probs=42.6

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      ...|++..|+.|++.+++..  .-     ||+..+..    |.    ...+.||+.....|. +.+|+|...|-
T Consensus        45 ~~~l~lp~g~~v~~~ltS~D--Vi-----Hsf~ip~~----~~----k~d~~PG~~~~~~~~~~~~G~y~~~C~  103 (120)
T PF00116_consen   45 DNELVLPAGQPVRFHLTSED--VI-----HSFWIPEL----GI----KMDAIPGRTNSVTFTPDKPGTYYGQCA  103 (120)
T ss_dssp             SSEEEEETTSEEEEEEEESS--S------EEEEETTC----TE----EEEEBTTCEEEEEEEESSSEEEEEEE-
T ss_pred             cceecccccceEeEEEEcCC--cc-----cccccccc----Cc----ccccccccceeeeeeeccCCcEEEcCc
Confidence            35789999999999999964  23     45544321    11    123679999999999 99999999984


No 50 
>TIGR03094 sulfo_cyanin sulfocyanin. Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus. The most closely related proteins characterized as functionally different are the rustacyanins.
Probab=97.16  E-value=0.0055  Score=38.78  Aligned_cols=69  Identities=16%  Similarity=0.113  Sum_probs=48.3

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccC------CCCCCCCCcc----c-----ccccCCCCEEEEEEc-CC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRG------TQYSDGVPFV----T-----QCPITQGNTFRYQFT-AN   65 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~------~~~~DG~~~~----~-----~~~i~pG~~~~y~~~-~~   65 (75)
                      .++|.+-.|=+|.|+|.|... .+|++-.  +....      ....||....    +     ..-+.+|++..-.|. -+
T Consensus        84 ~mtIyiPaGw~V~V~f~N~e~-~pHnl~i--v~n~t~~P~~~~~s~dgkil~~vG~~~s~~~~NGi~~Gqs~sg~~~~~~  160 (195)
T TIGR03094        84 AMTIYLPAGWNVYVTFTNYES-LPHNLKL--LPNSTQTPRGPIWAHTGKIINSTGATTSIYYGNGISSGHSRSGWWNDTS  160 (195)
T ss_pred             ceEEEEeCCCEEEEEEEcCCC-CCccEEE--ecCCCCCCCccccccCceeEeecccccCccccccccccceeEEEeccCC
Confidence            578999999999999999987 7877654  22111      1234553211    1     133568889777777 89


Q ss_pred             CeeeEEcc
Q psy88            66 AGTHFWHA   73 (75)
Q Consensus        66 ~Gt~~YH~   73 (75)
                      +|+|||=|
T Consensus       161 ~G~YwlvC  168 (195)
T TIGR03094       161 AGKYWLVC  168 (195)
T ss_pred             CeeEEEEc
Confidence            99999988


No 51 
>PF06525 SoxE:  Sulfocyanin (SoxE);  InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus. The most closely related proteins characterised as functionally different are the rusticyanins.
Probab=97.15  E-value=0.0059  Score=38.93  Aligned_cols=71  Identities=18%  Similarity=0.122  Sum_probs=47.9

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeC--Ccccc--CCCCCCCCCc----c-----cccccCCCCEEEEEEc-CCCe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWH--GIHQR--GTQYSDGVPF----V-----TQCPITQGNTFRYQFT-ANAG   67 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~H--G~~~~--~~~~~DG~~~----~-----~~~~i~pG~~~~y~~~-~~~G   67 (75)
                      .++|.+-.|-+|.|+|+|... .+|++=.=  +...+  .....||...    .     ....|.+|++..-.|. -++|
T Consensus        85 ~m~i~VPAGw~V~i~f~N~~~-l~Hnl~iv~~~~~~p~~~~i~~DgkIl~~~G~s~~~~~~~GI~~G~s~~~~~~~l~aG  163 (196)
T PF06525_consen   85 QMTIYVPAGWNVQITFTNQES-LPHNLVIVQNDTPTPNNPPISSDGKILLYVGASPGNYTSNGISSGQSASGVYNDLPAG  163 (196)
T ss_pred             cEEEEEcCCCEEEEEEEcCCC-CCeeEEEEeCCCCCCCccccCCCCceeeeccCCCCccccCCccCCceeeEEEccCCCc
Confidence            478999999999999999876 67654321  11111  1223565221    0     1234778999988887 8899


Q ss_pred             eeEEcc
Q psy88            68 THFWHA   73 (75)
Q Consensus        68 t~~YH~   73 (75)
                      .||+=|
T Consensus       164 ~YwlvC  169 (196)
T PF06525_consen  164 YYWLVC  169 (196)
T ss_pred             eEEEEc
Confidence            999988


No 52 
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion]
Probab=96.70  E-value=0.0034  Score=44.87  Aligned_cols=60  Identities=23%  Similarity=0.306  Sum_probs=39.0

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .++.+++||+|++.+.|-.. ..-.+  ||...+    +-|+..    .+.|-++-.|.|. +.+|.+||.|
T Consensus       558 ~ef~Vkq~DEVt~l~tnld~-Ved~t--hgfv~p----~~~v~~----~v~pq~tasvtf~a~kpgv~w~yc  618 (637)
T COG4263         558 TEFKVKQGDEVTVLTTNLDE-VEDLT--HGFVIP----NYGVNM----EVKPQRTASVTFYADKPGVAWYYC  618 (637)
T ss_pred             EEEEEecCcEEEEEecccce-ecccc--ceeeec----cCceEE----EEccCCceEEEEEccCCeeeehhh
Confidence            45667777777777777644 22222  454433    223222    2778888899999 9999999987


No 53 
>TIGR02695 azurin azurin. Azurin is a blue copper-binding protein in the plastocyanin/azurin family (see Pfam model pfam00127). It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The most closely related copper-binding proteins to this family are auracyanins, as in Chloroflexus aurantiacus, which have similar redox activities.
Probab=96.69  E-value=0.015  Score=34.63  Aligned_cols=70  Identities=14%  Similarity=0.151  Sum_probs=41.8

Q ss_pred             cEEEec-CCEEEEEEEeCCCCCCceEEeCCccccC--------------------CCCCCCCCcccccccCCCCEEEEEE
Q psy88             4 PKNVCE-GDRVVVDVRNSMDGLENTIHWHGIHQRG--------------------TQYSDGVPFVTQCPITQGNTFRYQF   62 (75)
Q Consensus         4 ~i~~~~-Gd~v~i~~~N~~~~~~~~iH~HG~~~~~--------------------~~~~DG~~~~~~~~i~pG~~~~y~~   62 (75)
                      .|.|+. +.+|+|+|+|... .|...--|-+....                    .+..|-.-...+..|.|||+.+..|
T Consensus        17 ~i~V~a~~k~vtv~l~h~G~-lpk~~MgHN~Vl~k~~d~~~v~~~g~~ag~~~~Yvp~~d~~ViAhTkliggGes~svtF   95 (125)
T TIGR02695        17 SISVPKSCKEFTVNLKHTGK-LPKAVMGHNWVLAKSADMQAVATDGMSAGADNNYVKPGDARVIAHTKVIGGGEKTSVTF   95 (125)
T ss_pred             EEEEcCCCcEEEEEEecCCc-CchhccCccEEEeccccHHHHHHHHHhcccccCccCCCCcceEEEccccCCCceEEEEE
Confidence            678887 5899999999854 44322223211110                    0101100011244588999999999


Q ss_pred             c-C--CCee-eEEccC
Q psy88            63 T-A--NAGT-HFWHAH   74 (75)
Q Consensus        63 ~-~--~~Gt-~~YH~H   74 (75)
                      . .  .+|. |-|-|-
T Consensus        96 ~~~~l~~g~~Y~f~CS  111 (125)
T TIGR02695        96 DVSKLSAGEDYTFFCS  111 (125)
T ss_pred             ECCCCCCCCcceEEEc
Confidence            8 4  6885 999883


No 54 
>TIGR02866 CoxB cytochrome c oxidase, subunit II. Cytochrome c oxidase is the terminal electron acceptor of mitochondria (and one of several possible acceptors in prokaryotes) in the electron transport chain of aerobic respiration. The enzyme couples the oxidation of reduced cytochrome c with the reduction of molecular oxygen to water. This process results in the pumping of four protons across the membrane which are used in the proton gradient powered synthesis of ATP. The oxidase contains two heme a cofactors and three copper atoms as well as other bound ions.
Probab=95.42  E-value=0.12  Score=32.65  Aligned_cols=57  Identities=16%  Similarity=0.081  Sum_probs=42.3

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      ..|.+..|+.|++.+++..-  -     ||+..+..    |+    +..+.||..-+..|. +++|+|...|-
T Consensus       117 ~~l~vp~g~~v~~~~ts~DV--~-----Hsf~ip~~----~~----k~da~PG~~~~~~~~~~~~G~y~~~c~  174 (201)
T TIGR02866       117 NELVVPAGTPVRLQVTSKDV--I-----HSFWVPEL----GG----KIDAIPGQYNALWFNADEPGVYYGYCA  174 (201)
T ss_pred             CEEEEEcCCEEEEEEEeCch--h-----hccccccc----Cc----eEEecCCcEEEEEEEeCCCEEEEEEeh
Confidence            47899999999999998632  2     66655421    21    123668999999999 99999998873


No 55 
>PRK13202 ureB urease subunit beta; Reviewed
Probab=95.10  E-value=0.13  Score=29.70  Aligned_cols=60  Identities=17%  Similarity=0.135  Sum_probs=39.2

Q ss_pred             ccEEEecC--CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG--DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G--d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|++++|  ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 ~~I~ln~grr~~~~l~V~NtGD-RPIQVGSHyHF~E~N~aL~FDR~~A~G~RLdIpaGTavRFEPG~~k~V~LV   83 (104)
T PRK13202         11 GDIEMNAAALSRLQMRIINAGD-RPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIVGLV   83 (104)
T ss_pred             CCEEeCCCCCceEEEEEEeCCC-CceEEccccchhhcCcceeecHhHhcCcccccCCCCeEEECCCCeEEEEEE
Confidence            46899999  589999999999 77655  55533322111111     1    22223455889999999887


No 56 
>PRK13203 ureB urease subunit beta; Reviewed
Probab=94.33  E-value=0.28  Score=28.32  Aligned_cols=60  Identities=22%  Similarity=0.265  Sum_probs=39.1

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      ..|++++| ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 ~~I~ln~gr~~~~l~V~NtGD-RPIQVGSH~HF~E~N~aL~FDR~~A~G~RLdIpaGTavRFEPG~~k~V~LV   82 (102)
T PRK13203         11 GEIELNAGRETVTLTVANTGD-RPIQVGSHYHFFEVNPALSFDREAARGMRLNIPAGTAVRFEPGQTREVELV   82 (102)
T ss_pred             CCEEeCCCCCEEEEEEEeCCC-CceEEccccchhhcCcchhccHhhhcCcccccCCCCeEeECCCCeEEEEEE
Confidence            46788888 889999999999 78655  55543322111111     1    22223455889999999887


No 57 
>TIGR00192 urease_beta urease, beta subunit. In a number of species, including B.subtilis, Synechocystis, and Haemophilus influenzae, urease subunits beta and gamma are encoded as separate polypeptides. In Helicobacter pylori UreA and in the fission yeast Schizosaccharomyces pombe, beta subunit-like sequence follows gamma subunit-like sequence in a single chain; the fission yeast protein contains additional C-terminal regions.
Probab=94.30  E-value=0.28  Score=28.21  Aligned_cols=60  Identities=23%  Similarity=0.277  Sum_probs=38.9

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|+++.| ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 ~~I~ln~gr~~~~l~V~NtGD-RPIQVGSHyHF~E~N~aL~FDR~~A~G~RLdIpaGTavRFEPG~~k~V~LV   82 (101)
T TIGR00192        11 GDITINEGRKTVSVKVKNTGD-RPIQVGSHFHFFEVNRALDFDRELAFGMRLDIPSGTAVRFEPGEEKSVELV   82 (101)
T ss_pred             CCEEeCCCCcEEEEEEEeCCC-cceEEccccchhhcCcceeecHhhhcCcccccCCCCeEeECCCCeEEEEEE
Confidence            35788888 889999999999 77655  55543322111111     1    22223455899999999887


No 58 
>PF12690 BsuPI:  Intracellular proteinase inhibitor;  InterPro: IPR020481 BsuPI is a intracellular proteinase inhibitor that directly regulates the major intracellular proteinase (ISP-1) activity in vivo. It inhibits ISP-1 in the early stages of sporulation and then may be inactivated by a membrane-bound proteinase [].; PDB: 3ISY_A.
Probab=93.89  E-value=0.34  Score=26.65  Aligned_cols=32  Identities=25%  Similarity=0.480  Sum_probs=17.7

Q ss_pred             CCCCCCc---ccccccCCCCEEEEEEc---CC--CeeeEE
Q psy88            40 YSDGVPF---VTQCPITQGNTFRYQFT---AN--AGTHFW   71 (75)
Q Consensus        40 ~~DG~~~---~~~~~i~pG~~~~y~~~---~~--~Gt~~Y   71 (75)
                      |++|...   +....|+||++.+|++.   ..  +|+|..
T Consensus        41 wS~~~~FtQal~~~~l~pGe~~~~~~~~~~~~~~~G~Y~~   80 (82)
T PF12690_consen   41 WSDGKMFTQALQEETLEPGESLTYEETWDLKDLSPGEYTL   80 (82)
T ss_dssp             TTTT-------EEEEE-TT-EEEEEEEESS----SEEEEE
T ss_pred             ecCCchhhheeeEEEECCCCEEEEEEEECCCCCCCceEEE
Confidence            4555332   23456899999999988   33  788753


No 59 
>cd00407 Urease_beta Urease beta-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide. Nickel-dependent ureases are found in bacteria, archaea, fungi and plants. Their primary role is to allow the use of external and internally-generated urea as a nitrogen source. The enzyme consists of three subunits, alpha, beta and gamma, which can exist as separate proteins or can be fused on a single protein chain. The alpha-beta-gamma heterotrimer forms multimers, mainly trimers. The large alpha subunit is the catalytic domain containing an active site with a bi-nickel center complexed by a carbamylated lysine. The beta and gamma subunits play a role in subunit association to form the higher order trimers.
Probab=93.88  E-value=0.42  Score=27.52  Aligned_cols=60  Identities=20%  Similarity=0.268  Sum_probs=38.6

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|++++| ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 ~~I~lN~gr~~~~l~V~NtGD-RpIQVGSH~HF~E~N~aL~FDR~~A~G~RLdIpaGTavRFEPG~~k~V~LV   82 (101)
T cd00407          11 GDIELNAGREAVTLKVKNTGD-RPIQVGSHYHFFEVNPALKFDREKAYGMRLDIPAGTAVRFEPGEEKEVELV   82 (101)
T ss_pred             CCeEeCCCCCEEEEEEEeCCC-cceEEccccchhhcCccccccHHHcccceecccCCCeEEECCCCeEEEEEE
Confidence            35778888 789999999998 77655  55543322111111     1    22223455889999999887


No 60 
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional
Probab=93.35  E-value=0.59  Score=32.65  Aligned_cols=60  Identities=13%  Similarity=0.040  Sum_probs=39.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCC-cccccccCCCCEEEEEEcCCCeeeEEcc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVP-FVTQCPITQGNTFRYQFTANAGTHFWHA   73 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~-~~~~~~i~pG~~~~y~~~~~~Gt~~YH~   73 (75)
                      +..+.+..|+ +++.++|... .++-+-.          .+|.- ...-..|.||.+.++.++-.+|+|-|+|
T Consensus        43 p~~~tVpAG~-~~f~V~N~~~-~~~Efe~----------~~~~~vv~e~EnIaPG~s~~l~~~L~pGtY~~~C  103 (375)
T PRK10378         43 PMTLTVNAGK-TQFIIQNHSQ-KALEWEI----------LKGVMVVEERENIAPGFSQKMTANLQPGEYDMTC  103 (375)
T ss_pred             cCceeeCCCC-EEEEEEeCCC-CcceEEe----------eccccccccccccCCCCceEEEEecCCceEEeec
Confidence            4567888996 8888899876 4433211          01110 0011358999998887665699999999


No 61 
>PRK13201 ureB urease subunit beta; Reviewed
Probab=93.02  E-value=0.6  Score=28.17  Aligned_cols=60  Identities=17%  Similarity=0.239  Sum_probs=38.8

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|+++.| ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 ~~I~lN~gr~~~~l~V~NtGD-RPIQVGSHyHF~EvN~aL~FDR~~A~G~RLdIPAGTAVRFEPG~~k~V~LV   82 (136)
T PRK13201         11 TEVEINNHHPETVIEVENTGD-RPIQVGSHFHFYEANAALDFEREMAYGKHLDIPAGAAVRFEPGDKKEVQLV   82 (136)
T ss_pred             CCeEeCCCCCEEEEEEEeCCC-cceEeccccchhhcCccccccHhhhcCcccccCCCCeEeECCCCeEEEEEE
Confidence            35788888 889999999998 77655  55533322111111     1    22223456889999999887


No 62 
>PRK13198 ureB urease subunit beta; Reviewed
Probab=93.00  E-value=0.54  Score=29.02  Aligned_cols=60  Identities=20%  Similarity=0.211  Sum_probs=39.0

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCC-----CCC----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQY-----SDG----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~-----~DG----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -+|.+++| ++++|.+.|..+ +|.-+  |+|=+.......     .-|    .|.-+...+.||++++.++.
T Consensus        39 g~I~lN~gr~~~~l~V~NtGD-RPIQVGSHyHF~EvN~aL~FDR~~A~G~RLdIPAGTAVRFEPG~~k~V~LV  110 (158)
T PRK13198         39 TPITFNENKPVTKVKVRNTGD-RPIQVGSHFHFFEVNRALEFDRAAAYGKRLNISSTTAIRFEPGDETEVPLI  110 (158)
T ss_pred             CCeEeCCCCcEEEEEEEeCCC-CceEeccccchhhcCccccccHhhhcCcccccCCCCeEeeCCCCeeEEEEE
Confidence            35888888 899999999998 77655  555333221111     111    22223455889999999887


No 63 
>PRK13205 ureB urease subunit beta; Reviewed
Probab=92.93  E-value=0.57  Score=28.93  Aligned_cols=60  Identities=18%  Similarity=0.211  Sum_probs=38.7

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|.+++| ++++|.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        11 g~IelN~GR~~i~L~V~NtGD-RPIQVGSHyHF~EvN~AL~FDR~~A~G~RLdIPAGTAVRFEPGe~ktV~LV   82 (162)
T PRK13205         11 ESLTGNVGREAKTIEIINTGD-RPVQIGSHFHFAEVNPSISFDRSEGYGFRLDIPSGTAVRLEPGDARTVNLV   82 (162)
T ss_pred             CCeEeCCCCcEEEEEEEeCCC-CceEeccccchhhcCccccccHHHhcCcccccCCCCeEeECCCCeEEEEEE
Confidence            35788888 889999999998 78665  55533222111111     1    22223455889999999887


No 64 
>PRK13204 ureB urease subunit beta; Reviewed
Probab=92.88  E-value=0.56  Score=28.98  Aligned_cols=60  Identities=25%  Similarity=0.329  Sum_probs=38.9

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|+++.| ++++|.+.|..+ +|.-+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus        34 ~~I~lN~gr~~~~l~V~NtGD-RPIQVGSHyHF~EvN~aL~FDR~~A~G~RLdIPAGTAVRFEPG~~k~V~LV  105 (159)
T PRK13204         34 DPIEINQGRPRTTLTVRNTGD-RPIQIGSHFHFFEVNRYLEFDRSKAFGLRLDIPANTAVRFEPGDEKEVTLV  105 (159)
T ss_pred             CCeEeCCCCcEEEEEEEeCCC-CceEeccccchhhcCccccccHhhhcCcccccCCCCeEeECCCCeeEEEEE
Confidence            35788888 889999999998 77655  55543322111111     1    22223455889999999887


No 65 
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion]
Probab=92.77  E-value=0.37  Score=34.87  Aligned_cols=60  Identities=7%  Similarity=-0.020  Sum_probs=46.6

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      ++.-+++++.+++.++|...   .+.-.||+..-    .|+..+.    +.|......+|. +++|++||.|
T Consensus       548 ~~staps~~l~ef~Vkq~DE---Vt~l~tnld~V----ed~thgf----v~p~~~v~~~v~pq~tasvtf~a  608 (637)
T COG4263         548 MTSTAPSFGLTEFKVKQGDE---VTVLTTNLDEV----EDLTHGF----VIPNYGVNMEVKPQRTASVTFYA  608 (637)
T ss_pred             EeeccCCCceEEEEEecCcE---EEEEeccccee----cccccee----eeccCceEEEEccCCceEEEEEc
Confidence            45567889999999999753   45666888643    4766654    778899999999 9999999987


No 66 
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion]
Probab=89.76  E-value=2.9  Score=27.59  Aligned_cols=57  Identities=16%  Similarity=0.035  Sum_probs=41.5

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      ..|.+..|..|++.++-..  .-     ||+..+..    |.    +..+-||......++ +++|+|.-.|.
T Consensus       137 n~l~lPv~~~V~f~ltS~D--Vi-----HsF~IP~l----~~----k~d~iPG~~~~~~~~~~~~G~Y~g~Ca  194 (247)
T COG1622         137 NELVLPVGRPVRFKLTSAD--VI-----HSFWIPQL----GG----KIDAIPGMTTELWLTANKPGTYRGICA  194 (247)
T ss_pred             ceEEEeCCCeEEEEEEech--hc-----eeEEecCC----Cc----eeeecCCceEEEEEecCCCeEEEEEcH
Confidence            5789999999999988763  22     55554421    11    223678988888888 99999998884


No 67 
>PRK13192 bifunctional urease subunit gamma/beta; Reviewed
Probab=89.37  E-value=2.1  Score=27.69  Aligned_cols=60  Identities=22%  Similarity=0.231  Sum_probs=38.5

Q ss_pred             ccEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCC-----CC----CCcccccccCCCCEEEEEEc
Q psy88             3 YPKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYS-----DG----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         3 ~~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~-----DG----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -.|.+++| +++.+.++|..+ +|.-+  |+|=+.....-..     -|    .|.-+...+.||++++.++.
T Consensus       120 ~~I~lN~gr~~~~l~V~NtGD-RPIQVGSHyHF~E~N~aL~FDR~~A~G~RLdIpAGTavRFEPG~~k~V~LV  191 (208)
T PRK13192        120 GEIELNAGRPAVTLDVTNTGD-RPIQVGSHFHFFEVNRALRFDRAAAYGMRLDIPAGTAVRFEPGETKEVRLV  191 (208)
T ss_pred             CCeeeCCCCCEEEEEEEeCCC-CceeeccccchhhcCchhhccHHHhcCcccccCCCCeEeECCCCeeEEEEE
Confidence            35788888 889999999998 77655  5553322211111     11    22223455889999999887


No 68 
>PF05938 Self-incomp_S1:  Plant self-incompatibility protein S1;  InterPro: IPR010264 This family consists of a series of plant proteins which are related to the Papaver rhoeas S1 self-incompatibility protein. Self-incompatibility (SI) is the single most important outbreeding device found in angiosperms and is a mechanism that regulates the acceptance or rejection of pollen. S1 is known to exhibit specific pollen-inhibitory properties [].
Probab=88.71  E-value=3  Score=23.66  Aligned_cols=52  Identities=17%  Similarity=0.304  Sum_probs=31.1

Q ss_pred             EEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88            14 VVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus        14 ~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .|.+.|.+. ....|..|=-.-    ..|    +....+.||+.+.++|. +-.|+-.|-|+
T Consensus         2 ~V~I~N~L~-~~~~L~vhC~S~----d~D----lg~~~l~~g~~~~~~F~~~~~~~t~f~C~   54 (110)
T PF05938_consen    2 HVVIINNLG-PGKILTVHCKSK----DDD----LGWHVLKPGQSYSFSFRDNFFGTTLFWCH   54 (110)
T ss_pred             EEEEEECCC-CCCeEEEEeeCC----Ccc----CCCEECCCCCEEEEEEecCcCCceeEEEE
Confidence            478899985 344443332211    122    11224899999999999 65566666664


No 69 
>PF00699 Urease_beta:  Urease beta subunit CAUTION: The Prosite patterns do not match this subunit of the enzyme;  InterPro: IPR002019 Urease 3.5.1.5 from EC is a nickel-binding enzyme that catalyzes the hydrolysis of urea to carbon dioxide and ammonia []:  Urea + H2O = CO2 + 2 NH3  Historically, it was the first enzyme to be crystallized (in 1926). It is mainly found in plant seeds and microorganisms. In plants, urease is a hexamer of identical chains. In bacteria [], it consists of either two or three different subunits (alpha IPR005847 from INTERPRO, beta, described in this entry, and gamma IPR002026 from INTERPRO). The structure of the urease complex is known []. This subunit does not appear to take part in the catalytic mechanism. This subunit is known (confusingly) as alpha in Helicobacter.; GO: 0009039 urease activity, 0016151 nickel ion binding, 0006807 nitrogen compound metabolic process; PDB: 1EJS_B 1EJW_B 1A5N_B 1A5K_B 1A5M_B 1EJR_B 1EJX_B 1A5L_B 1KRB_B 1FWA_B ....
Probab=88.60  E-value=0.64  Score=26.74  Aligned_cols=59  Identities=20%  Similarity=0.232  Sum_probs=31.4

Q ss_pred             cEEEecC-CEEEEEEEeCCCCCCceEEeCCccccCCC--CCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEG-DRVVVDVRNSMDGLENTIHWHGIHQRGTQ--YSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~G-d~v~i~~~N~~~~~~~~iH~HG~~~~~~~--~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .|.+++| ++++|.+.|..| +|..+=.|=.++..++  ..|     |    .|.-+...+.||++++.++.
T Consensus        11 ~I~lN~gr~~~~l~V~N~GD-RPIQVGSH~HF~E~N~aL~FDR~~A~G~RLdIPaGTavRFEPG~~k~V~LV   81 (100)
T PF00699_consen   11 DIELNAGRERITLEVTNTGD-RPIQVGSHYHFFEVNPALEFDREAAYGMRLDIPAGTAVRFEPGDTKEVELV   81 (100)
T ss_dssp             EEETTTTSEEEEEEEEE-SS-S-EEEETTS-GGGS-TTEES-HHHHTTEEE-SSTT-EEEE-TT-EEEEEEE
T ss_pred             cEEecCCCcEEEEEEEeCCC-cceEEccccCHHHHhHHhhhhHHHhCCcccCcCCCCeEEECCCCcEEEEEE
Confidence            4666666 578999999999 8876633332222211  111     1    12223455889999999887


No 70 
>PF10989 DUF2808:  Protein of unknown function (DUF2808);  InterPro: IPR021256  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=87.56  E-value=0.89  Score=27.43  Aligned_cols=25  Identities=20%  Similarity=0.387  Sum_probs=20.9

Q ss_pred             ccccCCCCEEEEEEc-----CCCeeeEEcc
Q psy88            49 QCPITQGNTFRYQFT-----ANAGTHFWHA   73 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~-----~~~Gt~~YH~   73 (75)
                      ..||+||.+.+..+.     ...|+|.|.|
T Consensus        96 ~~PV~pG~tv~V~l~~v~NP~~~G~Y~f~v  125 (146)
T PF10989_consen   96 DEPVPPGTTVTVVLSPVRNPRSGGTYQFNV  125 (146)
T ss_pred             CCCCCCCCEEEEEEEeeeCCCCCCeEEEEE
Confidence            568999999999995     3469999876


No 71 
>PRK13986 urease subunit alpha; Provisional
Probab=86.40  E-value=3.6  Score=26.90  Aligned_cols=59  Identities=19%  Similarity=0.169  Sum_probs=38.0

Q ss_pred             cEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCC-----CC----CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYS-----DG----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~-----DG----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .|.+++| +++++.++|..+ +|.-+  |+|=+.....-..     -|    .|.-+...+.||++++.++.
T Consensus       117 ~I~lN~gr~~~~l~V~NtGD-RPIQVGSHyHF~E~N~aL~FDR~~A~G~RLdIpAGTavRFEPG~~k~V~LV  187 (225)
T PRK13986        117 DITINAGKKAVSVKVKNVGD-RPVQVGSHFHFFEVNRCLEFDREKAFGKRLDIASGTAVRFEPGEEKSVELI  187 (225)
T ss_pred             CeecCCCCcEEEEEEEeCCC-CceeeccccchhhcCchhhccHHHhcCcccccCCCCeEeECCCCeeEEEEE
Confidence            5788888 889999999998 77655  5553332211111     11    22223455889999999887


No 72 
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism]
Probab=85.61  E-value=5.8  Score=24.65  Aligned_cols=67  Identities=13%  Similarity=0.107  Sum_probs=42.7

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccC-----------CCCCCCCCcccccccCCCCEEEEEEc-CCCeee
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRG-----------TQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTH   69 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~-----------~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~   69 (75)
                      +-.+.++.|++++..+.|... -   .|=-.+..+.           .+..++-. .....+.||++-...|. ..+|.|
T Consensus        62 p~~~~v~aG~tv~~v~~n~~e-l---~hef~~~~~~~~~~~~~~~~~~~Dme~d~-~~~v~L~PG~s~elvv~ft~~g~y  136 (158)
T COG4454          62 PSSFEVKAGETVRFVLKNEGE-L---KHEFTMDAPDKNLEHVTHMILADDMEHDD-PNTVTLAPGKSGELVVVFTGAGKY  136 (158)
T ss_pred             CCcccccCCcEEeeeecCccc-c---eEEEeccCccccchhHHHhhhCCccccCC-cceeEeCCCCcEEEEEEecCCccE
Confidence            456789999999999999764 1   1211111110           01122211 12345899999999999 889999


Q ss_pred             EEcc
Q psy88            70 FWHA   73 (75)
Q Consensus        70 ~YH~   73 (75)
                      -+-|
T Consensus       137 e~~C  140 (158)
T COG4454         137 EFAC  140 (158)
T ss_pred             EEEe
Confidence            8877


No 73 
>COG0832 UreB Urea amidohydrolase (urease) beta subunit [Amino acid transport and metabolism]
Probab=85.13  E-value=5.3  Score=23.08  Aligned_cols=59  Identities=20%  Similarity=0.288  Sum_probs=35.4

Q ss_pred             cEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .|++++| .++.|.+.|..+ +|.-+  |+|=.........|     |    .|.-+.....||+.++.++.
T Consensus        12 ~IelN~gr~~~~i~V~NtGD-RPIQVGSHfHF~EvN~aL~FDR~~a~G~RLdIpagTAVRFEPG~~k~V~LV   82 (106)
T COG0832          12 DIELNAGRPTVTIEVANTGD-RPIQVGSHFHFFEVNRALSFDREKAYGMRLDIPAGTAVRFEPGDEKEVELV   82 (106)
T ss_pred             cEEEeCCCcceEEEEeecCC-CceEeecceeehhhCcceeechhhhcceEecccCCceEeeCCCCccEEEEE
Confidence            4677777 467889999998 77654  55533322111111     1    12223455789999988876


No 74 
>TIGR03079 CH4_NH3mon_ox_B methane monooxygenase/ammonia monooxygenase, subunit B. Both ammonia oxidizers such as Nitrosomonas europaea and methanotrophs (obligate methane oxidizers) such as Methylococcus capsulatus each can grow only on their own characteristic substrate. However, both groups have the ability to oxidize both substrates, and so the relevant enzymes must be named here according to their ability to oxidze both. The protein family represented here reflects subunit B of both the particulate methane monooxygenase of methylotrophs and the ammonia monooxygenase of nitrifying bacteria.
Probab=83.65  E-value=2.2  Score=29.93  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=16.0

Q ss_pred             CCCcccccccCCCCEEEEEEc
Q psy88            43 GVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus        43 G~~~~~~~~i~pG~~~~y~~~   63 (75)
                      |.......||.|||+++.++.
T Consensus       331 GL~v~d~~pI~PGETr~v~v~  351 (399)
T TIGR03079       331 GLEVDDQSAIAPGETVEVKME  351 (399)
T ss_pred             cceeCCCCCcCCCcceEEEEE
Confidence            433334668999999999987


No 75 
>PF04744 Monooxygenase_B:  Monooxygenase subunit B protein;  InterPro: IPR006833 Ammonia monooxygenase and the particulate methane monooxygenase are both integral membrane proteins, occurring in ammonia oxidisers and methanotrophs respectively, which are thought to be evolutionarily related []. These enzymes have a relatively wide substrate specificity and can catalyse the oxidation of a range of substrates including ammonia, methane, halogenated hydrocarbons and aromatic molecules []. These enzymes are composed of 3 subunits - A (IPR003393 from INTERPRO), B (IPR006833 from INTERPRO) and C (IPR006980 from INTERPRO) - and contain various metal centres, including copper. Particulate methane monooxygenase from Methylococcus capsulatus str. Bath is an ABC homotrimer, which contains mononuclear and dinuclear copper metal centres, and a third metal centre containing a metal ion whose identity in vivo is not certain[]. The soluble regions of these enzymes derive primarily from the B subunit. This subunit forms two antiparallel beta-barrel-like structures and contains the mono- and di- nuclear copper metal centres [].; PDB: 3CHX_E 3RFR_A 3RGB_A 1YEW_A.
Probab=82.51  E-value=2.2  Score=29.93  Aligned_cols=15  Identities=27%  Similarity=0.432  Sum_probs=10.0

Q ss_pred             ccccCCCCEEEEEEc
Q psy88            49 QCPITQGNTFRYQFT   63 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~   63 (75)
                      ..||+|||+++.+..
T Consensus       318 ~~pI~PGETrtl~V~  332 (381)
T PF04744_consen  318 NSPIAPGETRTLTVE  332 (381)
T ss_dssp             -S-B-TT-EEEEEEE
T ss_pred             CCCcCCCceEEEEEE
Confidence            558999999999987


No 76 
>PF05506 DUF756:  Domain of unknown function (DUF756);  InterPro: IPR008475 This domain is found, normally as a tandem repeat, at the C terminus of bacterial phospholipase C proteins.; GO: 0004629 phospholipase C activity, 0016042 lipid catabolic process
Probab=82.44  E-value=6.1  Score=21.56  Aligned_cols=46  Identities=13%  Similarity=0.132  Sum_probs=30.6

Q ss_pred             CCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc
Q psy88            10 GDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus        10 Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~   63 (75)
                      ...|.|+|.|... .+..+......+     ..+.+  .+..|.||++.+..|.
T Consensus        19 ~g~l~l~l~N~g~-~~~~~~v~~~~y-----~~~~~--~~~~v~ag~~~~~~w~   64 (89)
T PF05506_consen   19 TGNLRLTLSNPGS-AAVTFTVYDNAY-----GGGGP--WTYTVAAGQTVSLTWP   64 (89)
T ss_pred             CCEEEEEEEeCCC-CcEEEEEEeCCc-----CCCCC--EEEEECCCCEEEEEEe
Confidence            3589999999977 666665443211     12222  2345899999999997


No 77 
>cd00918 Der-p2_like Several group 2 allergen proteins belong to the ML domain family. They include Dermatophagoides pteronyssinus, group 2 (Der p 2) and D. farinae, group 2 (Der f 2) allergens. These house dust mites cause heavy atopic diseases such as asthma and dermatitis. Although the allergenic properties of these proteins have been well characterized, their biological function in mites is unknown.
Probab=80.89  E-value=9  Score=22.45  Aligned_cols=57  Identities=16%  Similarity=0.436  Sum_probs=32.1

Q ss_pred             EEecCCEEEEEEEeCCC--CCCceEEeCC----cccc-CCCCCCCCCcccccccCCCCEEEEEEc
Q psy88             6 NVCEGDRVVVDVRNSMD--GLENTIHWHG----IHQR-GTQYSDGVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~--~~~~~iH~HG----~~~~-~~~~~DG~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .+++|..+.+.+.=..+  ......-.||    +..+ ..+..||=.. ..||+.+|+.++|.+.
T Consensus        23 ~l~rG~~~~~~~~F~~~~~s~~l~~~v~a~~~gv~iP~p~~~~daC~~-l~CPl~~G~~~~y~~~   86 (120)
T cd00918          23 VIHRGKPLTLEAKFTANQDTAKAKIKITASIDGLEIDVPGIETDGCKY-VKCPIKKGQHYDIKYT   86 (120)
T ss_pred             EEECCCeEEEEEEEECCCccceEEEEEEEEECCEEcCCCCCCCCCccc-EeCCCcCCcEEEEEEe
Confidence            56788888777652111  1223333344    2222 1123455322 3799999999999885


No 78 
>PF10633 NPCBM_assoc:  NPCBM-associated, NEW3 domain of alpha-galactosidase;  InterPro: IPR018905 This domain has been named NEW3, but its function is not known. It is found on proteins which are bacterial galactosidases [].; PDB: 1EUT_A 2BZD_A 1WCQ_C 2BER_A 1W8O_A 1EUU_A 1W8N_A.
Probab=80.25  E-value=4.2  Score=21.56  Aligned_cols=20  Identities=25%  Similarity=0.429  Sum_probs=13.6

Q ss_pred             ccCCCCEEEEEEc-C-----CCeeeE
Q psy88            51 PITQGNTFRYQFT-A-----NAGTHF   70 (75)
Q Consensus        51 ~i~pG~~~~y~~~-~-----~~Gt~~   70 (75)
                      .|+||++.+..|. .     .+|+|.
T Consensus        45 ~l~pG~s~~~~~~V~vp~~a~~G~y~   70 (78)
T PF10633_consen   45 SLPPGESVTVTFTVTVPADAAPGTYT   70 (78)
T ss_dssp             -B-TTSEEEEEEEEEE-TT--SEEEE
T ss_pred             cCCCCCEEEEEEEEECCCCCCCceEE
Confidence            5899999999988 2     367764


No 79 
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional
Probab=79.15  E-value=14  Score=23.53  Aligned_cols=57  Identities=14%  Similarity=0.061  Sum_probs=37.9

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .++++..|..+++.++-..  .-     |++..+..   .+     +.-.-||......+. +++|+|.--|.
T Consensus       116 ~~l~lp~g~~v~~~ltS~D--Vi-----Hsf~vp~l---~~-----k~d~~PG~~~~~~~~~~~~G~y~g~C~  173 (194)
T MTH00047        116 KPLRLVYGVPYHLLVTSSD--VI-----HSFSVPDL---NL-----KMDAIPGRINHLFFCPDRHGVFVGYCS  173 (194)
T ss_pred             ceEEEeCCCEEEeeeecCc--cc-----cceecccc---Cc-----eeecCCCceEEEEEEcCCCEEEEEEee
Confidence            3577888999888887653  22     55544321   11     112558999888888 99999987763


No 80 
>COG2967 ApaG Uncharacterized protein affecting Mg2+/Co2+ transport [Inorganic ion transport and metabolism]
Probab=78.61  E-value=3.3  Score=24.65  Aligned_cols=48  Identities=21%  Similarity=0.285  Sum_probs=27.8

Q ss_pred             EEEEEeCCCCCC---ceEEeCCccccCC---CCCCCCCcccccccCCCCEEEEEEc
Q psy88            14 VVDVRNSMDGLE---NTIHWHGIHQRGT---QYSDGVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus        14 ~i~~~N~~~~~~---~~iH~HG~~~~~~---~~~DG~~~~~~~~i~pG~~~~y~~~   63 (75)
                      +|++.|..+ .+   .+=||+=.+....   -.-+|+-+ .|-.+.||++|+|.--
T Consensus        33 titI~N~g~-~~vqLlsR~W~ITd~~g~v~eV~G~GVVG-eQP~l~PG~~y~YtSg   86 (126)
T COG2967          33 TVTIRNLGE-VPVQLLSRYWLITDGNGRVTEVEGEGVVG-EQPLLAPGEEYQYTSG   86 (126)
T ss_pred             EEEEecCCC-ccceeeeeEEEEecCCCcEEEEEcCceec-cccccCCCCceEEcCC
Confidence            578889876 44   3447764332210   01123322 3667899999999843


No 81 
>MTH00140 COX2 cytochrome c oxidase subunit II; Provisional
Probab=77.40  E-value=17  Score=23.55  Aligned_cols=56  Identities=14%  Similarity=0.049  Sum_probs=39.0

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .|.+-.|..|++.+++..-  -     |+...+.    -|..    .-+-||......+. +.+|.|+-.|.
T Consensus       141 ~l~lP~~~~v~~~~ts~DV--i-----Hsf~ip~----~~~k----~d~~Pg~~~~~~~~~~~~g~y~~~C~  197 (228)
T MTH00140        141 RLVLPYSVDTRVLVTSADV--I-----HSWTVPS----LGVK----VDAIPGRLNQLSFEPKRPGVFYGQCS  197 (228)
T ss_pred             eEEEeeCcEEEEEEEcCcc--c-----cceeccc----cCce----eECCCCcceeEEEEeCCCEEEEEECc
Confidence            5788889999999988532  2     5555442    2222    12568888888888 99999987773


No 82 
>PF00386 C1q:  C1q domain;  InterPro: IPR001073 This entry represents the C-terminal domain of C1q. C1q is a subunit of the C1 enzyme complex that activates the serum complement system. C1q comprises 6 A, 6 B and 6 C chains. These share the same topology, each possessing a small, globular N-terminal domain, a collagen-like Gly/Pro-rich central region, and a conserved C-terminal region, the C1q domain []. The C1q protein is produced in collagen-producing cells and shows sequence and structural similarity to collagens VIII and X [, ]. This domain is also found in multimerin and EMILIN proteins.; PDB: 1O91_C 2JG8_D 2JG9_A 2WNV_A 2WNU_A 1PK6_A 4DOU_A 1C3H_C 1C28_C 2OII_A ....
Probab=77.35  E-value=3.2  Score=23.89  Aligned_cols=18  Identities=22%  Similarity=0.254  Sum_probs=13.2

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      ..+.+++||+|.|++...
T Consensus        91 ~vl~L~~GD~V~v~~~~~  108 (127)
T PF00386_consen   91 AVLQLNKGDTVWVRLDSG  108 (127)
T ss_dssp             EEEEE-TT-EEEEEEEEE
T ss_pred             EEEEeCCCCEEEEEEecC
Confidence            367899999999999853


No 83 
>PLN02303 urease
Probab=74.76  E-value=10  Score=29.34  Aligned_cols=59  Identities=24%  Similarity=0.268  Sum_probs=38.2

Q ss_pred             cEEEecC-CEEEEEEEeCCCCCCceE--EeCCccccCCCCCC-----C----CCcccccccCCCCEEEEEEc
Q psy88             4 PKNVCEG-DRVVVDVRNSMDGLENTI--HWHGIHQRGTQYSD-----G----VPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus         4 ~i~~~~G-d~v~i~~~N~~~~~~~~i--H~HG~~~~~~~~~D-----G----~~~~~~~~i~pG~~~~y~~~   63 (75)
                      .|++++| +++++.++|..+ +|..+  |+|=+........|     |    .|.-+...+.||++++.++.
T Consensus       142 ~i~~n~gr~~~~l~v~n~gd-rpiqvgSH~hf~e~N~aL~FdR~~a~G~rLdipaGtavRfePG~~~~V~lv  212 (837)
T PLN02303        142 SIIINAGRKAVKLKVTNTGD-RPIQVGSHYHFIETNPYLVFDRRKAYGMRLNIPAGTAVRFEPGETKTVTLV  212 (837)
T ss_pred             CeeeCCCCCeEEEEEeeCCC-CceEeccccchHhcCchhhccHHHhcCccccCCCCCeEeECCCCeeEEEEE
Confidence            5778887 789999999999 78665  55533322111111     1    22223455889999999887


No 84 
>PRK05461 apaG CO2+/MG2+ efflux protein ApaG; Reviewed
Probab=73.60  E-value=8.7  Score=22.88  Aligned_cols=15  Identities=27%  Similarity=0.474  Sum_probs=11.2

Q ss_pred             ccccCCCCEEEEEEc
Q psy88            49 QCPITQGNTFRYQFT   63 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~   63 (75)
                      |-.|.||++|.|.=-
T Consensus        73 qP~L~PGe~F~Y~S~   87 (127)
T PRK05461         73 QPVLAPGESFEYTSG   87 (127)
T ss_pred             CceECCCCCeEEeCC
Confidence            344789999999744


No 85 
>PF09394 Inhibitor_I42:  Chagasin family peptidase inhibitor I42;  InterPro: IPR018990 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   Chagasin reversible inhibitor of papain-like cysteine proteases []. Chagasin has a beta-barrel structure, which is a unique variant of the immunoglobulin fold with homology to human CD8alpha [, ].; PDB: 2NQD_A 2NNR_A 2H7W_B 3E1Z_A 3CBK_B 3CBJ_B 2OUL_B 2FO8_A 2WGN_B 2C34_A ....
Probab=73.59  E-value=11  Score=20.27  Aligned_cols=18  Identities=17%  Similarity=0.242  Sum_probs=14.7

Q ss_pred             EEEecCCEEEEEEEeCCC
Q psy88             5 KNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~   22 (75)
                      |.++.||.+.|.|.-+..
T Consensus         1 I~v~~g~~~~I~L~~nps   18 (92)
T PF09394_consen    1 ITVKVGDTFEIELPENPS   18 (92)
T ss_dssp             -EEETTSEEEEEEEEBCC
T ss_pred             CeecCCCEEEEEECCCCC
Confidence            689999999999997644


No 86 
>cd05468 pVHL von Hippel-Landau (pVHL) tumor suppressor protein. von Hippel-Landau (pVHL) protein, the gene product of VHL, is a critical regulator of the ubiquitous oxygen-sensing pathway. It is conserved throughout evolution, as its homologs are found in organisms ranging from mammals to the Drosophila melanogaster, Anopheles gambiae insects and the Caenorhabditis elegans nematode. pVHL acts as the substrate recognition component of an E3 ubiquitin ligase complex.  Several proteins have been identified as pVHL-binding proteins that are subject to ubiquitin-mediated proteolysis; the best characterized putative substrates are the alpha subunits of the hypoxia-inducible factor (HIF1alpha, HIF2alpha, and HIF3alpha). In addition to HIF degradation, pVHL has been implicated to be involved in HIF independent cellular processes. Germline VHL mutations cause renal cell carcinomas, hemangioblastomas and pheochromocytomas in humans. pVHL can bind to and direct the proper deposition of fibronecti
Probab=72.55  E-value=14  Score=22.18  Aligned_cols=43  Identities=28%  Similarity=0.375  Sum_probs=29.3

Q ss_pred             ecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEE
Q psy88             8 CEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRY   60 (75)
Q Consensus         8 ~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y   60 (75)
                      +.+..+.|.|.|..+ .+.-+-|  +.+      +|.. .....+.||++++.
T Consensus         4 ~s~~~~~v~F~N~t~-~~v~~~W--id~------~G~~-~~Y~~l~pg~~~~~   46 (141)
T cd05468           4 NSRVPSTVRFVNRTD-RPVELYW--IDY------DGKP-VSYGTLQPGETVRQ   46 (141)
T ss_pred             CCCceEEEEEEeCCC-CeEEEEE--ECC------CCCE-EEeeeeCCCCEEee
Confidence            456789999999998 7888887  322      3322 22344888888754


No 87 
>cd00916 Npc2_like Niemann-Pick type C2 (Npc2) is a lysosomal protein in which a mutation in the gene causes a rare form of Niemann-Pick type C disease, an autosomal recessive lipid storage disorder characterized by accumulation of low-density lipoprotein-derived cholesterol in lysosomes. Although Npc2 is known to bind cholesterol, the function of this protein is unknown. These proteins belong to the ML domain family.
Probab=71.27  E-value=18  Score=21.06  Aligned_cols=58  Identities=17%  Similarity=0.361  Sum_probs=31.6

Q ss_pred             EEecCCEEEEEEEeCCC--CC--CceEEe--CCccccCC-CCCCCCCcc-cccccCCCCEEEEEEc
Q psy88             6 NVCEGDRVVVDVRNSMD--GL--ENTIHW--HGIHQRGT-QYSDGVPFV-TQCPITQGNTFRYQFT   63 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~--~~--~~~iH~--HG~~~~~~-~~~DG~~~~-~~~~i~pG~~~~y~~~   63 (75)
                      .+++|+.+.+.+.=...  ..  .+.+|+  -|+..+-. +..|+=... ..||+.+|+.++|...
T Consensus        25 ~l~rG~~~~~~i~F~~~~~~~~~~~~v~~~~~gv~ip~~~~~~daC~~~~~~CPl~~G~~~~y~~~   90 (123)
T cd00916          25 KLKRGSTAKVSIDFTPNFDSTSLKTEVHAILLGVPVPFPLPNPDACKNLGTSCPLSAGEDVTYTLS   90 (123)
T ss_pred             EEECCCEEEEEEEEEcCcccceeEEEEEEEECCEEecCCCCCCccccCCCCCCCCcCCcEEEEEEe
Confidence            46788888777662211  01  122222  24333211 124442111 4799999999999985


No 88 
>MTH00098 COX2 cytochrome c oxidase subunit II; Validated
Probab=71.24  E-value=25  Score=22.81  Aligned_cols=56  Identities=7%  Similarity=0.005  Sum_probs=35.6

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .|.+-.|..|++.++-..-     |  |+...+.    -|+-   . -.-||..-...+. +++|.|+.-|-
T Consensus       141 ~lvlP~~~~v~~~~tS~DV-----i--Hsf~ip~----lg~k---~-daiPG~~~~~~~~~~~~G~~~g~Cs  197 (227)
T MTH00098        141 RVVLPMEMPIRMLISSEDV-----L--HSWAVPS----LGLK---T-DAIPGRLNQTTLMSTRPGLYYGQCS  197 (227)
T ss_pred             eEEecCCCEEEEEEEECcc-----c--ccccccc----cccc---e-ecCCCceEEEEEecCCcEEEEEECc
Confidence            4566667777777665432     2  5554442    2222   1 2458998888888 99999988773


No 89 
>smart00110 C1Q Complement component C1q domain. Globular domain found in many collagens and eponymously in complement C1q. When part of full length proteins these domains form a 'bouquet' due to the multimerization of heterotrimers. The C1q fold is similar to that of tumour necrosis factor.
Probab=68.68  E-value=6.1  Score=23.51  Aligned_cols=16  Identities=19%  Similarity=0.302  Sum_probs=14.0

Q ss_pred             ccEEEecCCEEEEEEE
Q psy88             3 YPKNVCEGDRVVVDVR   18 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~   18 (75)
                      ..|.+++||+|.|++.
T Consensus        96 ~vL~L~~GD~Vwl~l~  111 (135)
T smart00110       96 ALLQLRQGDQVWLELP  111 (135)
T ss_pred             EEEEECCCCEEEEEEe
Confidence            4689999999999985


No 90 
>PF09962 DUF2196:  Uncharacterized conserved protein (DUF2196);  InterPro: IPR019240  A pair of adjacent genes, ablAB (acetyl-beta-lysine biosynthesis) encodes lysine 2,3-aminomutase and beta-lysine acetyltransferase in methanogenic archaea. Homologous pairs, possibly with identical function, occur in a wide range of species, including Bacillus subtilis. This model describes a conserved hypothetical protein, small in size, with a phylogenetic distribution moderately well correlated to that of the acetyltransferase family. This protein family is also described as DUF2196 and COG4895 from COG. The function is unknown. 
Probab=65.67  E-value=6.1  Score=20.80  Aligned_cols=36  Identities=25%  Similarity=0.303  Sum_probs=25.1

Q ss_pred             EecCCEEEEEEEeCCCC------------CCceEEeCCccccCCCCCCCCC
Q psy88             7 VCEGDRVVVDVRNSMDG------------LENTIHWHGIHQRGTQYSDGVP   45 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~~------------~~~~iH~HG~~~~~~~~~DG~~   45 (75)
                      ++.|..|.|.+++.-..            ...+.|.||+...-   .||.-
T Consensus         9 I~~G~~V~IVlK~dQ~tg~lt~GiV~~iLT~s~~HP~GIKVrL---~~G~V   56 (62)
T PF09962_consen    9 IKPGITVEIVLKQDQRTGKLTEGIVKDILTNSPTHPHGIKVRL---EDGQV   56 (62)
T ss_pred             ccCCCEEEEEECCCCCcCccccEEhheeecCCCCCCCCcEEEe---cCCCe
Confidence            57899999988886431            13568999988764   36643


No 91 
>MTH00129 COX2 cytochrome c oxidase subunit II; Provisional
Probab=65.58  E-value=35  Score=22.21  Aligned_cols=56  Identities=16%  Similarity=0.121  Sum_probs=36.1

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .+.+-.|..+++.++-..     .|  |+...+.    -|..    ...-||..-...+. +++|+|+--|.
T Consensus       141 ~lvlP~~~~v~~~~tS~D-----Vi--Hsf~ip~----~~~k----~da~PG~~~~~~~~~~~~G~~~g~C~  197 (230)
T MTH00129        141 RMVVPVESPIRVLVSAED-----VL--HSWAVPA----LGVK----MDAVPGRLNQTAFIASRPGVFYGQCS  197 (230)
T ss_pred             eEEEecCcEEEEEEEeCc-----cc--cceeccc----cCCc----cccCCCceEEEEEEeCCceEEEEECh
Confidence            466667777777776543     22  5554442    2221    12558999888888 99999988773


No 92 
>MTH00051 COX2 cytochrome c oxidase subunit II; Provisional
Probab=65.07  E-value=36  Score=22.20  Aligned_cols=55  Identities=16%  Similarity=0.073  Sum_probs=37.0

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .|.+-.|+.+++.+++..-     |  |+...+.    -|.-    .-.-||..-...+. +++|+|.--|
T Consensus       145 ~lvlP~~~~v~~~itS~DV-----i--Hsf~vp~----lg~k----~daiPG~~~~~~~~~~~~G~y~g~C  200 (234)
T MTH00051        145 RLIVPIQTQVRVLVTAADV-----L--HSFAVPS----LSVK----IDAVPGRLNQTSFFIKRPGVFYGQC  200 (234)
T ss_pred             EEEEecCcEEEEEEEeCch-----h--ccccccc----cCce----eEccCCceEeEEEEeCCCEEEEEEC
Confidence            4777889999999888632     2  5554432    2222    12458888888888 9999988766


No 93 
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=64.60  E-value=7.7  Score=20.73  Aligned_cols=16  Identities=25%  Similarity=0.391  Sum_probs=13.4

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      -|++.+||.|.|.+.-
T Consensus        42 rI~I~~GD~V~Ve~sp   57 (68)
T TIGR00008        42 YIRILPGDKVKVELSP   57 (68)
T ss_pred             cEEECCCCEEEEEECc
Confidence            5789999999998754


No 94 
>TIGR03833 conserved hypothetical protein. A pair of adjacent genes, ablAB (acetyl-beta-lysine biosynthesis) encodes lysine 2,3-aminomutase and beta-lysine acetyltransferase in methanogenic archaea. Homologous pairs, possibly with identical function, occur in a wide range of species, including Bacillus subtilis. This model describes a conserved hypothetical protein, small in size, with a phylogenetic distribution moderately well correlated to that of the acetyltransferase family. This protein family is also described as DUF2196 and COG4895. The function is unknown.
Probab=63.17  E-value=8.2  Score=20.30  Aligned_cols=37  Identities=27%  Similarity=0.319  Sum_probs=24.9

Q ss_pred             EEecCCEEEEEEEeCCCC------------CCceEEeCCccccCCCCCCCCC
Q psy88             6 NVCEGDRVVVDVRNSMDG------------LENTIHWHGIHQRGTQYSDGVP   45 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~~------------~~~~iH~HG~~~~~~~~~DG~~   45 (75)
                      .++.|..|.|.++..-..            ...+.|.||+.+.-   .||.-
T Consensus         7 ~I~~G~~V~IvlK~DQ~tG~lt~G~V~diLT~s~~Hp~GIKVrL---~dG~V   55 (62)
T TIGR03833         7 NIKPGLSVDIVLKQDQRTGKLTRGIVKDILTNSPTHPHGIKVRL---EDGQV   55 (62)
T ss_pred             ccCCCCEEEEEEeccCCCCceeeEEhhhhhcCCCCCCCceEEEE---ecCCe
Confidence            356788999988864321            13578999998764   47643


No 95 
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=62.72  E-value=8.6  Score=21.59  Aligned_cols=28  Identities=18%  Similarity=0.143  Sum_probs=18.6

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWH   31 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~H   31 (75)
                      -|++..||.|.|.+.--.....-.++-|
T Consensus        44 rIrIl~GD~V~VE~spYDltkGRIiyR~   71 (87)
T PRK12442         44 RIRILAGDRVTLELSPYDLTKGRINFRH   71 (87)
T ss_pred             eEEecCCCEEEEEECcccCCceeEEEEe
Confidence            4889999999999885433233344444


No 96 
>KOG4387|consensus
Probab=62.57  E-value=3.4  Score=26.31  Aligned_cols=30  Identities=13%  Similarity=0.452  Sum_probs=23.9

Q ss_pred             EEEecCCEEEEEEEeCCCCCCceEEeCCccc
Q psy88             5 KNVCEGDRVVVDVRNSMDGLENTIHWHGIHQ   35 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~   35 (75)
                      ...+.++.+.+.+.|.+. ...+++|||+.-
T Consensus        71 ~~~n~~~~~~~d~~~rlt-~~~s~~W~~vl~  100 (191)
T KOG4387|consen   71 LPGNDRKPGILDFQERLT-VAKSMNWHGVLS  100 (191)
T ss_pred             ccccCCCCcEEeccchhh-eeeecccceEEe
Confidence            345567888899999988 789999999753


No 97 
>KOG4063|consensus
Probab=61.32  E-value=35  Score=21.22  Aligned_cols=16  Identities=25%  Similarity=0.802  Sum_probs=14.4

Q ss_pred             cccccCCCCEEEEEEc
Q psy88            48 TQCPITQGNTFRYQFT   63 (75)
Q Consensus        48 ~~~~i~pG~~~~y~~~   63 (75)
                      ..||+.+||.++|.+.
T Consensus       106 v~CPl~age~ytY~~s  121 (158)
T KOG4063|consen  106 VYCPLSAGEDYTYLNS  121 (158)
T ss_pred             ccCcccCCCceEEEEE
Confidence            4799999999999976


No 98 
>MTH00008 COX2 cytochrome c oxidase subunit II; Validated
Probab=61.23  E-value=43  Score=21.77  Aligned_cols=55  Identities=18%  Similarity=0.144  Sum_probs=36.7

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .+.+-.|..|++.+++..-     |  |+...+.    -|.-    ...-||..-...+. +++|.|+--|
T Consensus       141 ~lvlP~~~~v~~~~tS~DV-----i--Hsf~vP~----~~~k----~daiPG~~~~~~~~~~~~G~~~g~C  196 (228)
T MTH00008        141 RAVLPMQTEIRVLVTAADV-----I--HSWTVPS----LGVK----VDAVPGRLNQIGFTITRPGVFYGQC  196 (228)
T ss_pred             eEEEecCCEEEEEEEeCCc-----c--ccccccc----cCcc----eecCCCceEEEEEEeCCCEEEEEEC
Confidence            5667788888998888532     2  5554432    2221    12458888888888 9999988766


No 99 
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=60.89  E-value=9.9  Score=20.74  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=13.9

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      -|++.+||.|.|.+.--
T Consensus        44 ~i~I~~GD~V~Ve~~~~   60 (75)
T COG0361          44 RIRILPGDVVLVELSPY   60 (75)
T ss_pred             eEEeCCCCEEEEEeccc
Confidence            58899999999987643


No 100
>KOG2500|consensus
Probab=59.45  E-value=7.3  Score=25.73  Aligned_cols=18  Identities=17%  Similarity=0.399  Sum_probs=15.0

Q ss_pred             cEEEecCCEEEEEEEeCC
Q psy88             4 PKNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~   21 (75)
                      -+-+|+|++|+|.+.|..
T Consensus       149 DlgFKEGeTIkinikn~t  166 (253)
T KOG2500|consen  149 DLGFKEGETIKINIKNIT  166 (253)
T ss_pred             cccccCCcEEEEEeeccc
Confidence            356899999999999843


No 101
>COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis]
Probab=58.85  E-value=6.3  Score=22.68  Aligned_cols=17  Identities=24%  Similarity=0.190  Sum_probs=14.4

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      .++.||.|+|++.|..-
T Consensus        48 ~VK~GD~l~i~~~~~~~   64 (100)
T COG1188          48 EVKVGDILTIRFGNKEF   64 (100)
T ss_pred             ccCCCCEEEEEeCCcEE
Confidence            47899999999999853


No 102
>PF12306 PixA:  Inclusion body protein;  InterPro: IPR021087  This entry represents bacterial proteins that are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein []. This signature also identifies AidA. 
Probab=58.39  E-value=42  Score=20.80  Aligned_cols=18  Identities=11%  Similarity=0.067  Sum_probs=15.3

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +.|+++.||.|+++..--
T Consensus        58 L~i~a~~GD~Irwr~tSl   75 (172)
T PF12306_consen   58 LSIKANVGDTIRWRATSL   75 (172)
T ss_pred             eEEeccCCCEEEEEEEee
Confidence            578999999999998744


No 103
>cd08058 MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding); eukaryotic. This family contains eukaryotic MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+) domains found in proteins with a variety of functions, including AMSH (associated molecule with the Src homology 3 domain (SH3) of STAM), H2A-DUB (histone H2A deubiquitinase), BRCC36 (BRCA1/BRCA2-containing complex subunit 36), as well as Rpn11 (regulatory particle number 11) and CSN5 (COP9 signalosome complex subunit 5). These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity. Rpn11 is responsible for substrate deubiquitination during proteasomal degradation. It is essential for maintaining a correct cell cycle and normal mitochondrial morphology and physiology. CSN5 is critical for nuclear export and the degradation of several tumor suppressor prot
Probab=57.89  E-value=5.1  Score=23.01  Aligned_cols=7  Identities=29%  Similarity=0.928  Sum_probs=5.5

Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      =|||||.
T Consensus        69 G~YHSHP   75 (119)
T cd08058          69 GWYHSHP   75 (119)
T ss_pred             EEEecCC
Confidence            3999994


No 104
>PRK12791 flbT flagellar biosynthesis repressor FlbT; Reviewed
Probab=57.38  E-value=9.7  Score=22.89  Aligned_cols=27  Identities=19%  Similarity=0.178  Sum_probs=19.5

Q ss_pred             CcccEEEecCCEEEEE---EEeCCCCCCceEE
Q psy88             1 MLYPKNVCEGDRVVVD---VRNSMDGLENTIH   29 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~---~~N~~~~~~~~iH   29 (75)
                      |++.|.+|.|+++.|.   +.|..  +..++-
T Consensus         1 M~Lkl~LKP~ERi~INGaVi~Ngd--rr~~l~   30 (131)
T PRK12791          1 MPLRVELKPFERIVIGQSVITNSD--TRARFL   30 (131)
T ss_pred             CCeeEEeCCCCEEEEcCEEEEeCC--cceEEE
Confidence            8899999999999884   55553  344443


No 105
>PF00927 Transglut_C:  Transglutaminase family, C-terminal ig like domain;  InterPro: IPR008958 Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase  Transglutaminases catalyse the post-translational modification of proteins at glutamine residues, with formation of isopeptide bonds. Members of the transglutaminase family usually have three domains: N-terminal (IPR001102 from INTERPRO), middle (IPR013808 from INTERPRO) and C-terminal. The middle domain is usually well conserved, but family members can display major differences in their N- and C-terminal domains, although their overall structure is conserved []. This entry represents the C-terminal domain found in transglutaminases, which consists of an immunoglobulin-like beta-sandwich consisting of seven strands in two sheets with a Greek key topology. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. Protein-glutamine gamma-glutamyltransferases (2.3.2.13 from EC) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [, ].; GO: 0003810 protein-glutamine gamma-glutamyltransferase activity, 0018149 peptide cross-linking; PDB: 2XZZ_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B 1L9N_B ....
Probab=57.23  E-value=7.3  Score=21.80  Aligned_cols=19  Identities=21%  Similarity=0.331  Sum_probs=13.5

Q ss_pred             cccCCCCEEEEEEc---CCCee
Q psy88            50 CPITQGNTFRYQFT---ANAGT   68 (75)
Q Consensus        50 ~~i~pG~~~~y~~~---~~~Gt   68 (75)
                      ..|.||++.++++.   .+.|.
T Consensus        60 ~~l~p~~~~~~~~~i~p~~yG~   81 (107)
T PF00927_consen   60 VTLKPGETKSVEVTITPSQYGP   81 (107)
T ss_dssp             EEE-TTEEEEEEEEE-HHSHEE
T ss_pred             eeeCCCCEEEEEEEEEceeEec
Confidence            34899999999988   45553


No 106
>COG2880 Uncharacterized protein conserved in archaea [Function unknown]
Probab=54.96  E-value=11  Score=20.22  Aligned_cols=19  Identities=26%  Similarity=0.378  Sum_probs=16.1

Q ss_pred             CcccEEEecCCEEEEEEEe
Q psy88             1 MLYPKNVCEGDRVVVDVRN   19 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~N   19 (75)
                      +++.+.+++|+.|+|.+.|
T Consensus        18 PLqkv~LkEGekv~i~i~~   36 (67)
T COG2880          18 PLKKVDLKEGEKVKIVIRV   36 (67)
T ss_pred             ccccccCCCCCEEEEEEec
Confidence            4678899999999999855


No 107
>PF05688 DUF824:  Salmonella repeat of unknown function (DUF824);  InterPro: IPR008542 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli. These repeats are almost always found with this entry. The repeats are associated with RatA and RatB, the coding sequences of which are found in the pathogeneicity island of Salmonella. The sequences may be determinants of pathogenicity [, ].
Probab=54.63  E-value=14  Score=18.28  Aligned_cols=15  Identities=13%  Similarity=0.202  Sum_probs=11.7

Q ss_pred             EEEecCCEEEEEEEe
Q psy88             5 KNVCEGDRVVVDVRN   19 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N   19 (75)
                      ..+|.||+|.+++.=
T Consensus         7 akaK~Ge~I~ltVt~   21 (47)
T PF05688_consen    7 AKAKVGETIPLTVTV   21 (47)
T ss_pred             hheecCCeEEEEEEE
Confidence            468999998887763


No 108
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=51.39  E-value=9.4  Score=18.77  Aligned_cols=15  Identities=20%  Similarity=0.038  Sum_probs=10.7

Q ss_pred             cccEEEecCCEEEEE
Q psy88             2 LYPKNVCEGDRVVVD   16 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~   16 (75)
                      +..|.+++||.|+|.
T Consensus        13 ~~~Ls~~~Gd~i~v~   27 (55)
T PF07653_consen   13 PDELSFKKGDVIEVL   27 (55)
T ss_dssp             TTB-EB-TTEEEEEE
T ss_pred             CCceEEecCCEEEEE
Confidence            356899999999987


No 109
>cd00912 ML The ML (MD-2-related lipid-recognition) domain is present in MD-1, MD-2, GM2 activator protein, Niemann-Pick type C2 (Npc2) protein, phosphatidylinositol/phosphatidylglycerol transfer protein (PG/PI-TP), mite allergen Der p 2  and several proteins of unknown function in plants, animals and fungi. These single-domain proteins form two anti-parallel beta-pleated sheets stabilized by three disulfide bonds and with an accessible central hydrophobic cavity, and are predicted to mediate diverse biological functions through interaction with specific lipids.
Probab=51.26  E-value=14  Score=21.33  Aligned_cols=16  Identities=31%  Similarity=0.856  Sum_probs=14.1

Q ss_pred             cccccCCCCEEEEEEc
Q psy88            48 TQCPITQGNTFRYQFT   63 (75)
Q Consensus        48 ~~~~i~pG~~~~y~~~   63 (75)
                      ..||+.+|+.++|...
T Consensus        78 ~~CPl~~G~~~~~~~~   93 (127)
T cd00912          78 SFCPLRKGQQYSYAKT   93 (127)
T ss_pred             ccCCcCCCCEEEEEEE
Confidence            3699999999999986


No 110
>cd04456 S1_IF1A_like S1_IF1A_like: Translation initiation factor IF1A-like, S1-like RNA-binding domain. IF1A is also referred to as eIF1A in eukaryotes and aIF1A in archaea. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=50.36  E-value=19  Score=19.56  Aligned_cols=17  Identities=24%  Similarity=0.239  Sum_probs=14.0

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++++||.|.|...-.
T Consensus        36 ~iwI~~GD~VlV~~~~~   52 (78)
T cd04456          36 NIWIKRGDFLIVDPIEE   52 (78)
T ss_pred             CEEEcCCCEEEEEeccc
Confidence            48999999999986553


No 111
>cd05793 S1_IF1A S1_IF1A: Translation initiation factor IF1A, also referred to as eIF1A in eukaryotes and aIF1A in archaea, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=50.00  E-value=19  Score=19.47  Aligned_cols=17  Identities=29%  Similarity=0.235  Sum_probs=13.9

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++++||.|.|.+.-.
T Consensus        36 ~iwI~~GD~V~Ve~~~~   52 (77)
T cd05793          36 RVWINEGDIVLVAPWDF   52 (77)
T ss_pred             cEEEcCCCEEEEEeccc
Confidence            58999999999986544


No 112
>TIGR01432 QOXA cytochrome aa3 quinol oxidase, subunit II. This enzyme catalyzes the oxidation of quinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. This subunit contains two transmembrane helices and a large external domain responsible for the binding and oxidation of quinol. QuoX is (presently) only found in gram positive bacteria of the Bacillus/Staphylococcus group. Like CyoA, the ubiquinol oxidase found in proteobacteria, the residues responsible for the ligation of Cu(a) and cytochrome c (found in the related cyt. c oxidases) are absent. Unlike CyoA, QoxA is in complex with a subunit I which contains cytochromes a similar to the cyt. c oxidases (as opposed to cytochromes b).
Probab=49.93  E-value=66  Score=20.56  Aligned_cols=56  Identities=16%  Similarity=0.129  Sum_probs=36.4

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      ..|.+-.|..|++.++...     .|  |.+..+..   -+     +.-.-||..-...|. +++|+|.=.|
T Consensus       130 n~l~iP~g~~v~~~ltS~D-----Vi--Hsf~vP~l---~~-----k~daiPG~~~~~~~~~~~~G~y~g~C  186 (217)
T TIGR01432       130 NYLNIPKDRPVLFKLQSAD-----TM--TSFWIPQL---GG-----QKYAMTGMTMNWYLQADQVGTYRGRN  186 (217)
T ss_pred             CcEEEECCCEEEEEEECCc-----hh--hhhhchhh---Cc-----eeecCCCceEEEEEEeCCCEEEEEEe
Confidence            3577788888888887653     22  44444321   11     112458888888888 9999997666


No 113
>MTH00185 COX2 cytochrome c oxidase subunit II; Provisional
Probab=49.69  E-value=71  Score=20.80  Aligned_cols=56  Identities=14%  Similarity=0.100  Sum_probs=35.1

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .+.+-.|..+++.++-..     .|  |+...+.    -|.-    ...-||+.....+. +++|+|.--|.
T Consensus       141 ~lvlP~~~~v~~~~tS~D-----Vi--Hsf~iP~----lg~k----~daiPG~~~~~~~~~~~~G~~~g~Cs  197 (230)
T MTH00185        141 RMVVPMESPIRVLITAED-----VL--HSWTVPA----LGVK----MDAVPGRLNQATFIISRPGLYYGQCS  197 (230)
T ss_pred             eEEEecCCEEEEEEEcCc-----cc--ccccccc----cCce----eEecCCceEEEEEEeCCcEEEEEEch
Confidence            456666777777766543     22  5554442    2222    12458888888888 99999987763


No 114
>PF01847 VHL:  von Hippel-Lindau disease tumour suppressor protein;  InterPro: IPR022772 Von Hippel-Lindau disease tumor suppressor (VHL) has two domains: a roughly 100-residue N-terminal domain rich in beta sheet (beta domain) and a smaller alpha-helical domain (alpha domain), held together by two linkers and a polar interface. A large portion of the alpha domain surface, and a small portion of the beta domain, interact with ElonginC. About half of the tumorigenic mutations map to the alpha domain and its residues that contact ElonginC. The remaining mutations map to the beta domain, and significantly, to a beta domain surface patch uninvolved in ElonginC binding. This suggests that two intact macromolecular binding sites may be required for the tumor suppressor effects of VHL []. This entry represents both beta and alpha domains of VHL.; PDB: 3ZRF_L 3ZRC_C 1LM8_V 1LQB_C 1VCB_F.
Probab=49.63  E-value=35  Score=21.20  Aligned_cols=45  Identities=18%  Similarity=0.245  Sum_probs=24.2

Q ss_pred             EecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEE
Q psy88             7 VCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQ   61 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~   61 (75)
                      ++..+...|.|.|..+ ...-+-|=.        .||.+. ....+.||+.+...
T Consensus         9 ~~S~~~s~V~F~N~s~-r~V~v~Wld--------y~G~~~-~Y~~L~Pg~~~~~~   53 (156)
T PF01847_consen    9 LNSREPSFVRFVNRSP-RTVDVYWLD--------YDGKPV-PYGTLKPGQGRRQN   53 (156)
T ss_dssp             ----SEEEEEEEE-SS-S-EEEEEE---------TTS-EE-E---B-TTEEEEEE
T ss_pred             CCCCCceEEEEEECCC-CEEEEEEEc--------CCCcEe-eccccCCCCeEEcc
Confidence            3456789999999998 788888822        245332 12348899887764


No 115
>PF05753 TRAP_beta:  Translocon-associated protein beta (TRAPB);  InterPro: IPR008856 This family consists of several eukaryotic translocon-associated protein beta (TRAPB) or signal sequence receptor beta subunit (SSR-beta) proteins. The normal translocation of nascent polypeptides into the lumen of the endoplasmic reticulum (ER) is thought to be aided in part by a translocon-associated protein (TRAP) complex consisting of 4 protein subunits. The association of mature proteins with the ER and Golgi, or other intracellular locales, such as lysosomes, depends on the initial targeting of the nascent polypeptide to the ER membrane. A similar scenario must also exist for proteins destined for secretion [].; GO: 0005783 endoplasmic reticulum, 0016021 integral to membrane
Probab=49.15  E-value=65  Score=20.23  Aligned_cols=21  Identities=14%  Similarity=0.230  Sum_probs=15.7

Q ss_pred             ccccCCCCEEEEEEc---CCCeee
Q psy88            49 QCPITQGNTFRYQFT---ANAGTH   69 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~---~~~Gt~   69 (75)
                      -..|+||++.+..+.   ...|.|
T Consensus        80 ~~~i~pg~~vsh~~vv~p~~~G~f  103 (181)
T PF05753_consen   80 WERIPPGENVSHSYVVRPKKSGYF  103 (181)
T ss_pred             EEEECCCCeEEEEEEEeeeeeEEE
Confidence            356899999988887   446655


No 116
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=49.15  E-value=26  Score=20.51  Aligned_cols=17  Identities=18%  Similarity=0.366  Sum_probs=14.4

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      .++.||+|+++|....+
T Consensus        88 ~lk~G~~V~F~~~~~~~  104 (115)
T PRK09838         88 EIKTGDKVAFNFVQQGN  104 (115)
T ss_pred             cCCCCCEEEEEEEEcCC
Confidence            46899999999998765


No 117
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=49.10  E-value=33  Score=18.96  Aligned_cols=27  Identities=15%  Similarity=0.101  Sum_probs=18.7

Q ss_pred             EEEecCCEEEEEEEeCCCCCCceEEeC
Q psy88             5 KNVCEGDRVVVDVRNSMDGLENTIHWH   31 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~~~~~~iH~H   31 (75)
                      |.+++|++|+|.=..........++|-
T Consensus         1 ~~v~~G~~vtL~C~~~~~~~~~~~~Wy   27 (107)
T cd07700           1 ILVQTNNTVKLSCEAKGISENTRIYWL   27 (107)
T ss_pred             CEEcCCCCEEEEEEEecCCCCCeEEEE
Confidence            568999999999765331135578883


No 118
>PF14646 MYCBPAP:  MYCBP-associated protein family
Probab=48.68  E-value=63  Score=22.76  Aligned_cols=61  Identities=21%  Similarity=0.260  Sum_probs=35.9

Q ss_pred             cEEEecCCEEE--EE-EEeCCCCCCceEEeCCccccCCC-----------CCCCCCcccccccCCCCEEEEEEc---CCC
Q psy88             4 PKNVCEGDRVV--VD-VRNSMDGLENTIHWHGIHQRGTQ-----------YSDGVPFVTQCPITQGNTFRYQFT---ANA   66 (75)
Q Consensus         4 ~i~~~~Gd~v~--i~-~~N~~~~~~~~iH~HG~~~~~~~-----------~~DG~~~~~~~~i~pG~~~~y~~~---~~~   66 (75)
                      ++.+..|+.+.  |. |.|... ......|.=+......           ..|-.    .-.|.||++..+.|.   ..+
T Consensus       240 ~Fe~~p~e~~~~~v~~l~N~Gt-~~I~y~W~~~~~~~~~~~~~~~~~~~F~Fd~~----~gvilPGe~~~~~~~F~s~~~  314 (426)
T PF14646_consen  240 TFECHPGERVSKEVVRLENNGT-TAIYYSWRRVPFFKNFGSLFRAQDQRFYFDTS----SGVILPGETRNFPFMFKSRKV  314 (426)
T ss_pred             EEEcccCceeeEEEEEEecCCc-eEEEEEEEecccccccchhccccCCeEEEeCC----CCEECCCceEEEEEEEeCCCc
Confidence            44555665543  33 778876 5666677655442110           01111    223899999999887   678


Q ss_pred             eee
Q psy88            67 GTH   69 (75)
Q Consensus        67 Gt~   69 (75)
                      |.|
T Consensus       315 Gif  317 (426)
T PF14646_consen  315 GIF  317 (426)
T ss_pred             eEE
Confidence            865


No 119
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant.
Probab=48.48  E-value=74  Score=20.66  Aligned_cols=56  Identities=4%  Similarity=-0.044  Sum_probs=36.3

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      ..|++-.|..|++.++-..     .|  |++..+..   -+    .+ -.-||..-...|. +++|+|.-.|
T Consensus       139 nel~lP~g~pV~~~ltS~D-----Vi--HSF~VP~l---~~----K~-DaiPG~~n~~~~~~~~~G~y~g~C  195 (226)
T TIGR01433       139 NEIAFPVNTPINFKITSNS-----VM--NSFFIPQL---GS----QI-YAMAGMQTKLHLIANEPGVYDGIS  195 (226)
T ss_pred             ceEEEECCCEEEEEEEECc-----hh--hhhhhhhc---CC----ee-ecCCCceEEEEEEeCCCEEEEEEc
Confidence            4678888999998887763     22  44443321   11    11 1447888888888 9999987666


No 120
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=47.92  E-value=25  Score=18.86  Aligned_cols=16  Identities=31%  Similarity=0.376  Sum_probs=13.6

Q ss_pred             EecCCEEEEEEEeCCC
Q psy88             7 VCEGDRVVVDVRNSMD   22 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~   22 (75)
                      .+.||+|++.++.+-+
T Consensus         3 ~~~Ge~v~~~~~~~~~   18 (83)
T PF14326_consen    3 YRVGERVRFRVTSNRD   18 (83)
T ss_pred             ccCCCEEEEEEEeCCC
Confidence            5789999999998754


No 121
>PF04744 Monooxygenase_B:  Monooxygenase subunit B protein;  InterPro: IPR006833 Ammonia monooxygenase and the particulate methane monooxygenase are both integral membrane proteins, occurring in ammonia oxidisers and methanotrophs respectively, which are thought to be evolutionarily related []. These enzymes have a relatively wide substrate specificity and can catalyse the oxidation of a range of substrates including ammonia, methane, halogenated hydrocarbons and aromatic molecules []. These enzymes are composed of 3 subunits - A (IPR003393 from INTERPRO), B (IPR006833 from INTERPRO) and C (IPR006980 from INTERPRO) - and contain various metal centres, including copper. Particulate methane monooxygenase from Methylococcus capsulatus str. Bath is an ABC homotrimer, which contains mononuclear and dinuclear copper metal centres, and a third metal centre containing a metal ion whose identity in vivo is not certain[]. The soluble regions of these enzymes derive primarily from the B subunit. This subunit forms two antiparallel beta-barrel-like structures and contains the mono- and di- nuclear copper metal centres [].; PDB: 3CHX_E 3RFR_A 3RGB_A 1YEW_A.
Probab=47.35  E-value=18  Score=25.53  Aligned_cols=34  Identities=21%  Similarity=0.506  Sum_probs=18.9

Q ss_pred             CCCCCCcccccccCCCCEEEEEEc---CCCeeeEEcc
Q psy88            40 YSDGVPFVTQCPITQGNTFRYQFT---ANAGTHFWHA   73 (75)
Q Consensus        40 ~~DG~~~~~~~~i~pG~~~~y~~~---~~~Gt~~YH~   73 (75)
                      |..|.+...-..+..|+.+.|++.   ..||+|.-|.
T Consensus        71 ~ing~~~p~S~~le~G~~y~fki~lkar~pG~~hvh~  107 (381)
T PF04744_consen   71 WINGQPVPRSVSLELGGTYEFKIVLKARRPGTWHVHP  107 (381)
T ss_dssp             EETTEE-SS-B---TT-EEEEEEEEEE-S-EEEEEEE
T ss_pred             eecCccccceEEeecCCeeeEEEEEecccCcccccee
Confidence            345544333456889999999987   7899998875


No 122
>PF00207 A2M:  Alpha-2-macroglobulin family;  InterPro: IPR001599 This entry contains serum complement C3 and C4 precursors and alpha-macrogrobulins.  The alpha-macroglobulin (aM) family of proteins includes protease inhibitors [], typified by the human tetrameric a2-macroglobulin (a2M); they belong to the MEROPS proteinase inhibitor family I39, clan IL. These protease inhibitors share several defining properties, which include (i) the ability to inhibit proteases from all catalytic classes, (ii) the presence of a 'bait region' and a thiol ester, (iii) a similar protease inhibitory mechanism and (iv) the inactivation of the inhibitory capacity by reaction of the thiol ester with small primary amines. aM protease inhibitors inhibit by steric hindrance []. The mechanism involves protease cleavage of the bait region, a segment of the aM that is particularly susceptible to proteolytic cleavage, which initiates a conformational change such that the aM collapses about the protease. In the resulting aM-protease complex, the active site of the protease is sterically shielded, thus substantially decreasing access to protein substrates. Two additional events occur as a consequence of bait region cleavage, namely (i) the h-cysteinyl-g-glutamyl thiol ester becomes highly reactive and (ii) a major conformational change exposes a conserved COOH-terminal receptor binding domain [] (RBD). RBD exposure allows the aM protease complex to bind to clearance receptors and be removed from circulation []. Tetrameric, dimeric, and, more recently, monomeric aM protease inhibitors have been identified [, ].; GO: 0004866 endopeptidase inhibitor activity; PDB: 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 2PN5_A 3FRP_G 3HRZ_B ....
Probab=47.29  E-value=37  Score=18.43  Aligned_cols=19  Identities=32%  Similarity=0.600  Sum_probs=12.5

Q ss_pred             cEEEecCCEEEEEE--EeCCC
Q psy88             4 PKNVCEGDRVVVDV--RNSMD   22 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~--~N~~~   22 (75)
                      +-.+++||++.|.+  .|.++
T Consensus        63 P~~l~~GD~~~i~v~v~N~~~   83 (92)
T PF00207_consen   63 PRSLRRGDQIQIPVTVFNYTD   83 (92)
T ss_dssp             -SEEETTSEEEEEEEEEE-SS
T ss_pred             CcEEecCCEEEEEEEEEeCCC
Confidence            44678999887654  58876


No 123
>cd08067 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deubiquitinase. This family includes histone H2A deubiquitinase (Histone H2A DUB;MYSM1; myb-like, SWIRM and MPN domains 1; 2ADUB; 2A-DUB; KIAA19152ADUB, or KIAA1915/MYSM1), a member of JAMM/MPN+ deubiquitinases (DUBs), with possible Zn2+-dependent ubiquitin isopeptidase activity. It contains the SWIRM (Swi3p, Rsc8p and Moira), and SANT (SWI-SNF, ADA N-CoR, TFIIIB)/Myb domains; the SANT, but not the SWIRM, domain can bind directly to DNA. 2A-DUB is specific for monoubiquitinated H2A (uH2A), regulating transcription by coordinating histone acetylation and deubiquitination, and destabilizing the association of linker histone H1 with nucleosomes. 2A-DUB interacts with p/CAF (p300/CBP-associated factor) in a co-regulatory protein complex, where the status of acetylation of nucleosomal histones modulates its deubiquitinase activity. 2A-DUB is a positive regulator of androgen receptor (AR) transactivation activity on a reporter gene; it p
Probab=47.02  E-value=8.8  Score=24.23  Aligned_cols=7  Identities=29%  Similarity=0.928  Sum_probs=5.6

Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      =|||||.
T Consensus        83 GwYHSHP   89 (187)
T cd08067          83 GWYHSHP   89 (187)
T ss_pred             EEEecCC
Confidence            3999994


No 124
>PRK00794 flbT flagellar biosynthesis repressor FlbT; Reviewed
Probab=46.96  E-value=19  Score=21.66  Aligned_cols=29  Identities=17%  Similarity=0.320  Sum_probs=21.0

Q ss_pred             CcccEEEecCCEEEEE---EEeCCCCCCceEEeCC
Q psy88             1 MLYPKNVCEGDRVVVD---VRNSMDGLENTIHWHG   32 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~---~~N~~~~~~~~iH~HG   32 (75)
                      |++.|.+|.|+++.|.   +.|  + +..++-.-+
T Consensus         2 ~~Lkl~LKp~ERi~INGAVirn--d-rr~~l~i~n   33 (132)
T PRK00794          2 SGLKLSLKPGERIFINGAVLRN--D-RKVSLELLN   33 (132)
T ss_pred             CCeeEEecCCCEEEEcCeEEEe--C-CceEEEEec
Confidence            6889999999999884   667  4 455554433


No 125
>smart00207 TNF Tumour necrosis factor family. Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75  TNF receptor.
Probab=46.81  E-value=19  Score=20.83  Aligned_cols=16  Identities=31%  Similarity=0.445  Sum_probs=13.4

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .+++++||+|.|++.+
T Consensus        92 vf~L~~gD~L~v~v~~  107 (125)
T smart00207       92 LFPLTAGDRLSVNVTE  107 (125)
T ss_pred             EEEecCCCEEEEEeCC
Confidence            5688999999998764


No 126
>PF02221 E1_DerP2_DerF2:  ML domain;  InterPro: IPR003172  The MD-2-related lipid-recognition (ML) domain is implicated in lipid recognition, particularly in the recognition of pathogen related products. It has an immunoglobulin-like beta-sandwich fold similar to that of E-set Ig domains. This domain is present in the following proteins:  Epididymal secretory protein E1 (also known as Niemann-Pick C2 protein), which is known to bind cholesterol. Niemann-Pick disease type C2 is a fatal hereditary disease characterised by accumulation of low-density lipoprotein-derived cholesterol in lysosomes [].  House-dust mite allergen proteins such as Der f 2 from Dermatophagoides farinae and Der p 2 from Dermatophagoides pteronyssinus [].  ; PDB: 2AG9_B 1G13_B 2AG2_B 2AG4_A 1TJJ_C 1PU5_C 1PUB_A 2AF9_A 3T6Q_D 3M7O_B ....
Probab=45.82  E-value=16  Score=20.87  Aligned_cols=16  Identities=38%  Similarity=0.995  Sum_probs=13.3

Q ss_pred             cccccCCCCEEEEEEc
Q psy88            48 TQCPITQGNTFRYQFT   63 (75)
Q Consensus        48 ~~~~i~pG~~~~y~~~   63 (75)
                      ..||+.+|+.++|.+.
T Consensus        84 ~~CPi~~G~~~~~~~~   99 (134)
T PF02221_consen   84 LSCPIKAGEYYTYTYT   99 (134)
T ss_dssp             TTSTBTTTEEEEEEEE
T ss_pred             ccCccCCCcEEEEEEE
Confidence            3799999998887776


No 127
>cd08068 MPN_BRCC36 Mov34/MPN/PAD-1 family: BRCC36, a subunit of BRCA1-A complex. BRCC36 (BRCA1-A complex subunit BRCC36; BRCA1/BRCA2-containing complex subunit 36; BRCA1/BRCA2-containing complex subunit 3; BRCC3; BRISC complex subunit BRCC36; BRCC36 isopeptidase complex; Lys-63-specific deubiquitinase BRCC36) and BRCC36-like domains are members of JAMM/MPN+ deubiquitinases (DUBs),  possibly with Zn2+-dependent ubiquitin isopeptidase activity. BRCC36 is part of the BRCA1/BRCA2/BARD1-containing nuclear complex that displays an E3 ubiquitin ligase activity. It is targeted to DNA damage foci after irradiation; RAP80 recruits the Abraxas-BRCC36-BRCA1-BARD1 complex to DNA double strand breaks (DSBs) for DNA repair through specific recognition of Lys 63-linked polyubiquitinated proteins by its tandem ubiquitin-interacting motifs. A new protein, MERIT40 (mediator of RAP80 interactions and targeting 40 kDa), also named NBA1 (new component of the BRCA1 A complex), exists in the same BRCA1-contai
Probab=45.13  E-value=10  Score=25.05  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=6.1

Q ss_pred             eeEEccCC
Q psy88            68 THFWHAHT   75 (75)
Q Consensus        68 t~~YH~H~   75 (75)
                      .=|||||.
T Consensus        92 VGwYHSHP   99 (244)
T cd08068          92 VGWYHSHP   99 (244)
T ss_pred             EEEEecCC
Confidence            34999994


No 128
>smart00652 eIF1a eukaryotic translation initiation factor 1A.
Probab=44.78  E-value=26  Score=19.25  Aligned_cols=17  Identities=29%  Similarity=0.268  Sum_probs=14.1

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++++||.|.|.+...
T Consensus        41 ~iwI~~GD~VlVe~~~~   57 (83)
T smart00652       41 KVWIRRGDIVLVDPWDF   57 (83)
T ss_pred             cEEEcCCCEEEEEecCC
Confidence            58899999999987643


No 129
>COG4895 Uncharacterized conserved protein [Function unknown]
Probab=44.23  E-value=28  Score=17.99  Aligned_cols=37  Identities=24%  Similarity=0.247  Sum_probs=24.5

Q ss_pred             EecCCEEEEEEEeCCCC------------CCceEEeCCccccCCCCCCCCCc
Q psy88             7 VCEGDRVVVDVRNSMDG------------LENTIHWHGIHQRGTQYSDGVPF   46 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~~------------~~~~iH~HG~~~~~~~~~DG~~~   46 (75)
                      +++|-+|.|.++-.-..            ...+.|.||+....   .||.-+
T Consensus         9 I~~GL~VdIVlKqDQkTGKlTrGvVk~iLT~S~~HPHGIKVrL---~dGqvG   57 (63)
T COG4895           9 IRPGLTVDIVLKQDQKTGKLTRGVVKAILTRSPSHPHGIKVRL---TDGQVG   57 (63)
T ss_pred             cCCCcEEEEEEeccccCCcchhHHHHHHHhCCCCCCCceEEEe---ecCccc
Confidence            46788888887754321            13578999998764   477544


No 130
>PRK04012 translation initiation factor IF-1A; Provisional
Probab=44.05  E-value=26  Score=20.02  Aligned_cols=16  Identities=31%  Similarity=0.341  Sum_probs=13.4

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .|++++||.|.|.+.-
T Consensus        57 ~IwI~~GD~VlVe~~~   72 (100)
T PRK04012         57 RMWIREGDVVIVAPWD   72 (100)
T ss_pred             cEEecCCCEEEEEecc
Confidence            6899999999998643


No 131
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=43.69  E-value=14  Score=21.72  Aligned_cols=17  Identities=41%  Similarity=0.593  Sum_probs=12.8

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      ++.++.||.|+|.+...
T Consensus        49 ~~~~~~GD~V~v~i~~~   65 (135)
T PF04246_consen   49 PIGAKVGDRVEVEIPES   65 (135)
T ss_pred             CCCCCCCCEEEEEeccc
Confidence            45678899988887654


No 132
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
Probab=43.60  E-value=16  Score=20.54  Aligned_cols=15  Identities=20%  Similarity=0.113  Sum_probs=11.8

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      -+.++.||.|+|.=.
T Consensus        53 ~~~~k~GD~V~I~Et   67 (87)
T COG0186          53 CNEAKVGDIVRIAET   67 (87)
T ss_pred             cccCCCCCEEEEEEc
Confidence            467899999999644


No 133
>TIGR03396 PC_PLC phospholipase C, phosphocholine-specific, Pseudomonas-type. Members of this protein family are bacterial, phosphatidylcholine-hydrolyzing phospholipase C enzymes, with a characteristic domain architecture as found in hemolytyic (PlcH) and nonhemolytic (PlcN) secreted enzymes of Pseudomonas aeruginosa. PlcH hydrolyzes phosphatidylcholine to diacylglycerol and phosphocholine, but unlike PlcN can also hydrolyze sphingomyelin to ceramide ((N-acylsphingosine)) and phosphocholine. Members of this family share the twin-arginine signal sequence for Sec-independent transport across the plasma membrane. PlcH is secreted as a heterodimer with a small chaperone, PlcR, encoded immediately downstream.
Probab=42.34  E-value=1.6e+02  Score=22.66  Aligned_cols=46  Identities=11%  Similarity=0.190  Sum_probs=28.9

Q ss_pred             CCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc
Q psy88            10 GDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus        10 Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~   63 (75)
                      ...|+|+|.|... ....++.---.     ..++.+.  ..-|++|++.+..|.
T Consensus       604 ~G~L~L~L~N~G~-~a~~ftV~d~~-----Y~~~~pr--~ytV~aG~~~~~~w~  649 (690)
T TIGR03396       604 NGNLYLTLSNAGR-SPVTVTVTDNA-----YGGAGPR--TVTVAPGQRVELHWD  649 (690)
T ss_pred             CCEEEEEEEeCCC-CcEEEEEEeCC-----CCCCCCE--EEEECCCCEEEEEEe
Confidence            4469999999987 66666653211     1122231  234788999888887


No 134
>PF01176 eIF-1a:  Translation initiation factor 1A / IF-1;  InterPro: IPR006196  The S1 domain of around 70 amino acids, originally identified in ribosomal protein S1, is found in a large number of RNA-associated proteins. It has been shown that S1 proteins bind RNA through their S1 domains with some degree of sequence specificity. This type of S1 domain is found in translation initiation factor 1.  The solution structure of one S1 RNA-binding domain from Escherichia coli polynucleotide phosphorylase has been determined []. It displays some similarity with the cold shock domain (CSD) (IPR002059 from INTERPRO). Both the S1 and the CSD domain consist of an antiparallel beta barrel of the same topology with 5 beta strands. This fold is also shared by many other proteins of unrelated function and is known as the OB fold. However, the S1 and CSD fold can be distinguished from the other OB folds by the presence of a short 3(10) helix at the end of strand 3. This unique feature is likely to form a part of the DNA/RNA-binding site.  This entry is specific for bacterial, chloroplastic and eukaryotic IF-1 type S1 domains.; GO: 0003723 RNA binding, 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1JT8_A 3I4O_A 1AH9_A 1ZO1_W 1D7Q_A 2OQK_A 2DGY_A 1HR0_W.
Probab=41.82  E-value=17  Score=18.85  Aligned_cols=15  Identities=27%  Similarity=0.257  Sum_probs=9.9

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .|++++||.|.|.+.
T Consensus        39 ~iwI~~GD~V~V~~~   53 (65)
T PF01176_consen   39 RIWIKRGDFVLVEPS   53 (65)
T ss_dssp             CC---TTEEEEEEES
T ss_pred             eEecCCCCEEEEEec
Confidence            578899999999874


No 135
>PF14796 AP3B1_C:  Clathrin-adaptor complex-3 beta-1 subunit C-terminal
Probab=41.72  E-value=82  Score=19.24  Aligned_cols=47  Identities=13%  Similarity=0.155  Sum_probs=25.8

Q ss_pred             EEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcc---cccccCCCCEEEEEEc
Q psy88            12 RVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFV---TQCPITQGNTFRYQFT   63 (75)
Q Consensus        12 ~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~---~~~~i~pG~~~~y~~~   63 (75)
                      .|+++|.|..+..-..||.-.-..     .+|....   .-.-++||++.+..+-
T Consensus        88 sIql~ftN~s~~~i~~I~i~~k~l-----~~g~~i~~F~~I~~L~pg~s~t~~lg  137 (145)
T PF14796_consen   88 SIQLTFTNNSDEPIKNIHIGEKKL-----PAGMRIHEFPEIESLEPGASVTVSLG  137 (145)
T ss_pred             EEEEEEEecCCCeecceEECCCCC-----CCCcEeeccCcccccCCCCeEEEEEE
Confidence            478999999884444555422111     2232110   1123789999886653


No 136
>PF07705 CARDB:  CARDB;  InterPro: IPR011635 The APHP (acidic peptide-dependent hydrolases/peptidase) domain is found in a variety of different proteins.; PDB: 2KUT_A 2L0D_A 3IDU_A 2KL6_A.
Probab=41.28  E-value=25  Score=18.68  Aligned_cols=20  Identities=20%  Similarity=0.370  Sum_probs=14.4

Q ss_pred             ccCCCCEEEEEEc---CCCeeeE
Q psy88            51 PITQGNTFRYQFT---ANAGTHF   70 (75)
Q Consensus        51 ~i~pG~~~~y~~~---~~~Gt~~   70 (75)
                      .++||++.++.|.   ..+|.+-
T Consensus        56 ~L~~g~~~~v~~~~~~~~~G~~~   78 (101)
T PF07705_consen   56 SLAPGESETVTFTWTPPSPGSYT   78 (101)
T ss_dssp             EB-TTEEEEEEEEEE-SS-CEEE
T ss_pred             CcCCCcEEEEEEEEEeCCCCeEE
Confidence            5789999999988   5677664


No 137
>PF08234 Spindle_Spc25:  Chromosome segregation protein Spc25;  InterPro: IPR013255  This is a family of chromosome segregation proteins. It contains Spc25, which is a conserved eukaryotic kinetochore protein involved in cell division. In fungi the Spc25 protein is a subunit of the Nuf2-Ndc80 complex [], and in vertebrates it forms part of the Ndc80 complex []. ; PDB: 2VE7_B.
Probab=41.25  E-value=27  Score=18.53  Aligned_cols=18  Identities=17%  Similarity=0.100  Sum_probs=10.9

Q ss_pred             EEEecCCEEEEEEEeCCC
Q psy88             5 KNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~   22 (75)
                      |++..+|.+++.|.|-.+
T Consensus         1 ie~~~~d~lkf~F~~id~   18 (74)
T PF08234_consen    1 IEAIGGDQLKFVFTNIDP   18 (74)
T ss_dssp             EE--STT-EEEEE-S-BT
T ss_pred             CcccCCceEEEEEeEcCC
Confidence            677889999999998754


No 138
>cd00175 SNc Staphylococcal nuclease homologues. SNase homologues are found in bacteria, archaea, and eukaryotes. They contain no disufide bonds.
Probab=41.19  E-value=27  Score=19.85  Aligned_cols=65  Identities=18%  Similarity=0.226  Sum_probs=36.9

Q ss_pred             EEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCC----CC--CCccc-----ccccCCCCEEEEEEc--CCCeeeEEc
Q psy88             6 NVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYS----DG--VPFVT-----QCPITQGNTFRYQFT--ANAGTHFWH   72 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~----DG--~~~~~-----~~~i~pG~~~~y~~~--~~~Gt~~YH   72 (75)
                      ||--||+++|...+.   ....+-+-|+..+.....    ++  .+...     ......|...++.+.  +..|.+.-+
T Consensus         1 rV~dGDt~~v~~~~~---~~~~vrL~gId~Pe~~~~~~~~~~~~~~~g~~A~~~l~~~l~~~~V~i~~~~~d~~gr~la~   77 (129)
T cd00175           1 RVIDGDTIRVRLPPG---PLITVRLSGIDAPETARPNKGKSETDEPFGEEAKEFLKKLLLGKKVQVEVDSKDRYGRTLGT   77 (129)
T ss_pred             CeecCcEEEEEeCCC---CEEEEEEEeecCccccCCccCCCCCCCchHHHHHHHHHHHhCCCEEEEEEccCCCCCCEEEE
Confidence            466799999876655   356888899887643211    11  11100     001235677777666  566665544


Q ss_pred             c
Q psy88            73 A   73 (75)
Q Consensus        73 ~   73 (75)
                      |
T Consensus        78 v   78 (129)
T cd00175          78 V   78 (129)
T ss_pred             E
Confidence            3


No 139
>smart00737 ML Domain involved in innate immunity and lipid metabolism. ML (MD-2-related lipid-recognition) is a novel domain identified in MD-1, MD-2, GM2A, Npc2 and multiple proteins of unknown function in plants, animals and fungi. These single-domain proteins were predicted to form a beta-rich fold containing multiple strands, and to mediate diverse biological functions through interacting with specific lipids.
Probab=40.80  E-value=26  Score=19.79  Aligned_cols=15  Identities=40%  Similarity=0.946  Sum_probs=13.1

Q ss_pred             ccccCCCCEEEEEEc
Q psy88            49 QCPITQGNTFRYQFT   63 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~   63 (75)
                      .||+.+|+.++|...
T Consensus        71 ~CPl~~G~~~~~~~~   85 (118)
T smart00737       71 KCPIEKGETVNYTNS   85 (118)
T ss_pred             CCCCCCCeeEEEEEe
Confidence            699999999888765


No 140
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain. Both domains are members of the Oligonucleotide/oligosaccharide Binding (OB) fold.
Probab=40.78  E-value=41  Score=15.93  Aligned_cols=16  Identities=31%  Similarity=0.177  Sum_probs=13.2

Q ss_pred             EEecCCEEEEEEEeCC
Q psy88             6 NVCEGDRVVVDVRNSM   21 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~   21 (75)
                      .++.||.|++.+....
T Consensus        41 ~~~~G~~v~~~v~~~d   56 (65)
T cd00164          41 VFKVGDEVEVKVLEVD   56 (65)
T ss_pred             EeCCCCEEEEEEEEEc
Confidence            5789999999998653


No 141
>PF02563 Poly_export:  Polysaccharide biosynthesis/export protein;  InterPro: IPR003715 The extracellular polysaccharide colanic acid (CA) is produced by species of the family Enterobacteriaceae. In Escherichia coli (strain K12) the CA cluster comprises 19 genes. The wzx gene encodes a protein with multiple transmembrane segments that may function in export of the CA repeat unit from the cytoplasm into the periplasm in a process analogous to O-unit export. The CA gene clusters may be involved in the export of polysaccharide from the cell [].; GO: 0015159 polysaccharide transmembrane transporter activity, 0015774 polysaccharide transport, 0016020 membrane; PDB: 2W8I_E 2W8H_E 2J58_D.
Probab=40.35  E-value=25  Score=18.83  Aligned_cols=20  Identities=15%  Similarity=0.072  Sum_probs=10.3

Q ss_pred             ccEEEecCCEEEEEEEeCCC
Q psy88             3 YPKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~   22 (75)
                      ...++..||.++|.+.+..+
T Consensus         9 ~~y~l~pGD~l~i~v~~~~~   28 (82)
T PF02563_consen    9 PEYRLGPGDVLRISVFGWPE   28 (82)
T ss_dssp             ------TT-EEEEEETT-HH
T ss_pred             CCCEECCCCEEEEEEecCCC
Confidence            34678999999999987643


No 142
>PF04379 DUF525:  Protein of unknown function (DUF525);  InterPro: IPR007474 This domain is found in the bacterial protein ApaG and at the C termini of some F-box proteins (IPR001810 from INTERPRO). F-box proteins contain a carboxy-terminal domain that interacts with protein substrates []. The ApaG domain is ~125 amino acids in length, and is named after the bacterial ApaG protein, of which it forms the core. The Salmonella typhimurium ApaG domain protein, CorD, is involved in Co(2+) resistance and Mg(2+) efflux. Tertiary structures from different ApaG proteins show a fold of several beta-sheets. The ApaG domain may be involved in protein-protein interactions which could be implicated in substrate-specificity [, , ].; PDB: 2F1E_A 1XVS_A 1TZA_A 1XQ4_D.
Probab=39.93  E-value=17  Score=20.25  Aligned_cols=14  Identities=21%  Similarity=0.444  Sum_probs=9.4

Q ss_pred             cccCCCCEEEEEEc
Q psy88            50 CPITQGNTFRYQFT   63 (75)
Q Consensus        50 ~~i~pG~~~~y~~~   63 (75)
                      -.+.||++|.|.=-
T Consensus        57 P~L~pGe~f~Y~S~   70 (90)
T PF04379_consen   57 PVLAPGESFEYTSG   70 (90)
T ss_dssp             -EE-TTEEEEEEEE
T ss_pred             ceECCCCcEEEcCC
Confidence            34689999999744


No 143
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=39.57  E-value=21  Score=17.08  Aligned_cols=15  Identities=27%  Similarity=0.503  Sum_probs=11.7

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      .+++||.|.|...+.
T Consensus        20 ~l~~Gd~v~i~~~~~   34 (47)
T PF04014_consen   20 GLKPGDEVEIEVEGD   34 (47)
T ss_dssp             TSSTTTEEEEEEETT
T ss_pred             CCCCCCEEEEEEeCC
Confidence            357899999988764


No 144
>PF08496 Peptidase_S49_N:  Peptidase family S49 N-terminal;  InterPro: IPR013703 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found to the N terminus of bacterial signal peptidases that belong to the MEROPS peptidase family S49 (protease IV family, clan SK) (see also IPR002142 from INTERPRO) [, ]. ; GO: 0004252 serine-type endopeptidase activity, 0005886 plasma membrane
Probab=39.08  E-value=35  Score=20.98  Aligned_cols=24  Identities=21%  Similarity=0.297  Sum_probs=18.3

Q ss_pred             EEecCCEEEEEEEeCCCCCCceEEeCCc
Q psy88             6 NVCEGDRVVVDVRNSMDGLENTIHWHGI   33 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~~~~~~iH~HG~   33 (75)
                      .+++||+|.|++.....    .+|-.|+
T Consensus       127 ~a~~~DeV~~rLES~GG----~Vh~YGL  150 (155)
T PF08496_consen  127 VATPEDEVLVRLESPGG----MVHGYGL  150 (155)
T ss_pred             hCCCCCeEEEEEecCCc----eeeccch
Confidence            46889999999988755    5565665


No 145
>KOG1555|consensus
Probab=39.05  E-value=12  Score=25.75  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=6.0

Q ss_pred             eeEEccCC
Q psy88            68 THFWHAHT   75 (75)
Q Consensus        68 t~~YH~H~   75 (75)
                      .=|||||.
T Consensus       118 VGWYHSHP  125 (316)
T KOG1555|consen  118 VGWYHSHP  125 (316)
T ss_pred             EeeccCCC
Confidence            34999993


No 146
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=39.01  E-value=67  Score=17.50  Aligned_cols=29  Identities=17%  Similarity=0.314  Sum_probs=19.7

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+++|+.|.++=.-........++|
T Consensus         7 p~~~~v~~G~~v~L~C~~~~~~~~~~~~W   35 (106)
T cd04980           7 PATLSVSPGESATISCKASQSVSSNYLAW   35 (106)
T ss_pred             CCcEEECCCCCEEEEEEECCCCCCCcEEE
Confidence            34678999999999876432202456887


No 147
>PF11604 CusF_Ec:  Copper binding periplasmic protein CusF;  InterPro: IPR021647  CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil. CusF forms a five-stranded beta-barrel OB fold. Cu(I) binds to H36, M47 and M49 which are conserved residues in the protein []. ; PDB: 2L55_A 2VB3_X 1ZEQ_X 2QCP_X 3E6Z_X 2VB2_X.
Probab=38.95  E-value=28  Score=18.25  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=12.0

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      .++.||.|.+.|.-..+
T Consensus        42 ~l~~Gd~V~F~~~~~~~   58 (70)
T PF11604_consen   42 GLKPGDKVRFTFERTDD   58 (70)
T ss_dssp             S-STT-EEEEEEEEETT
T ss_pred             cCCCCCEEEEEEEECCC
Confidence            36789999999987654


No 148
>MTH00038 COX2 cytochrome c oxidase subunit II; Provisional
Probab=38.87  E-value=1.1e+02  Score=19.87  Aligned_cols=55  Identities=15%  Similarity=0.097  Sum_probs=33.9

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .+.+-.|..+++.++-..-     |  |+...+..    |.-   . -.-||..-...+. +++|+|.--|
T Consensus       141 ~lvlP~~~~v~~~~tS~DV-----i--Hsf~iP~l----g~k---~-daiPG~~~~~~~~~~~~G~~~g~C  196 (229)
T MTH00038        141 RLVLPYQTPIRVLVSSADV-----L--HSWAVPSL----GVK---M-DAVPGRLNQTTFFISRTGLFYGQC  196 (229)
T ss_pred             eEEEecCeEEEEEEEECCc-----c--cccccccc----Cce---e-ecCCCceEEEEEEcCCCEEEEEEc
Confidence            4566677777777665531     2  44433321    111   1 1448888888888 9999998777


No 149
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=38.65  E-value=67  Score=17.36  Aligned_cols=28  Identities=21%  Similarity=0.313  Sum_probs=21.0

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+.+|+.|.|.=.=... ....++|
T Consensus         5 ~~~v~~~~G~~v~L~C~~~~~-~~~~v~W   32 (109)
T cd04983           5 PQSLSVQEGENVTLNCNYSTS-TFYYLFW   32 (109)
T ss_pred             CCceEEcCCCCEEEEEEECCC-CccEEEE
Confidence            457889999999998764443 4668888


No 150
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=38.49  E-value=59  Score=17.92  Aligned_cols=24  Identities=13%  Similarity=0.205  Sum_probs=15.8

Q ss_pred             EEecCCEEEEEEEeCCCCCCceEEe
Q psy88             6 NVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      .+++|+.|+|.=.-... ....++|
T Consensus         2 ~v~~G~~vtL~C~~~~~-~~~~v~W   25 (104)
T cd05720           2 DAELGQKVELKCEVLNS-SPTGCSW   25 (104)
T ss_pred             cccCCCeEEEEEEecCC-CCCcEEE
Confidence            36889999997654332 3456777


No 151
>cd08961 GH64-TLP-SF glycoside hydrolase family 64 (beta-1,3-glucanases which produce specific pentasaccharide oligomers) and thaumatin-like proteins. This superfamily includes glycoside hydrolases of family 64 (GH64), these are mostly bacterial beta-1,3-glucanases which cleave long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers  and are implicated in fungal cell wall degradation. Also included in this superfamily are thaumatin, the sweet-tasting protein from the African berry Thaumatococcus daniellii, and thaumatin-like proteins (TLPs) which are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Like GH64s, some TLPs also hydrolyze the beta-1,3-glucans of the type commonly found in fungal walls. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. Several members of the plant TLP 
Probab=38.48  E-value=95  Score=19.05  Aligned_cols=21  Identities=14%  Similarity=0.328  Sum_probs=16.7

Q ss_pred             ccCCCCEEEEEEc-CCCeeeEE
Q psy88            51 PITQGNTFRYQFT-ANAGTHFW   71 (75)
Q Consensus        51 ~i~pG~~~~y~~~-~~~Gt~~Y   71 (75)
                      .+.||+++++.++ .-.|..|.
T Consensus        30 ~L~pG~s~si~vP~~wsGRIW~   51 (153)
T cd08961          30 GLAPGRSTTIQIPKGFSGRIWF   51 (153)
T ss_pred             ccCCCCcEEEEecCCceEEEEE
Confidence            4789999999988 66677774


No 152
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=38.10  E-value=65  Score=17.08  Aligned_cols=28  Identities=14%  Similarity=0.222  Sum_probs=19.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+++|+.+++.-.=... ..-.+.|
T Consensus         8 p~~v~v~~G~~v~L~C~v~G~-P~p~v~W   35 (92)
T cd05737           8 PDVVTIMEGKTLNLTCTVFGD-PDPEVSW   35 (92)
T ss_pred             CceEEEeCCCcEEEEEEEEec-CCCeEEE
Confidence            345789999999988764433 2336777


No 153
>PF01954 DUF104:  Protein of unknown function DUF104;  InterPro: IPR008203 This family includes short archaebacterial proteins of unknown function. Archaeoglobus fulgidus has twelve copies of this protein, with several being clustered together in the genome.; PDB: 2NWT_A.
Probab=37.95  E-value=21  Score=18.50  Aligned_cols=19  Identities=26%  Similarity=0.541  Sum_probs=9.6

Q ss_pred             cccEEEecCCEEEEEEEeC
Q psy88             2 LYPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~   20 (75)
                      +-++.+.+|+.|+|.+...
T Consensus        17 l~~~~L~Eg~~V~i~I~~~   35 (60)
T PF01954_consen   17 LEPVDLPEGEEVKITIEEE   35 (60)
T ss_dssp             CS-----TTEEEEEEE---
T ss_pred             CCCCCCCCCCEEEEEEecc
Confidence            4567789999999999875


No 154
>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain. RNAPII is composed of 12 subunits (Rpb1-12). Rpb4 and Rpb7 form a heterodimer that associate with the RNAPII core. Rpb7 is a homolog of the Rpc25 of RNA polymerase III, RpoE of the archaeal RNA polymerase, and Rpa43 of eukaryotic RNA polymerase I. Rpb7 has two domains, an N-terminal ribonucleoprotein (RNP) domain and a C-terminal S1 domain, both of which bind single-stranded RNA. It is possible that the S1 domain interacts with the nascent RNA transcript, assisted by the RNP domain. In yeast, Rpb4/Rpb7 is necessary for promoter-directed transcription initiation. They also play a role in regulating transcription-coupled repair in the Rad26-dependent pathway, in efficient mRNA export, and in transcription termination.
Probab=37.83  E-value=53  Score=18.01  Aligned_cols=18  Identities=6%  Similarity=0.032  Sum_probs=14.9

Q ss_pred             cEEEecCCEEEEEEEeCC
Q psy88             4 PKNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~   21 (75)
                      .+.++.||.||+++....
T Consensus        53 ~~~i~~g~~VR~rV~~v~   70 (88)
T cd04462          53 DIVIKKDTEVRLKIIGTR   70 (88)
T ss_pred             cEEECCCCEEEEEEEEEE
Confidence            467899999999987653


No 155
>PF12988 DUF3872:  Domain of unknown function, B. Theta Gene description (DUF3872);  InterPro: IPR024355 This entry represents proteins of unknown function found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene coding for this protein is located in a conjugate transposon and appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].; PDB: 2L3B_A 2L7Q_A.
Probab=37.81  E-value=15  Score=22.35  Aligned_cols=18  Identities=28%  Similarity=0.516  Sum_probs=10.3

Q ss_pred             CcccEEEecCCEEEEEEE
Q psy88             1 MLYPKNVCEGDRVVVDVR   18 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~i~~~   18 (75)
                      |+.+=++.+|++|+|++.
T Consensus        38 mPVpk~I~~GeTvEIR~~   55 (137)
T PF12988_consen   38 MPVPKKIKKGETVEIRCE   55 (137)
T ss_dssp             ----SS--TTEEEEEEEE
T ss_pred             eccccccCCCCEEEEEEE
Confidence            445557789999999876


No 156
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=37.58  E-value=19  Score=19.47  Aligned_cols=15  Identities=13%  Similarity=0.271  Sum_probs=11.5

Q ss_pred             EEEecCCEEEEEEEe
Q psy88             5 KNVCEGDRVVVDVRN   19 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N   19 (75)
                      +.++.||+++|.+--
T Consensus        51 m~L~PGdEFeI~Lgr   65 (71)
T PF14250_consen   51 MGLKPGDEFEIKLGR   65 (71)
T ss_pred             hCCCCCCEEEEEeCc
Confidence            457899999998643


No 157
>PF00229 TNF:  TNF(Tumour Necrosis Factor) family ;  InterPro: IPR006052 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  The following cytokines can be grouped into a family on the basis of sequence, functional, and structural similarities [, , ]:   Tumor Necrosis Factor (TNF) (also known as cachectin or TNF-alpha) [, ] is a cytokine which has a wide variety of functions. It can cause cytolysis of certain tumor cell lines; it is involved in the induction of cachexia; it is a potent pyrogen, causing fever by direct action or by stimulation of interleukin-1 secretion; finally, it can stimulate cell proliferation and induce cell differentiation under certain conditions. Lymphotoxin-alpha (LT-alpha) and lymphotoxin-beta (LT-beta), two related cytokines produced by lymphocytes and which are cytotoxic for a wide range of tumor cells in vitro and in vivo [].   T cell antigen gp39 (CD40L), a cytokine which seems to be important in B-cell development and activation. CD27L, a cytokine which plays a role in T-cell activation. It induces the proliferation of costimulated T cells and enhances the generation of cytolytic T cells.   CD30L, a cytokine which induces proliferation of T cells.  FASL, a cytokine involved in cell death [].  4-1BBL, a inducible T cell surface molecule that contributes to T-cell stimulation.  OX40L, a cytokine that co-stimulates T cell proliferation and cytokine production [].  TNF-related apoptosis inducing ligand (TRAIL), a cytokine that induces apoptosis [].  TNF-alpha is synthesised as a type II membrane protein which then undergoes post-translational cleavage liberating the extracellular domain. CD27L, CD30L, CD40L, FASL, LT-beta, 4-1BBL and TRAIL also appear to be type II membrane proteins. LT-alpha is a secreted protein.   All these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors. The PROSITE pattern for this family is located in a beta-strand in the central section of the protein which is conserved across all members.; GO: 0005164 tumor necrosis factor receptor binding, 0006955 immune response, 0016020 membrane; PDB: 3QBQ_C 1IQA_B 1S55_C 1JTZ_Z 3ME2_A 3QD6_C 3LKJ_B 1I9R_A 1ALY_A 2X29_A ....
Probab=37.34  E-value=22  Score=20.35  Aligned_cols=15  Identities=33%  Similarity=0.415  Sum_probs=12.7

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .+++++||+|.|++.
T Consensus        93 v~~L~~gd~l~v~v~  107 (127)
T PF00229_consen   93 VFHLQAGDRLSVRVS  107 (127)
T ss_dssp             EEEECTTEEEEEEES
T ss_pred             eEEcCCCCEEEEEEC
Confidence            468999999999965


No 158
>PF03658 Ub-RnfH:  RnfH family Ubiquitin;  InterPro: IPR005346 This is a small family of proteins of unknown function.; PDB: 2HJ1_B.
Probab=37.13  E-value=22  Score=19.78  Aligned_cols=11  Identities=36%  Similarity=0.543  Sum_probs=6.7

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .+++||+|+|.
T Consensus        61 ~L~~GDRVEIY   71 (84)
T PF03658_consen   61 VLRDGDRVEIY   71 (84)
T ss_dssp             B--TT-EEEEE
T ss_pred             cCCCCCEEEEe
Confidence            46899999985


No 159
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation.
Probab=36.40  E-value=36  Score=18.03  Aligned_cols=15  Identities=27%  Similarity=0.505  Sum_probs=12.1

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      .+..||.+.|.+.|.
T Consensus        56 ~a~aGd~v~i~l~~~   70 (83)
T cd03696          56 EAKAGDRVALNLTGV   70 (83)
T ss_pred             EEcCCCEEEEEEcCC
Confidence            477899999998764


No 160
>COG5004 P2-like prophage tail protein X [General function prediction only]
Probab=36.31  E-value=13  Score=19.81  Aligned_cols=14  Identities=29%  Similarity=0.228  Sum_probs=10.1

Q ss_pred             CcccEEEecCCEEE
Q psy88             1 MLYPKNVCEGDRVV   14 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~   14 (75)
                      |++..|..+||+|.
T Consensus         1 ~~~~~Rt~~gDtvD   14 (70)
T COG5004           1 SLMIVRTRQGDTVD   14 (70)
T ss_pred             CceEEEeccCchHH
Confidence            56777888888753


No 161
>TIGR03635 S17_bact 30S ribosomal protein S17. This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17.
Probab=36.23  E-value=23  Score=18.90  Aligned_cols=11  Identities=27%  Similarity=0.190  Sum_probs=9.3

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .+++||.|+|.
T Consensus        48 ~~k~GD~V~I~   58 (71)
T TIGR03635        48 ECKVGDVVRII   58 (71)
T ss_pred             CCCCCCEEEEE
Confidence            47899999986


No 162
>PF04151 PPC:  Bacterial pre-peptidase C-terminal domain;  InterPro: IPR007280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  This domain is normally found at the C terminus of secreted archaeal and bacterial peptidases, the majority of which belong to MEROPS peptidase families M4 (vibriolysin, IPR001570 from INTERPRO), M9A amd M9B (microbial collangenase, IPR002169 from INTERPRO), M28 (aminopeptidase Ap1, IPR007484 from INTERPRO) and S8 (subtilisin family peptidases, IPR000209 from INTERPRO).; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 4DY5_B 4DXZ_A 4DY3_B 3JQW_A 3JQX_C 1NQJ_B 1NQD_A 2O8O_A 1WMF_A 1WME_A ....
Probab=36.10  E-value=64  Score=16.39  Aligned_cols=18  Identities=17%  Similarity=0.279  Sum_probs=15.8

Q ss_pred             cEEEecCCEEEEEEEeCC
Q psy88             4 PKNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~   21 (75)
                      .+.+++|++++|.+.+..
T Consensus         6 ~f~v~ag~~l~i~l~~~~   23 (70)
T PF04151_consen    6 SFTVPAGGTLTIDLSGGS   23 (70)
T ss_dssp             EEEESTTEEEEEEECETT
T ss_pred             EEEEcCCCEEEEEEcCCC
Confidence            578999999999998876


No 163
>PF00868 Transglut_N:  Transglutaminase family;  InterPro: IPR001102 Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase Protein-glutamine gamma-glutamyltransferases (2.3.2.13 from EC) (TGase) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [, ]. Transglutaminases are widely distributed in various organs, tissues and body fluids. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. There are commonly three domains: N-terminal, middle (IPR013808 from INTERPRO) and C-terminal (IPR013807 from INTERPRO). This entry represents the N-terminal domain found in transglutaminases.; GO: 0018149 peptide cross-linking; PDB: 1L9N_B 1NUF_A 1NUD_A 1NUG_B 1L9M_A 1KV3_C 3S3S_A 2Q3Z_A 3LY6_A 3S3P_A ....
Probab=36.04  E-value=56  Score=18.91  Aligned_cols=16  Identities=19%  Similarity=0.202  Sum_probs=13.6

Q ss_pred             ccEEEecCCEEEEEEE
Q psy88             3 YPKNVCEGDRVVVDVR   18 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~   18 (75)
                      ..|.+++|+.+.|.+.
T Consensus        25 ~~LVVRRGQ~F~i~l~   40 (118)
T PF00868_consen   25 PRLVVRRGQPFTITLR   40 (118)
T ss_dssp             SSEEEETTSEEEEEEE
T ss_pred             CCEEEECCCEEEEEEE
Confidence            3588999999998887


No 164
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=35.80  E-value=67  Score=16.51  Aligned_cols=28  Identities=25%  Similarity=0.356  Sum_probs=19.1

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+++|+.+.+...=... ....+.|
T Consensus         7 ~~~~~v~~G~~~~l~c~~~~~-p~~~v~W   34 (90)
T PF07679_consen    7 PKDVTVKEGESVTLECEVSGN-PPPTVTW   34 (90)
T ss_dssp             SSEEEEETTSEEEEEEEEEES-SSSEEEE
T ss_pred             cCCEEEeCCCEEEEEEEEEeC-CCCcccc
Confidence            356789999999988764432 2446666


No 165
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=35.67  E-value=53  Score=16.61  Aligned_cols=16  Identities=25%  Similarity=0.131  Sum_probs=12.9

Q ss_pred             EEecCCEEEEEEEeCC
Q psy88             6 NVCEGDRVVVDVRNSM   21 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~   21 (75)
                      .++.||.|++.+.+-.
T Consensus        47 ~~~~Gd~v~v~i~~vd   62 (77)
T cd05708          47 LFRVGDKVRAKVLKID   62 (77)
T ss_pred             eecCCCEEEEEEEEEe
Confidence            4689999999988754


No 166
>smart00232 JAB_MPN JAB/MPN domain. Domain in Jun kinase activation domain binding protein and proteasomal subunits. Domain at Mpr1p and Pad1p N-termini. Domain of unknown function.
Probab=35.65  E-value=19  Score=20.48  Aligned_cols=7  Identities=29%  Similarity=0.928  Sum_probs=5.4

Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      =|||+|.
T Consensus        80 Gwyhshp   86 (135)
T smart00232       80 GWYHSHP   86 (135)
T ss_pred             EEEEcCC
Confidence            4999984


No 167
>PTZ00047 cytochrome c oxidase subunit II; Provisional
Probab=35.45  E-value=1.1e+02  Score=19.06  Aligned_cols=23  Identities=9%  Similarity=0.153  Sum_probs=18.3

Q ss_pred             cCCCCEEEEEEc-CCCeeeEEccC
Q psy88            52 ITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus        52 i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      +-||..-...+. +.+|+|.-.|.
T Consensus       107 avPGr~n~l~~~~~~~G~y~gqCs  130 (162)
T PTZ00047        107 AIPGRLHKINTFILREGVFYGQCS  130 (162)
T ss_pred             ccCCceEEEEEecCCCeEEEEEcc
Confidence            457888788787 89999988774


No 168
>cd00184 TNF Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.
Probab=35.37  E-value=35  Score=19.97  Aligned_cols=16  Identities=31%  Similarity=0.418  Sum_probs=13.2

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .+++++||+|.|.+.+
T Consensus       106 vf~L~~gd~l~v~v~~  121 (137)
T cd00184         106 LFQLRAGDRLSVNVSA  121 (137)
T ss_pred             EEEecCCCEEEEEeCC
Confidence            4688999999998863


No 169
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=35.06  E-value=79  Score=17.15  Aligned_cols=28  Identities=18%  Similarity=0.351  Sum_probs=20.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      ++.+.+.+|+.+.++=.=... ....+.|
T Consensus         4 ~~~v~v~eG~~v~L~C~~~~~-p~~~v~W   31 (95)
T cd07701           4 TQNVTVVEGGTANLTCRVDQN-DNTSLQW   31 (95)
T ss_pred             cceEEEecCCcEEEEEEEecC-CceEEEE
Confidence            356889999999998754433 3456888


No 170
>CHL00084 rpl19 ribosomal protein L19
Probab=35.02  E-value=34  Score=20.21  Aligned_cols=16  Identities=31%  Similarity=0.295  Sum_probs=12.7

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      -.++.||+|+|.+.-.
T Consensus        21 p~f~~GDtV~V~~~i~   36 (117)
T CHL00084         21 PKIRVGDTVKVGVLIQ   36 (117)
T ss_pred             CccCCCCEEEEEEEEe
Confidence            3678999999999654


No 171
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=34.98  E-value=25  Score=17.80  Aligned_cols=13  Identities=31%  Similarity=0.371  Sum_probs=9.6

Q ss_pred             cEEEecCCEEEEE
Q psy88             4 PKNVCEGDRVVVD   16 (75)
Q Consensus         4 ~i~~~~Gd~v~i~   16 (75)
                      ...+++||+|+|-
T Consensus        48 ~~~l~~gD~vei~   60 (66)
T PRK05659         48 STALREGDVVEIV   60 (66)
T ss_pred             cccCCCCCEEEEE
Confidence            3457889998874


No 172
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=34.76  E-value=30  Score=14.10  Aligned_cols=10  Identities=40%  Similarity=0.245  Sum_probs=6.9

Q ss_pred             EecCCEEEEE
Q psy88             7 VCEGDRVVVD   16 (75)
Q Consensus         7 ~~~Gd~v~i~   16 (75)
                      +++||.|+|.
T Consensus         2 ~~~G~~V~I~   11 (28)
T smart00739        2 FEVGDTVRVI   11 (28)
T ss_pred             CCCCCEEEEe
Confidence            3578887775


No 173
>COG1310 Predicted metal-dependent protease of the PAD1/JAB1 superfamily [General function prediction only]
Probab=34.69  E-value=18  Score=21.11  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=6.0

Q ss_pred             eeEEccCC
Q psy88            68 THFWHAHT   75 (75)
Q Consensus        68 t~~YH~H~   75 (75)
                      .-|||||.
T Consensus        72 vg~yHSHP   79 (134)
T COG1310          72 VGWYHSHP   79 (134)
T ss_pred             EEEEcCCC
Confidence            45899984


No 174
>TIGR01451 B_ant_repeat conserved repeat domain. This model represents the conserved region of about 53 amino acids shared between regions, usually repeated, of proteins from a small number of phylogenetically distant prokaryotes. Examples include a 132-residue region found repeated in three of the five longest proteins of Bacillus anthracis, a 131-residue repeat in a cell wall-anchored protein of Enterococcus faecalis, and a 120-residue repeat in Methanobacterium thermoautotrophicum. A similar region is found in some Chlamydial outer membrane proteins.
Probab=34.62  E-value=35  Score=16.86  Aligned_cols=17  Identities=41%  Similarity=0.675  Sum_probs=13.6

Q ss_pred             cCCCCEEEEEEc-CCCee
Q psy88            52 ITQGNTFRYQFT-ANAGT   68 (75)
Q Consensus        52 i~pG~~~~y~~~-~~~Gt   68 (75)
                      +.||+..+|.+. .+.|.
T Consensus         8 ~~~Gd~v~Yti~v~N~g~   25 (53)
T TIGR01451         8 ATIGDTITYTITVTNNGN   25 (53)
T ss_pred             cCCCCEEEEEEEEEECCC
Confidence            689999999998 55553


No 175
>TIGR01024 rplS_bact ribosomal protein L19, bacterial type. This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs.
Probab=34.30  E-value=39  Score=19.80  Aligned_cols=17  Identities=29%  Similarity=0.280  Sum_probs=13.9

Q ss_pred             EEEecCCEEEEEEEeCC
Q psy88             5 KNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~   21 (75)
                      -.++.||+|.|.+....
T Consensus        17 p~f~~GD~v~V~~~i~e   33 (113)
T TIGR01024        17 PDFRVGDTVRVHVKIVE   33 (113)
T ss_pred             CccCCCCEEEEEEEEcc
Confidence            35789999999998754


No 176
>PF03459 TOBE:  TOBE domain;  InterPro: IPR005116  The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner. It is probably involved in the recognition of small ligands such as molybdenum (P46930 from SWISSPROT) and sulphate (P16676 from SWISSPROT), and is found in ABC transporters immediately after the ATPase domain.; GO: 0005215 transporter activity, 0005524 ATP binding, 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0006810 transport, 0043190 ATP-binding cassette (ABC) transporter complex; PDB: 1G29_2 1H9M_B 1H9J_A 1H9K_A 1H9R_B 1O7L_C 1H9S_A 1B9N_A 1B9M_A 1GUS_C ....
Probab=34.00  E-value=19  Score=17.93  Aligned_cols=14  Identities=21%  Similarity=0.453  Sum_probs=8.2

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      .+++||+|.+.++-
T Consensus        46 ~L~~G~~V~~~ik~   59 (64)
T PF03459_consen   46 GLKPGDEVYASIKA   59 (64)
T ss_dssp             T-STT-EEEEEE-G
T ss_pred             CCCCCCEEEEEEeh
Confidence            45688998887753


No 177
>PF14874 PapD-like:  Flagellar-associated PapD-like
Probab=33.50  E-value=84  Score=16.99  Aligned_cols=46  Identities=11%  Similarity=0.104  Sum_probs=26.7

Q ss_pred             EEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcc--cccccCCCCEEEEEEc
Q psy88            12 RVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFV--TQCPITQGNTFRYQFT   63 (75)
Q Consensus        12 ~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~--~~~~i~pG~~~~y~~~   63 (75)
                      ...|.++|... .+..+++.-..   .  .+..-.+  ....++||++.+....
T Consensus        23 ~~~v~l~N~s~-~p~~f~v~~~~---~--~~~~~~v~~~~g~l~PG~~~~~~V~   70 (102)
T PF14874_consen   23 SRTVTLTNTSS-IPARFRVRQPE---S--LSSFFSVEPPSGFLAPGESVELEVT   70 (102)
T ss_pred             EEEEEEEECCC-CCEEEEEEeCC---c--CCCCEEEECCCCEECCCCEEEEEEE
Confidence            45688889987 67666653211   0  0110000  1224899999998877


No 178
>PF07385 DUF1498:  Protein of unknown function (DUF1498);  InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length. The function of this family is unknown.; PDB: 3MPB_B 3KMH_A.
Probab=33.50  E-value=1.1e+02  Score=20.16  Aligned_cols=50  Identities=22%  Similarity=0.258  Sum_probs=23.3

Q ss_pred             EEEecCCEEEEEEEeCCCC------CCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEE
Q psy88             5 KNVCEGDRVVVDVRNSMDG------LENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQ   61 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~~------~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~   61 (75)
                      |.-+-|-++.|+|.|..+.      .+.++..-|.....       +.-++..+.||||.|..
T Consensus       112 IINRGGG~L~i~l~~s~~~~~~~~~~~v~V~~DG~~~t~-------~aG~~l~L~PGESiTL~  167 (225)
T PF07385_consen  112 IINRGGGNLVIELYNSDPDGELDADTDVTVPVDGIRRTV-------PAGTQLRLNPGESITLP  167 (225)
T ss_dssp             EEEEEES-EEEEEEEB--TTSSB-SS-EEEEETTEEEEE--------TT-EEEE-TT-EEEE-
T ss_pred             eeecCCceEEEEEEeccCCCccccCCCeEEecCCcEEEe-------cCCceEEeCCCCeEeeC
Confidence            4445568899999997531      23344444433221       11124457889988753


No 179
>KOG4680|consensus
Probab=33.49  E-value=43  Score=20.61  Aligned_cols=23  Identities=22%  Similarity=0.550  Sum_probs=15.3

Q ss_pred             cccccCCCCEE---EEEEc--CCCeeeE
Q psy88            48 TQCPITQGNTF---RYQFT--ANAGTHF   70 (75)
Q Consensus        48 ~~~~i~pG~~~---~y~~~--~~~Gt~~   70 (75)
                      +.|||+||+--   +..++  -+||+|.
T Consensus        95 tsCPVepG~f~~~hsq~LPg~tPPG~Y~  122 (153)
T KOG4680|consen   95 TSCPVEPGDFLVAHSQVLPGYTPPGSYV  122 (153)
T ss_pred             ccCCcCcCceeeeeeEeccCcCCCceEE
Confidence            36899998743   44444  5788774


No 180
>cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+) domains are found in the N-terminal termini of proteins with a variety of functions; they are components of the proteasome regulatory subunits, the signalosome (CSN), eukaryotic translation initiation factor 3 (eIF3) complexes, and regulators of transcription factors.  These domains are isopeptidases that release ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation. Catalytically active MPN domains contain a metalloprotease signature known as the JAB1/MPN/Mov34 metalloenzyme (JAMM) motif. For example, Rpn11 (also known as POH1 or PSMD14), a subunit of the 19S proteasome lid is involved in the ATP-dependent degradation of ubiquitinated proteins, contains the conserved JAMM motif involved in zinc ion coordination. Poh1 is a regulator of c-Jun, an important regulator of cell proliferation, differentiation, survival and death. J
Probab=33.30  E-value=21  Score=19.72  Aligned_cols=7  Identities=29%  Similarity=0.904  Sum_probs=5.1

Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      =|||+|.
T Consensus        67 Gwyhshp   73 (116)
T cd07767          67 GWYHTHP   73 (116)
T ss_pred             EEEEcCC
Confidence            4888883


No 181
>COG4013 Uncharacterized protein conserved in archaea [Function unknown]
Probab=33.22  E-value=32  Score=19.30  Aligned_cols=13  Identities=31%  Similarity=0.215  Sum_probs=10.5

Q ss_pred             EEecCCEEEEEEE
Q psy88             6 NVCEGDRVVVDVR   18 (75)
Q Consensus         6 ~~~~Gd~v~i~~~   18 (75)
                      ++++||+|++.+-
T Consensus        20 eV~~gd~vel~~g   32 (91)
T COG4013          20 EVDVGDYVELYFG   32 (91)
T ss_pred             cCCCCCEEEEEEE
Confidence            4789999999764


No 182
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=32.96  E-value=59  Score=18.60  Aligned_cols=24  Identities=17%  Similarity=0.181  Sum_probs=16.8

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeCCc
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGI   33 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~   33 (75)
                      .+..++++||.+.+        .+-..||++.
T Consensus        81 g~~~~l~~Gd~i~i--------p~g~~H~~~a  104 (131)
T COG1917          81 GEKKELKAGDVIII--------PPGVVHGLKA  104 (131)
T ss_pred             CCceEecCCCEEEE--------CCCCeeeecc
Confidence            35677888888887        3557777664


No 183
>PF00018 SH3_1:  SH3 domain;  InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. The crystal structure of the SH3 domain of the cytoskeletal protein spectrin, and the solution structures of SH3 domains of phospholipase C (PLC-y) and phosphatidylinositol 3-kinase p85 alpha-subunit, have been determined [, , ]. In spite of relatively limited sequence similarity, their overall structures are similar. The domains belong to the alpha+beta structural class, with 5 to 8 beta-strands forming 2 tightly-packed, anti-parallel beta-sheets arranged in a barrel-like structure, and intervening loops sometimes forming helices. Conserved aliphatic and aromatic residues form a hydrophobic core (A11, L23, A29, V34, W42, L52 and V59 in PLC-y []) and a hydrophobic pocket on the molecular surface (L12, F13, W53 and P55 in PLC-y). The conserved core is believed to stabilise the fold, while the pocket is thought to serve as a binding site for target proteins. Conserved carboxylic amino acids located in the loops, on the periphery of the pocket (D14 and E22), may be involved in protein-protein interactions via proline-rich regions. The N- and C-termini are packed in close proximity, indicating that they are independent structural modules.; GO: 0005515 protein binding; PDB: 1UHF_A 1W1F_A 1WA7_A 1SEM_A 1KFZ_A 2SEM_B 1K76_A 3SEM_B 1X2Q_A 2J06_B ....
Probab=32.91  E-value=19  Score=17.09  Aligned_cols=14  Identities=21%  Similarity=0.086  Sum_probs=10.0

Q ss_pred             ccEEEecCCEEEEE
Q psy88             3 YPKNVCEGDRVVVD   16 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~   16 (75)
                      ..|.+++||.+.|.
T Consensus        12 ~eLs~~~Gd~i~v~   25 (48)
T PF00018_consen   12 DELSFKKGDIIEVL   25 (48)
T ss_dssp             TBSEB-TTEEEEEE
T ss_pred             CEEeEECCCEEEEE
Confidence            35778999998874


No 184
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  
Probab=32.83  E-value=43  Score=17.80  Aligned_cols=14  Identities=14%  Similarity=0.404  Sum_probs=11.3

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      ++..||.+.+.++|
T Consensus        56 ~a~aGd~v~~~l~~   69 (83)
T cd03698          56 YAVAGENVRLKLKG   69 (83)
T ss_pred             EECCCCEEEEEECC
Confidence            47789999988876


No 185
>cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associated molecule with the Src homology 3 domain (SH3) of STAM (signal-transducing adapter molecule, also known as STAMBP)) and AMSH-like proteins (AMSH-LP) are members of JAMM/MPN+ deubiquitinases (DUBs), with Zn2+-dependent ubiquitin isopeptidase activity. AMSH specifically cleaves Lys 63 and not Lys48-linked polyubiquitin (poly-Ub) chains, thus facilitating the recycling and subsequent trafficking of receptors to the cell surface. AMSH and AMSH-LP are anchored on the early endosomal membrane via interaction with the clathrin coat. AMSH shares a common SH3-binding site with another endosomal DUB, UBPY (ubiquitin-specific protease Y; also known as USP8), the latter being a cysteine protease that does not discriminate between Lys48 and Lys63-linked ubiquitin.  AMSH is involved in the degradation of EGF receptor (EGFR) and possibly other ubiquitinated endocytosed proteins. AMSH also interacts with CHMP1, CHMP2, and CHMP3 proteins, al
Probab=32.79  E-value=21  Score=22.19  Aligned_cols=7  Identities=29%  Similarity=0.624  Sum_probs=5.6

Q ss_pred             eEEccCC
Q psy88            69 HFWHAHT   75 (75)
Q Consensus        69 ~~YH~H~   75 (75)
                      =|||+|.
T Consensus        79 GwyHSHP   85 (173)
T cd08066          79 GWIHTHP   85 (173)
T ss_pred             EEEeccC
Confidence            4999994


No 186
>PRK11347 antitoxin ChpS; Provisional
Probab=32.68  E-value=33  Score=18.82  Aligned_cols=16  Identities=31%  Similarity=0.383  Sum_probs=13.1

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      +.++.||+|.|.+.+.
T Consensus        24 l~l~~G~~v~i~v~~~   39 (83)
T PRK11347         24 LNLQPGQSVEAQVSNN   39 (83)
T ss_pred             cCCCCCCEEEEEEECC
Confidence            5577899999998875


No 187
>PRK12281 rplX 50S ribosomal protein L24; Reviewed
Probab=32.65  E-value=30  Score=18.72  Aligned_cols=13  Identities=38%  Similarity=0.297  Sum_probs=10.1

Q ss_pred             EEEecCCEEEEEE
Q psy88             5 KNVCEGDRVVVDV   17 (75)
Q Consensus         5 i~~~~Gd~v~i~~   17 (75)
                      +.++.||+|.|--
T Consensus         5 ~~I~kGD~V~Vi~   17 (76)
T PRK12281          5 LKVKKGDMVKVIA   17 (76)
T ss_pred             ccccCCCEEEEeE
Confidence            5788999988754


No 188
>TIGR03000 plancto_dom_1 Planctomycetes uncharacterized domain TIGR03000. Domains described by this model are found, so far, only in the Planctomycetes (Pirellula sp. strain 1 and Gemmata obscuriglobus), in up to six proteins per genome, and may be duplicated within a protein. The function is unknown.
Probab=32.62  E-value=50  Score=18.02  Aligned_cols=16  Identities=31%  Similarity=0.681  Sum_probs=13.6

Q ss_pred             cccccCCCCEEEEEEc
Q psy88            48 TQCPITQGNTFRYQFT   63 (75)
Q Consensus        48 ~~~~i~pG~~~~y~~~   63 (75)
                      ...++.+|..|.|++.
T Consensus        32 ~T~~L~~G~~y~Y~v~   47 (75)
T TIGR03000        32 TTPPLEAGKEYEYTVT   47 (75)
T ss_pred             ECCCCCCCCEEEEEEE
Confidence            3567999999999998


No 189
>CHL00142 rps17 ribosomal protein S17; Validated
Probab=32.61  E-value=25  Score=19.47  Aligned_cols=11  Identities=27%  Similarity=0.613  Sum_probs=9.3

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .+++||.|+|.
T Consensus        50 ~~~~GD~V~I~   60 (84)
T CHL00142         50 ECNIGDQVLIE   60 (84)
T ss_pred             CCCCCCEEEEE
Confidence            47899999986


No 190
>smart00318 SNc Staphylococcal nuclease homologues.
Probab=32.28  E-value=80  Score=18.09  Aligned_cols=33  Identities=27%  Similarity=0.317  Sum_probs=24.6

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGT   38 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~   38 (75)
                      ...++--||+++|.+.+.   ....+-+-|+..+..
T Consensus         6 ~V~~V~DGDT~~v~~~~~---~~~~vrL~gIdaPe~   38 (138)
T smart00318        6 VVERVLDGDTIRVRLPKN---KLITIRLSGIDAPET   38 (138)
T ss_pred             EEEEEecCCEEEEEeCCC---CEEEEEEEeccCCcc
Confidence            356788999999987543   357888899987643


No 191
>cd05794 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with N-formylmethionyl-tRNA and puromycine in vitro. EF-P binds to both the 30S and 50S ribosomal subunits. EF-P binds near the streptomycine binding site of the 16S rRNA in the 30S subunit. EF-P interacts with domains 2 and 5 of the 23S rRNA. The L16 ribosomal protein of the 50S or its N-terminal fragment are required for EF-P mediated peptide bond synthesis, whereas L11, L15, and L7/L12 are not required in this reaction, suggesting that EF-P may function at a different ribosomal site than most other translation factors. EF-P is essential for cell viability and is required for protein synthesis. EF-P is mainly present in bacteria. The EF-P homologs in archaea and eukaryotes are the initiation factors aIF5A and eIF5A, respectively. EF-P 
Probab=32.12  E-value=41  Score=17.20  Aligned_cols=13  Identities=38%  Similarity=0.713  Sum_probs=9.9

Q ss_pred             cEEEecCCEEEEE
Q psy88             4 PKNVCEGDRVVVD   16 (75)
Q Consensus         4 ~i~~~~Gd~v~i~   16 (75)
                      |+-+++||.|+|.
T Consensus        35 P~FI~~Gd~I~V~   47 (56)
T cd05794          35 PLFIKEGEKIKVD   47 (56)
T ss_pred             CCeecCCCEEEEE
Confidence            4557899998885


No 192
>PF01398 JAB:  JAB1/Mov34/MPN/PAD-1 ubiquitin protease;  InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors. This family is also known as the MPN domain [] and PAD-1-like domain []. It has been shown that this domain occurs in prokaryotes []. Mov34 proteins act as the regulatory subunit of the 26 proteasome, which is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of this domain is unclear, but it is found in the N terminus of the proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors. A number of the proteins associated with this family belong to MEROPS peptidase family M67 (clan M-). This includes the Poh1 peptidase of Saccharomyces cerevisiae (Baker's yeast) which is a component of the 19S proteasome regulatory particle.; GO: 0005515 protein binding; PDB: 2ZNV_D 2ZNR_A 4E0Q_A 2P87_A 2P8R_A 2O96_B 2O95_A 3RZU_F 3RZV_A.
Probab=31.88  E-value=19  Score=20.22  Aligned_cols=6  Identities=33%  Similarity=1.077  Sum_probs=4.3

Q ss_pred             eEEccC
Q psy88            69 HFWHAH   74 (75)
Q Consensus        69 ~~YH~H   74 (75)
                      =|||+|
T Consensus        85 GWY~s~   90 (114)
T PF01398_consen   85 GWYHSH   90 (114)
T ss_dssp             EEEEEE
T ss_pred             EEEEcc
Confidence            478876


No 193
>cd08069 MPN_RPN11_CSN5 Mov34/MPN/PAD-1 family: proteasomal regulatory protein Rpn11 and signalosome complex subunit CSN5. This family contains proteasomal regulatory protein Rpn11 (26S proteasome regulatory subunit rpn11; PAD1; POH1; RPN11; PSMD14; Rpn11 subunit of the 19S-proteasome; regulatory particle number 11) and signalosomal CSN5 (COP9 signalosome complex subunit 5; COP9 complex homolog subunit 5; c-Jun activation domain-binding protein-1; CSN5/JAB1; JAB1). COP9 signalosome (CSN) and the proteasome lid are paralogous complexes and their respective subunits CSN5 and Rpn11 are most closely related between the two complexes, both containing the conserved JAMM (JAB1/MPN/Mov34 metalloenzyme) motif involved in zinc ion coordination and providing the active site for isopeptidase activity. Rpn11 is responsible for substrate deubiquitination during proteasomal degradation. It is essential for maintaining a correct cell cycle and normal mitochondrial morphology and physiology; mutations i
Probab=31.84  E-value=22  Score=23.65  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=5.9

Q ss_pred             eeEEccCC
Q psy88            68 THFWHAHT   75 (75)
Q Consensus        68 t~~YH~H~   75 (75)
                      .=|||+|.
T Consensus        90 VGWYHSHP   97 (268)
T cd08069          90 VGWYHSHP   97 (268)
T ss_pred             EeeeccCC
Confidence            34999984


No 194
>PHA03189 UL14 tegument protein; Provisional
Probab=31.79  E-value=90  Score=21.76  Aligned_cols=18  Identities=17%  Similarity=0.351  Sum_probs=12.4

Q ss_pred             cCCCCEEEEEEc---CCCeee
Q psy88            52 ITQGNTFRYQFT---ANAGTH   69 (75)
Q Consensus        52 i~pG~~~~y~~~---~~~Gt~   69 (75)
                      +.+.+.++.+|.   +.+|+|
T Consensus       128 lg~aq~ltLtF~v~t~taG~Y  148 (348)
T PHA03189        128 LGAAQRLTLTFRVSTSTAGMY  148 (348)
T ss_pred             ccceeEEEEEEEEEecccceE
Confidence            445677788887   667765


No 195
>PF07610 DUF1573:  Protein of unknown function (DUF1573);  InterPro: IPR011467 These hypothetical proteins from bacteria, such as Rhodopirellula baltica, Bacteroides thetaiotaomicron and Porphyromonas gingivalis, share a region of conserved sequence towards their N termini.
Probab=31.70  E-value=50  Score=15.65  Aligned_cols=42  Identities=14%  Similarity=0.180  Sum_probs=22.2

Q ss_pred             EEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEE
Q psy88            15 VDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQF   62 (75)
Q Consensus        15 i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~   62 (75)
                      +.|+|..+ .+..|-  .+...... .  .+.....+|+||++....+
T Consensus         2 F~~~N~g~-~~L~I~--~v~tsCgC-t--~~~~~~~~i~PGes~~i~v   43 (45)
T PF07610_consen    2 FEFTNTGD-SPLVIT--DVQTSCGC-T--TAEYSKKPIAPGESGKIKV   43 (45)
T ss_pred             EEEEECCC-CcEEEE--EeeEccCC-E--EeeCCcceECCCCEEEEEE
Confidence            57788877 555442  22221110 0  1122345699999987654


No 196
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=31.62  E-value=30  Score=16.69  Aligned_cols=14  Identities=21%  Similarity=0.140  Sum_probs=10.0

Q ss_pred             ccEEEecCCEEEEE
Q psy88             3 YPKNVCEGDRVVVD   16 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~   16 (75)
                      ..|.+++||.|.|.
T Consensus        11 dELs~~~Gd~i~v~   24 (49)
T PF14604_consen   11 DELSFKKGDVITVL   24 (49)
T ss_dssp             TB-EB-TTEEEEEE
T ss_pred             CEeeEcCCCEEEEE
Confidence            45888999999987


No 197
>PLN00208 translation initiation factor (eIF); Provisional
Probab=31.55  E-value=46  Score=20.40  Aligned_cols=17  Identities=24%  Similarity=0.429  Sum_probs=13.8

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      -|++++||.|.|.+.-.
T Consensus        68 rIWI~~GD~VlVel~~~   84 (145)
T PLN00208         68 KVWIAAGDIILVGLRDY   84 (145)
T ss_pred             eEEecCCCEEEEEccCC
Confidence            48899999999986544


No 198
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=31.28  E-value=39  Score=18.44  Aligned_cols=20  Identities=25%  Similarity=0.228  Sum_probs=15.4

Q ss_pred             cccEEEecCCEEEEEEEeCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~   21 (75)
                      +.-|.+|.||.|.|.=.+..
T Consensus         1 P~FL~Vk~Gd~ViV~~~~~~   20 (75)
T PF11302_consen    1 PVFLSVKPGDTVIVQDEQEV   20 (75)
T ss_pred             CcccccCCCCEEEEecCccc
Confidence            35678999999999876643


No 199
>PF11614 FixG_C:  IG-like fold at C-terminal of FixG, putative oxidoreductase; PDB: 2R39_A.
Probab=31.14  E-value=88  Score=17.63  Aligned_cols=45  Identities=16%  Similarity=0.220  Sum_probs=19.8

Q ss_pred             EEEEEEeCCCCCCce--EEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc
Q psy88            13 VVVDVRNSMDGLENT--IHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT   63 (75)
Q Consensus        13 v~i~~~N~~~~~~~~--iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~   63 (75)
                      -++.+.|+.. .+..  |=.-|+.  ......+..   ...|+||++....+.
T Consensus        35 Y~lkl~Nkt~-~~~~~~i~~~g~~--~~~l~~~~~---~i~v~~g~~~~~~v~   81 (118)
T PF11614_consen   35 YTLKLTNKTN-QPRTYTISVEGLP--GAELQGPEN---TITVPPGETREVPVF   81 (118)
T ss_dssp             EEEEEEE-SS-S-EEEEEEEES-S--S-EE-ES-----EEEE-TT-EEEEEEE
T ss_pred             EEEEEEECCC-CCEEEEEEEecCC--CeEEECCCc---ceEECCCCEEEEEEE
Confidence            4688889876 4433  3333321  110001112   234789999888876


No 200
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (ec4) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=31.12  E-value=71  Score=16.10  Aligned_cols=16  Identities=38%  Similarity=0.225  Sum_probs=12.7

Q ss_pred             EEecCCEEEEEEEeCC
Q psy88             6 NVCEGDRVVVDVRNSM   21 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~   21 (75)
                      ..+.||.+++.+....
T Consensus        48 ~~~~Gd~v~v~v~~id   63 (72)
T cd05689          48 VVSLGDEVEVMVLDID   63 (72)
T ss_pred             EeCCCCEEEEEEEEee
Confidence            3688999999987754


No 201
>PTZ00329 eukaryotic translation initiation factor 1A; Provisional
Probab=30.87  E-value=45  Score=20.70  Aligned_cols=16  Identities=25%  Similarity=0.393  Sum_probs=13.3

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      -|++++||.|.|.+.=
T Consensus        68 ~IWI~~GD~VlVel~~   83 (155)
T PTZ00329         68 RVWINIGDIILVSLRD   83 (155)
T ss_pred             eEEecCCCEEEEeccC
Confidence            4899999999998643


No 202
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=30.63  E-value=75  Score=15.74  Aligned_cols=15  Identities=27%  Similarity=0.098  Sum_probs=12.1

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      .++.||.|++.+..-
T Consensus        45 ~~~~G~~v~v~v~~i   59 (69)
T cd05690          45 IYKKGQEVEAVVLNI   59 (69)
T ss_pred             EECCCCEEEEEEEEE
Confidence            368899999998764


No 203
>smart00205 THN Thaumatin family. The thaumatin family gathers proteins related to plant pathogenesis. The thaumatin family includes very basic members with extracellular and vacuolar localization. Thaumatin itsel is a potent sweet-tasting protein. Several members of this family display significant in vitro activity of inhibiting hyphal growth or spore germination of various fungi probably by a membrane permeabilizing mechanism.
Probab=30.40  E-value=1.6e+02  Score=19.23  Aligned_cols=20  Identities=10%  Similarity=0.380  Sum_probs=15.6

Q ss_pred             ccCCCCEEEEEEc-CC-CeeeE
Q psy88            51 PITQGNTFRYQFT-AN-AGTHF   70 (75)
Q Consensus        51 ~i~pG~~~~y~~~-~~-~Gt~~   70 (75)
                      .+.||+++++..+ .- +|.+|
T Consensus        29 ~L~~g~s~~~~~p~~w~sGriW   50 (218)
T smart00205       29 ELNSGASWQLDAPPGTKMGRIW   50 (218)
T ss_pred             ecCCCCeEEEECCCCCccceEe
Confidence            4889999999988 44 37666


No 204
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=30.30  E-value=94  Score=16.58  Aligned_cols=28  Identities=11%  Similarity=0.169  Sum_probs=19.0

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+.+|+.+++.-.=... ....+.|
T Consensus         8 p~~v~v~eG~~v~L~C~v~g~-P~p~i~W   35 (92)
T cd05891           8 PDVVTIMEGKTLNLTCTVFGN-PDPEVIW   35 (92)
T ss_pred             CCcEEEcCCCEEEEEEEEEEe-CCCeEEE
Confidence            457889999999988752222 2335777


No 205
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=30.14  E-value=34  Score=15.86  Aligned_cols=17  Identities=18%  Similarity=0.141  Sum_probs=12.3

Q ss_pred             ccEEEecCCEEEEEEEe
Q psy88             3 YPKNVCEGDRVVVDVRN   19 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N   19 (75)
                      ..|.+++||.|.+.-..
T Consensus        17 ~~l~~~~Gd~v~v~~~~   33 (58)
T smart00326       17 DELSFKKGDIITVLEKS   33 (58)
T ss_pred             CCCCCCCCCEEEEEEcC
Confidence            34677899998887543


No 206
>PRK00276 infA translation initiation factor IF-1; Validated
Probab=30.04  E-value=54  Score=17.24  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=12.6

Q ss_pred             EEEecCCEEEEEEEeCC
Q psy88             5 KNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~   21 (75)
                      +++..||.|.+.+....
T Consensus        45 i~i~vGD~V~ve~~~~~   61 (72)
T PRK00276         45 IRILPGDKVTVELSPYD   61 (72)
T ss_pred             cccCCCCEEEEEEcccC
Confidence            45678999999876543


No 207
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=30.01  E-value=76  Score=15.43  Aligned_cols=15  Identities=40%  Similarity=0.330  Sum_probs=12.1

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      .++.||.+++.+..-
T Consensus        44 ~~~~Gd~v~v~i~~v   58 (68)
T cd05688          44 VVNVGDEVEVKVLKI   58 (68)
T ss_pred             EECCCCEEEEEEEEE
Confidence            368999999988764


No 208
>PF03423 CBM_25:  Carbohydrate binding domain (family 25);  InterPro: IPR005085 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM25 from CAZY which has a starch-binding function as has been demonstrated in one case.; PDB: 2LAB_A 2C3X_B 2C3V_A 2C3W_C 2LAA_A.
Probab=29.97  E-value=76  Score=17.29  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=13.6

Q ss_pred             CCEEEEEEE---eCCCCCCceEEeCCcc
Q psy88            10 GDRVVVDVR---NSMDGLENTIHWHGIH   34 (75)
Q Consensus        10 Gd~v~i~~~---N~~~~~~~~iH~HG~~   34 (75)
                      |++|+|.+.   ..+. ....||.|+-.
T Consensus         1 G~~vtVyYn~~~~~l~-g~~~v~~~~G~   27 (87)
T PF03423_consen    1 GETVTVYYNPSLTALS-GAPNVHLHGGF   27 (87)
T ss_dssp             -SEEEEEE---E-SSS--S-EEEEEETT
T ss_pred             CCEEEEEEEeCCCCCC-CCCcEEEEecC
Confidence            788888883   2233 36688988854


No 209
>cd04451 S1_IF1 S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the formation of the first peptide bond. In Escherichia coli, the initiation mechanism requires, in addition to mRNA, fMet-tRNA, and ribosomal subunits,  the presence of three additional proteins (initiation factors IF1, IF2, and IF3) and at least one GTP molecule. The three initiation factors influence both the kinetics and the stability of ternary complex formation. IF1 is the smallest of the three factors. IF1 enhances the rate of 70S ribosome subunit association and dissociation and the interaction of 30S ribosomal subunit with IF2 and IF3. It stimulates 30S complex formation. In addition, by binding to the A-site of the 30S ribosomal subunit, IF1 may contribute to the fidelity of the selection of the initiation site of th
Probab=29.83  E-value=74  Score=16.07  Aligned_cols=14  Identities=36%  Similarity=0.617  Sum_probs=10.0

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      ++..||.|.+.+..
T Consensus        40 ~~~vGD~V~~~~~~   53 (64)
T cd04451          40 RILPGDRVKVELSP   53 (64)
T ss_pred             ccCCCCEEEEEEee
Confidence            45678888887664


No 210
>PF06030 DUF916:  Bacterial protein of unknown function (DUF916);  InterPro: IPR010317 This family consists of putative cell surface proteins, from Firmicutes, of unknown function. 
Probab=29.79  E-value=1.2e+02  Score=17.65  Aligned_cols=14  Identities=14%  Similarity=0.252  Sum_probs=11.8

Q ss_pred             cccCCCCEEEEEEc
Q psy88            50 CPITQGNTFRYQFT   63 (75)
Q Consensus        50 ~~i~pG~~~~y~~~   63 (75)
                      .-|+|+++++..|.
T Consensus        87 Vtl~~~~sk~V~~~  100 (121)
T PF06030_consen   87 VTLPPNESKTVTFT  100 (121)
T ss_pred             EEECCCCEEEEEEE
Confidence            44889999999887


No 211
>KOG4792|consensus
Probab=29.70  E-value=34  Score=22.90  Aligned_cols=19  Identities=26%  Similarity=0.172  Sum_probs=15.9

Q ss_pred             cEEEecCCEEEEEEEeCCC
Q psy88             4 PKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~   22 (75)
                      -|+++.||.|.|+=+|.-.
T Consensus       245 aL~levGdiVkVTk~ninG  263 (293)
T KOG4792|consen  245 ALALEVGDIVKVTKKNING  263 (293)
T ss_pred             hhhhhcCcEEEEEeeccCc
Confidence            4789999999999888643


No 212
>KOG4458|consensus
Probab=29.62  E-value=39  Score=18.07  Aligned_cols=28  Identities=14%  Similarity=0.237  Sum_probs=21.6

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      ++-|.+..|--.+|-+.|.+. ..+-||+
T Consensus         9 pydii~dd~~d~riplhne~a-~qhgi~f   36 (78)
T KOG4458|consen    9 PYDIIADDGHDCRIPLHNEDA-FQHGICF   36 (78)
T ss_pred             Ccceeecccccceeeccchhh-hhccceE
Confidence            466788889999999999987 5655544


No 213
>PF05896 NQRA:  Na(+)-translocating NADH-quinone reductase subunit A (NQRA);  InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na+-translocating NADH: ubiquinone oxidoreductase (Na+-NQR) generates an electrochemical Na+ potential driven by aerobic respiration [].; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0006814 sodium ion transport, 0055114 oxidation-reduction process
Probab=29.54  E-value=44  Score=22.38  Aligned_cols=14  Identities=50%  Similarity=0.382  Sum_probs=10.7

Q ss_pred             CcccEEEecCCEEE
Q psy88             1 MLYPKNVCEGDRVV   14 (75)
Q Consensus         1 ~~~~i~~~~Gd~v~   14 (75)
                      |-+++.+++||+|+
T Consensus        39 ~~Pkm~VkeGD~Vk   52 (257)
T PF05896_consen   39 MKPKMLVKEGDRVK   52 (257)
T ss_pred             CCccEEeccCCEEe
Confidence            34678888898886


No 214
>PRK05610 rpsQ 30S ribosomal protein S17; Reviewed
Probab=29.45  E-value=31  Score=19.08  Aligned_cols=11  Identities=27%  Similarity=0.193  Sum_probs=9.2

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .++.||.|+|.
T Consensus        53 ~~k~GD~V~I~   63 (84)
T PRK05610         53 EAKIGDVVRIM   63 (84)
T ss_pred             CCCCCCEEEEE
Confidence            47899999986


No 215
>PF01828 Peptidase_A4:  Peptidase A4 family;  InterPro: IPR000250 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  The peptidases in family G1 form a subset of what were formerly termed 'pepstatin-insensitive carboxyl proteinases'. After its discovery in about 1970, the pentapeptide pepstatin soon came to be thought of as a very general inhibitor of the endopeptidases that are active at acidic pH. But more recently several acid-acting endopeptidases from bacteria and fungi had been found to be resistant to pepstatin. The unusual active sites of the 'pepstatin-insensitive carboxyl peptidases' proved difficult to characterise, but it has now been established that the enzymes from bacteria are acid-acting serine peptidases in family S53 (clan SB), IPR000209 from INTERPRO, whereas the fungal enzymes are in family G1 (formerly A4). The importance of glutamate ('E') and glutamine ('Q') residues in the active sites of the family G1 enzymes led to the family name, Eqolisin []. This group of glutamate/glutamine peptidases belong to MEROPS peptidase family G1 (eqolisin family, clan GA). An example of this group is scytalidoglutamic peptidase. The proteins are thermostable, pepstatin insensitive and are active at low pH ranges []. The enzyme has a unique heterodimeric structure, with a 39-residue light chain and a 173-residue heavy chain bound to each other non-covalently []. The tertiary structure of the active site of scytalidoglutamic peptidase (MEROPS G01.001) with a bound tripeptide product has been interpreted as showing that Glu136 is the primary catalytic residue. The most likely mechanism is suggested to be nucleophilic attack by a water molecule activated by the Glu136 side chain on the si-face of the scissile peptide bond carbon atom to form the tetrahedral intermediate. Electrophilic assistance, and oxyanion stabilisation, are provided by the side-chain amide of Gln53. Both scytalidoglutamic peptidase (MEROPS G01.001) and aspergilloglutamic peptidase (MEROPS G01.002) cleave the Tyr26 Thr27 bond in the B chain of oxidized insulin; a bond not cleaved by other acid-acting endopeptidases. Scytalidoglutamic peptidase is most active on casein at pH 2 and is inhibited by 1,2-epoxy-3-(p-nitrophenoxy)propane (EPNP), a compound that also inhibits pepsin. ; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis; PDB: 1Y43_B 1S2B_A 2IFR_A 1S2K_A 2IFW_A.
Probab=29.44  E-value=46  Score=21.38  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=10.6

Q ss_pred             EEEecCCEEEEEEEeCCC
Q psy88             5 KNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~   22 (75)
                      +.++.||.|++++.....
T Consensus        89 ~~v~~GD~i~~~V~a~s~  106 (208)
T PF01828_consen   89 FPVSPGDTIRVTVTATSN  106 (208)
T ss_dssp             ----TT-EEEEEEEEEET
T ss_pred             ceECCCCEEEEEEEecCC
Confidence            678999999999986543


No 216
>MTH00023 COX2 cytochrome c oxidase subunit II; Validated
Probab=29.27  E-value=1.7e+02  Score=19.16  Aligned_cols=56  Identities=14%  Similarity=0.132  Sum_probs=33.1

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccC
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAH   74 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H   74 (75)
                      .|.+-.|..|++.++-..     .|  |+...+..    |+   .. -.-||..-...+. +++|.|.-.|.
T Consensus       152 ~lvlP~~~~v~~~~tS~D-----Vi--Hsf~iP~l----gv---K~-DaiPG~~n~~~~~~~~~G~y~g~C~  208 (240)
T MTH00023        152 RLVVPINTHVRILVTGAD-----VL--HSFAVPSL----GL---KI-DAVPGRLNQTGFFIKRPGVFYGQCS  208 (240)
T ss_pred             eEEEecCCEEEEEEEcCC-----cc--cceeeccc----Cc---ee-ecCCCcceeEEEEcCCCEEEEEEch
Confidence            466667777777776552     22  33333311    11   11 1447888777888 88998887773


No 217
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=29.18  E-value=53  Score=17.40  Aligned_cols=14  Identities=14%  Similarity=0.321  Sum_probs=10.8

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      ++..||.+.|.++|
T Consensus        55 ~a~aGd~v~l~l~~   68 (82)
T cd04089          55 YARPGENVRLRLKG   68 (82)
T ss_pred             EECCCCEEEEEecC
Confidence            46778888888875


No 218
>PF08940 DUF1918:  Domain of unknown function (DUF1918);  InterPro: IPR015035 This domain is found in various hypothetical bacterial proteins, and has no known function. ; PDB: 2A7Y_A.
Probab=29.17  E-value=29  Score=17.99  Aligned_cols=12  Identities=42%  Similarity=0.642  Sum_probs=6.6

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ++++.||++.+.
T Consensus         1 M~A~vGD~lvv~   12 (58)
T PF08940_consen    1 MHASVGDRLVVH   12 (58)
T ss_dssp             ----TTEEEEES
T ss_pred             CCCCCCCEEEEc
Confidence            367889998875


No 219
>PF13218 DUF4026:  Protein of unknown function (DUF4026)
Probab=29.10  E-value=62  Score=22.45  Aligned_cols=25  Identities=12%  Similarity=0.260  Sum_probs=17.6

Q ss_pred             cccCCCCEEEEEEc---C-----CCeeeEEccC
Q psy88            50 CPITQGNTFRYQFT---A-----NAGTHFWHAH   74 (75)
Q Consensus        50 ~~i~pG~~~~y~~~---~-----~~Gt~~YH~H   74 (75)
                      ..+.|.=..-|.+.   +     .++.+|+|.|
T Consensus       147 s~v~Ps~d~LYtihaVyd~D~~~~~~~~WfHTH  179 (323)
T PF13218_consen  147 SDVLPSIDSLYTIHAVYDEDEDPEPTEYWFHTH  179 (323)
T ss_pred             cCCCCCccceEEEEEecccccCCCCceEEEEcc
Confidence            45777555556554   3     4799999998


No 220
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=29.07  E-value=1.1e+02  Score=16.94  Aligned_cols=27  Identities=19%  Similarity=0.196  Sum_probs=19.5

Q ss_pred             ccEEEecCCEEEEEEEeCC-CCCCceEEe
Q psy88             3 YPKNVCEGDRVVVDVRNSM-DGLENTIHW   30 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~-~~~~~~iH~   30 (75)
                      ..+.+++|+.+++...=.. + .+-.+-|
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~-P~p~v~W   38 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYP-PPPHINW   38 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecC-CCCccEE
Confidence            4678999999999988766 4 3334555


No 221
>PF09478 CBM49:  Carbohydrate binding domain CBM49;  InterPro: IPR019028 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see [].  This domain is found at the C-terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose []. ; GO: 0030246 carbohydrate binding, 0005576 extracellular region
Probab=29.04  E-value=57  Score=17.38  Aligned_cols=13  Identities=23%  Similarity=0.723  Sum_probs=10.9

Q ss_pred             ccCCCCEEEEEEc
Q psy88            51 PITQGNTFRYQFT   63 (75)
Q Consensus        51 ~i~pG~~~~y~~~   63 (75)
                      +|+||+++++-+.
T Consensus        66 ~i~pg~s~~FGYI   78 (80)
T PF09478_consen   66 TIKPGQSFTFGYI   78 (80)
T ss_pred             ccCCCCEEEEEEE
Confidence            6899999998764


No 222
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=29.02  E-value=1.1e+02  Score=16.71  Aligned_cols=28  Identities=18%  Similarity=0.141  Sum_probs=21.4

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+++|+.+++...=... .+-++-|
T Consensus         7 p~~~~v~~G~~v~l~C~~~G~-p~p~v~W   34 (98)
T cd05762           7 PEDMKVRAGESVELFCKVTGT-QPITCTW   34 (98)
T ss_pred             CcCEEEECCCEEEEEEEEccc-CCCceEE
Confidence            456789999999998876655 5667777


No 223
>CHL00141 rpl24 ribosomal protein L24; Validated
Probab=28.80  E-value=36  Score=18.72  Aligned_cols=15  Identities=27%  Similarity=0.162  Sum_probs=11.0

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      -+.++.||+|.|---
T Consensus         6 ~~~I~~GD~V~Vi~G   20 (83)
T CHL00141          6 KMHVKIGDTVKIISG   20 (83)
T ss_pred             eCcccCCCEEEEeEc
Confidence            357889999987643


No 224
>PRK13855 type IV secretion system protein VirB10; Provisional
Probab=28.80  E-value=70  Score=22.69  Aligned_cols=21  Identities=24%  Similarity=0.237  Sum_probs=18.6

Q ss_pred             cccEEEecCCEEEEEEEeCCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~   22 (75)
                      ++||.+++|+.|.|-+.-.++
T Consensus       336 pPTl~i~qG~~V~I~VaRDLD  356 (376)
T PRK13855        336 PPTLKKNQGDTVSIFVARDLD  356 (376)
T ss_pred             CCceEECCCCEEEEEECCCcc
Confidence            579999999999998887776


No 225
>PF08363 GbpC:  Glucan-binding protein C;  InterPro: IPR013574 This domain is found in glucan-binding protein C (GbpC) and in the V-region of surface protein antigen; both these proteins belong to the Spa family of Streptococcal proteins []. This domain consists of a beta-supersandwich of 18 beta-strands in two sheets.  There are at least four types of glucan-binding proteins (Gbp) in Streptococcus mutans, GbpA, GbpB, GbpC and GbpD. These proteins promote the adhesion of Streptococcal bacteria to teeth and are associated with dental caries []. GbpC is a cell-wall anchoring protein that plays an important role in sucrose-dependent adhesion by binding to soluble glucan synthesised by glucosyltransferase D (GTFD) []. Spa antigens I/II are multi-functional proteins expressed at the cell wall surface of oral Streptococci, where they function as adhesins. Antigens I/II recognise a wide range of ligands. They exert an immunomodulatory effect on human cells and are important in inflammatory disorders, such as dental caries. These proteins can be divided into seven regions: signal peptide, N-terminal, A-region (alanine-rich), V-region (variable domain), P-region (proline-rich), C-terminal domain, and a cell wall anchor motif. The V-region is the central domain and exhibits the greatest variability in sequence, and is responsible for binding monocyte receptors, its binding stimulating the release of TNF-alpha from the monocytes. The crystal structure of the V-region revealed a lectin-like fold that displays a putative preformed carbohydrate-binding site stabilised by a metal ion [].; GO: 0005488 binding, 0009405 pathogenesis, 0044406 adhesion to host, 0009274 peptidoglycan-based cell wall; PDB: 1JMM_A 3IPK_A 3IOX_A 2WD6_B.
Probab=28.67  E-value=72  Score=21.58  Aligned_cols=17  Identities=24%  Similarity=0.178  Sum_probs=12.6

Q ss_pred             EEEecCCEEEEEEEeCC
Q psy88             5 KNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~   21 (75)
                      +.+++||+++++..|--
T Consensus        85 v~l~~G~~~tvTYtNL~  101 (283)
T PF08363_consen   85 VLLKKGQTVTVTYTNLQ  101 (283)
T ss_dssp             EEEETT-EEEEEEE--S
T ss_pred             EEeccCCEEEEEEeCcc
Confidence            77999999999999974


No 226
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=28.61  E-value=1.1e+02  Score=16.75  Aligned_cols=27  Identities=11%  Similarity=0.188  Sum_probs=19.8

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+++|+.|.|.=.-...  ...++|
T Consensus         5 p~~~~v~~G~~v~l~C~~~~~--~~~v~W   31 (110)
T cd05899           5 PRYLIKGRGQSVTLRCSQTSG--HDNMYW   31 (110)
T ss_pred             CCceEEcCCCcEEEEEEECCC--CCEEEE
Confidence            446889999999998654433  457888


No 227
>TIGR01003 PTS_HPr_family Phosphotransferase System HPr (HPr) Family. The HPr family are bacterial proteins (or domains of proteins) which function in phosphoryl transfer system (PTS) systems. They include energy-coupling components which catalyze sugar uptake via a group translocation mechanism. The functions of most of these proteins are not known, but they presumably function in PTS-related regulatory capacities. All seed members are stand-alone HPr proteins, although the model also recognizes HPr domains of PTS fusion proteins. This family includes the related NPr protein.
Probab=28.42  E-value=32  Score=18.49  Aligned_cols=18  Identities=17%  Similarity=0.191  Sum_probs=14.0

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +.|-++.||.++|...-.
T Consensus        51 l~Lg~~~G~~i~i~~~G~   68 (82)
T TIGR01003        51 MMLGAGQGTEVTVSADGE   68 (82)
T ss_pred             HhcCCCCCCEEEEEEeCc
Confidence            457789999999987543


No 228
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A. Recommended nomenclature: eIF-1A for eukaryotes, aIF-1A for Archaea. Also called eIF-4C
Probab=28.33  E-value=56  Score=18.60  Aligned_cols=17  Identities=29%  Similarity=0.243  Sum_probs=13.4

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++++||.|.|.....
T Consensus        55 ~iwI~~GD~VlVsp~d~   71 (99)
T TIGR00523        55 RIWIREGDVVIVKPWEF   71 (99)
T ss_pred             cEEecCCCEEEEEEccC
Confidence            68899999999965443


No 229
>KOG1554|consensus
Probab=28.32  E-value=25  Score=24.17  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=6.1

Q ss_pred             eeEEccCC
Q psy88            68 THFWHAHT   75 (75)
Q Consensus        68 t~~YH~H~   75 (75)
                      .-|||+|.
T Consensus       134 VGWyHSHP  141 (347)
T KOG1554|consen  134 VGWYHSHP  141 (347)
T ss_pred             eeeeecCC
Confidence            44999994


No 230
>PF00431 CUB:  CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork. ;  InterPro: IPR000859 The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [, ]. These proteins are involved in a diverse range of functions, including complement activation, developmental patterning, tissue repair, axon guidance and angiogenesis, cell signalling, fertilisation, haemostasis, inflammation, neurotransmission, receptor-mediated endocytosis, and tumour suppression [, ]. Many CUB-containing proteins are peptidases belonging to MEROPS peptidase families M12A (astacin) and S1A (chymotrypsin). Proteins containing a CUB domain include:  Mammalian complement subcomponents C1s/C1r, which form the calcium-dependent complex C1, the first component of the classical pathway of the complement system.  Cricetidae sp. (Hamster) serine protease Casp, which degrades type I and IV collagen and fibronectin in the presence of calcium. Mammalian complement-activating component of Ra-reactive factor (RARF), a protease that cleaves the C4 component of complement. Vertebrate enteropeptidase (3.4.21.9 from EC), a type II membrane protein of the intestinal brush border, which activates trypsinogen. Vertebrate bone morphogenic protein 1 (BMP-1), a protein which induces cartilage and bone formation and expresses metalloendopeptidase activity. Sea urchin blastula proteins BP10 and SpAN.  Caenorhabditis elegans hypothetical proteins F42A10.8 and R151.5. Neuropilin (A5 antigen), a calcium-independent cell adhesion molecule that functions during the formation of certain neuronal circuits. Fibropellins I and III from Strongylocentrotus purpuratus (Purple sea urchin). Mammalian hyaluronate-binding protein TSG-6 (or PS4), a serum and growth factor induced protein. Mammalian spermadhesins.  Xenopus laevis embryonic protein UVS.2, which is expressed during dorsoanterior development.  Several of the above proteins consist of a catalytic domain together with several CUB domains interspersed by calcium-binding EGF domains. Some CUB domains appear to be involved in oligomerisation and/or recognition of substrates and binding partners. For example, in the complement proteases, the CUB domains mediate dimerisation and binding to collagen-like regions of target proteins (e.g. C1q for C1r/C1s). The structure of CUB domains consists of a beta-sandwich with a jelly-roll fold. Almost all CUB domains contain four conserved cysteines that probably form two disulphide bridges (C1-C2, C3-C4). The CUB1 domains of C1s and Map19 have calcium-binding sites [].; PDB: 1SFP_A 3KQ4_B 2WNO_A 2QQK_A 2QQL_A 2QQO_B 2QQM_A 3POJ_A 3POB_A 3POG_B ....
Probab=28.29  E-value=60  Score=17.25  Aligned_cols=17  Identities=12%  Similarity=0.112  Sum_probs=13.4

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++..|..|+|+|.+-
T Consensus        30 ~i~~~~~~~I~l~f~~~   46 (110)
T PF00431_consen   30 TITAPPGHRIRLTFLSF   46 (110)
T ss_dssp             EEE-STTEEEEEEEEEE
T ss_pred             EEEecccceeeeccccc
Confidence            68889999999999863


No 231
>COG2336 MazE Growth regulator [Signal transduction mechanisms]
Probab=28.16  E-value=32  Score=19.11  Aligned_cols=17  Identities=41%  Similarity=0.513  Sum_probs=14.2

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      -|-++.||.|++.+.|.
T Consensus        23 ql~l~~g~~v~v~v~n~   39 (82)
T COG2336          23 QLNLTIGDEVEVEVGND   39 (82)
T ss_pred             HhCCCcCceEEEEEcCC
Confidence            35678999999999985


No 232
>cd00367 PTS-HPr_like Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate is transferred to HPr by enzyme I (EI). Phospho-HPr then transfers the phosphoryl group to one of several sugar-specific phosphoprotein intermediates. The conserved histidine in the N-terminus of HPr serves as an acceptor for the phosphoryl group of EI. In addition to the phosphotransferase proteins HPr and E1, this family also includes the closely related Carbon Catabolite Repressor (CCR) proteins which use the same phosphorylation mechanism and interact with transcriptional regulators to control expression of genes coding for utilization of less favored carbon sources.
Probab=28.11  E-value=35  Score=17.94  Aligned_cols=18  Identities=11%  Similarity=0.292  Sum_probs=14.3

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +.|-++.||.++|.+...
T Consensus        47 ~~L~~~~G~~i~i~~~G~   64 (77)
T cd00367          47 MSLGAKQGDEITLSAEGE   64 (77)
T ss_pred             HHcCCCCCCEEEEEEECc
Confidence            457789999999988753


No 233
>PF00254 FKBP_C:  FKBP-type peptidyl-prolyl cis-trans isomerase;  InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5.2.1.8 from EC) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms.; GO: 0006457 protein folding; PDB: 1IX5_A 3JXV_A 3JYM_A 1T11_A 1PBK_A 1FD9_A 2VCD_A 3B7X_A 1Q6H_B 1Q6I_B ....
Probab=28.10  E-value=48  Score=17.65  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=11.9

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||+|.|.+.=.+
T Consensus         5 ~~~gd~V~i~y~~~~   19 (94)
T PF00254_consen    5 PKEGDTVTIHYTGRL   19 (94)
T ss_dssp             BSTTSEEEEEEEEEE
T ss_pred             CCCCCEEEEEEEEEE
Confidence            578999999887544


No 234
>PRK05338 rplS 50S ribosomal protein L19; Provisional
Probab=28.03  E-value=48  Score=19.51  Aligned_cols=14  Identities=36%  Similarity=0.479  Sum_probs=11.7

Q ss_pred             EEEecCCEEEEEEE
Q psy88             5 KNVCEGDRVVVDVR   18 (75)
Q Consensus         5 i~~~~Gd~v~i~~~   18 (75)
                      ..++.||+|+|.+.
T Consensus        17 p~f~~GD~V~V~~~   30 (116)
T PRK05338         17 PEFRPGDTVRVHVK   30 (116)
T ss_pred             CCcCCCCEEEEEEE
Confidence            36789999999886


No 235
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa. The tex gene is essential in Bortella pertusis and is named for its role in toxin expression. Tex has two functional domains, an N-terminal domain homologous to the Escherichia coli maltose repression protein, which is a poorly defined transcriptional factor, and a C-terminal S1 RNA-binding domain. Tex is found in prokaryotes, eukaryotes, and archaea.
Probab=27.99  E-value=58  Score=15.80  Aligned_cols=15  Identities=40%  Similarity=0.290  Sum_probs=12.2

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      .+.||.+++.+.+..
T Consensus        45 ~~~Gd~v~v~i~~vd   59 (68)
T cd05685          45 VSVGDIVEVKVISID   59 (68)
T ss_pred             cCCCCEEEEEEEEEE
Confidence            578999999987754


No 236
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA. This family is classified based on the S1 domain. PNPase nonspecifically removes the 3' nucleotides from mRNA, but is stalled by double-stranded RNA structures such as a stem-loop. Evidence shows that a minimum of 7-10 unpaired nucleotides at the 3' end, is required for PNPase degradation. It is suggested that PNPase also dephosphorylates the RNA 5' end. This additional activity may regulate the 5'-dependent activity of RNaseE in vivo.
Probab=27.72  E-value=70  Score=15.62  Aligned_cols=14  Identities=36%  Similarity=0.366  Sum_probs=11.7

Q ss_pred             EecCCEEEEEEEeC
Q psy88             7 VCEGDRVVVDVRNS   20 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~   20 (75)
                      ++.||.+++.+.+.
T Consensus        45 ~~~Gd~v~v~v~~~   58 (68)
T cd04472          45 LKVGDEVKVKVIEV   58 (68)
T ss_pred             cCCCCEEEEEEEEE
Confidence            58899999998765


No 237
>KOG4795|consensus
Probab=27.69  E-value=58  Score=21.82  Aligned_cols=19  Identities=11%  Similarity=0.253  Sum_probs=16.1

Q ss_pred             cEEEecCCEEEEEEEeCCC
Q psy88             4 PKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~   22 (75)
                      .|.+.+|++|.|+|.|.-.
T Consensus        50 ~l~~~k~n~Vti~~~n~q~   68 (264)
T KOG4795|consen   50 LLHKGKDNKVTIEFQNNQS   68 (264)
T ss_pred             ceeecCCCeEEEEecCCCC
Confidence            3678899999999999865


No 238
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.
Probab=27.43  E-value=57  Score=17.67  Aligned_cols=14  Identities=36%  Similarity=0.546  Sum_probs=11.5

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      .+..||.+.|.+.+
T Consensus        60 ~a~aG~~v~i~l~~   73 (91)
T cd03693          60 EALPGDNVGFNVKN   73 (91)
T ss_pred             EECCCCEEEEEECC
Confidence            47789999998876


No 239
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic. This model represents the archaeal and eukaryotic branch of the ribosomal protein L24p/L26e family. Bacterial and organellar forms are represented by the related TIGR01079.
Probab=27.43  E-value=52  Score=19.28  Aligned_cols=13  Identities=31%  Similarity=0.391  Sum_probs=10.5

Q ss_pred             cEEEecCCEEEEE
Q psy88             4 PKNVCEGDRVVVD   16 (75)
Q Consensus         4 ~i~~~~Gd~v~i~   16 (75)
                      .+.++.||+|.|.
T Consensus        39 ~~~IkkGD~V~Vi   51 (114)
T TIGR01080        39 ALPVRKGDKVRIM   51 (114)
T ss_pred             cceeecCCEEEEe
Confidence            4678999999885


No 240
>PRK10525 cytochrome o ubiquinol oxidase subunit II; Provisional
Probab=27.41  E-value=2.1e+02  Score=19.71  Aligned_cols=56  Identities=13%  Similarity=-0.010  Sum_probs=36.3

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      ..|.+-.|..|++.++-..-     |  |.+..+..   -|     +.-.-||..-+..+. +++|+|.=.|
T Consensus       151 NeL~iP~g~pV~f~lTS~DV-----i--HSF~IP~L---g~-----K~damPG~~n~l~~~a~~~G~Y~G~C  207 (315)
T PRK10525        151 NEIAFPANVPVYFKVTSNSV-----M--NSFFIPRL---GS-----QIYAMAGMQTRLHLIANEPGTYDGIS  207 (315)
T ss_pred             ccEEEecCCEEEEEEEEchh-----h--hhhhhhhh---CC-----eeecCCCceeEEEEEcCCCEEEEEEC
Confidence            46778888888888876532     2  44444321   11     222558888888888 8999887655


No 241
>PRK10850 PTS system phosphohistidinoprotein-hexose phosphotransferase subunit Hpr; Provisional
Probab=27.40  E-value=34  Score=18.70  Aligned_cols=17  Identities=12%  Similarity=0.241  Sum_probs=13.6

Q ss_pred             ccEEEecCCEEEEEEEe
Q psy88             3 YPKNVCEGDRVVVDVRN   19 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N   19 (75)
                      +.+-++.||.|+|...-
T Consensus        51 m~Lg~~~G~~v~i~~~G   67 (85)
T PRK10850         51 QTLGLTQGTVVTISAEG   67 (85)
T ss_pred             HhcCCCCCCEEEEEEeC
Confidence            56778999999998654


No 242
>COG0335 RplS Ribosomal protein L19 [Translation, ribosomal structure and biogenesis]
Probab=27.02  E-value=51  Score=19.44  Aligned_cols=14  Identities=36%  Similarity=0.427  Sum_probs=10.2

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      ..+.||+|++.++=
T Consensus        20 ~f~~GDtvrv~vki   33 (115)
T COG0335          20 SFRPGDTVRVHVKI   33 (115)
T ss_pred             CCCCCCEEEEEEEE
Confidence            35679998877763


No 243
>COG4118 Phd Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning]
Probab=26.96  E-value=24  Score=19.50  Aligned_cols=15  Identities=27%  Similarity=0.534  Sum_probs=12.0

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      ||+.|+.|.|+-.+.
T Consensus        20 rV~aGEev~IT~~G~   34 (84)
T COG4118          20 RVRAGEEVIITKRGR   34 (84)
T ss_pred             HHhCCCEEEEeeCCe
Confidence            678999999986654


No 244
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Eukaryotic and archaeal Initiation Factor 2 (e- and aIF2, respectively) are heterotrimeric proteins with three subunits (alpha, beta, and gamma). IF2 plays a crucial role in the process of translation initiation. The IF2 gamma subunit contains a GTP-binding site. The IF2 beta and gamma subunits together are thought to be responsible for binding methionyl-initiator tRNA. The ternary complex consisting of IF2, GTP, and the methionyl-initiator tRNA binds to the small subunit of the ribosome, as part of a pre-initiation complex that scans the mRNA to find the AUG start codon. The IF2-bound GTP is hydrolyzed to GDP when the methionyl-initiator tRNA binds the AUG start codon, at which time the IF2 is released with its bound GDP. The large ribosomal subunit then joins with the small subunit to c
Probab=26.91  E-value=86  Score=15.84  Aligned_cols=15  Identities=33%  Similarity=0.233  Sum_probs=12.0

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||.+++.+.+..
T Consensus        50 ~~~Gd~v~vkv~~~d   64 (76)
T cd04452          50 VKVGRKEVVKVIRVD   64 (76)
T ss_pred             eCCCCEEEEEEEEEE
Confidence            588999999888643


No 245
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=26.81  E-value=66  Score=16.11  Aligned_cols=15  Identities=40%  Similarity=0.246  Sum_probs=12.4

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||.+++.+.+-.
T Consensus        45 ~~~Gd~i~~~i~~~~   59 (70)
T cd05687          45 VKVGDEVEVYVLRVE   59 (70)
T ss_pred             CCCCCEEEEEEEEEE
Confidence            678999999988754


No 246
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=26.73  E-value=95  Score=17.71  Aligned_cols=30  Identities=13%  Similarity=0.057  Sum_probs=21.2

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEeC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWH   31 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~H   31 (75)
                      ...+.|+.|+.+.+.+.=.+-..+..+-|.
T Consensus        10 ~~~~~v~~gE~~~L~V~ieAYP~p~~~~W~   39 (101)
T cd05860          10 NTTIFVNAGENLDLIVEYEAYPKPEHQQWI   39 (101)
T ss_pred             CceEEEECCCCEEEEEEEEeCCCCeeeEEE
Confidence            357899999999998875543134456775


No 247
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=26.64  E-value=47  Score=16.08  Aligned_cols=10  Identities=40%  Similarity=0.395  Sum_probs=5.7

Q ss_pred             EEEecCCEEE
Q psy88             5 KNVCEGDRVV   14 (75)
Q Consensus         5 i~~~~Gd~v~   14 (75)
                      |.+++||.|+
T Consensus        16 v~V~~G~~Vk   25 (50)
T PF13533_consen   16 VYVKEGQQVK   25 (50)
T ss_pred             EEecCCCEEc
Confidence            4566666653


No 248
>KOG1151|consensus
Probab=26.59  E-value=39  Score=25.15  Aligned_cols=21  Identities=24%  Similarity=0.553  Sum_probs=13.7

Q ss_pred             cCCCCEEE----EEEc-CCCeeeEEc
Q psy88            52 ITQGNTFR----YQFT-ANAGTHFWH   72 (75)
Q Consensus        52 i~pG~~~~----y~~~-~~~Gt~~YH   72 (75)
                      |.-++++.    .+++ +-+|||||=
T Consensus       622 IMdddSy~~vdGmeLTSQgAGTYWYL  647 (775)
T KOG1151|consen  622 IMDDDSYNSVDGMELTSQGAGTYWYL  647 (775)
T ss_pred             hccCCccCcccceeeecccCceeeec
Confidence            44455544    3556 779999994


No 249
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA. This model describes a conserved C-terminal region of the flagellar basal body P-ring formation protein FlgA. This sequence region contains a SAF domain, now described by Pfam model pfam08666.
Probab=26.58  E-value=86  Score=17.76  Aligned_cols=26  Identities=31%  Similarity=0.306  Sum_probs=18.5

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGI   33 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~   33 (75)
                      +.-+++||.|.|.+...    ..++-.-|.
T Consensus        63 ~~~V~~G~~V~i~~~~~----~~~i~~~g~   88 (122)
T TIGR03170        63 PWLVKRGDTVTVIARGG----GLSVTTEGK   88 (122)
T ss_pred             ccEEcCCCEEEEEEecC----CEEEEEEEE
Confidence            45789999999998875    345544554


No 250
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain. RNase R is a processive 3' to 5' exoribonuclease, which is a homolog of RNase II. RNase R degrades RNA with secondary structure having a 3' overhang of at least 7 nucleotides. RNase R and PNPase play an important role in the degradation of RNA with extensive secondary structure, such as rRNA, tRNA, and certain mRNA which contains repetitive extragenic palindromic sequences. The C-terminal S1 domain binds ssRNA.
Probab=26.50  E-value=96  Score=15.87  Aligned_cols=16  Identities=31%  Similarity=0.198  Sum_probs=12.5

Q ss_pred             EEecCCEEEEEEEeCC
Q psy88             6 NVCEGDRVVVDVRNSM   21 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~   21 (75)
                      .++.||.|++.+..-.
T Consensus        57 ~~~~gd~v~v~v~~vd   72 (83)
T cd04471          57 VFRLGDKVKVRVVRVD   72 (83)
T ss_pred             EEcCCCEEEEEEEEec
Confidence            4678999999887653


No 251
>MTH00076 COX2 cytochrome c oxidase subunit II; Provisional
Probab=26.46  E-value=1.9e+02  Score=18.78  Aligned_cols=55  Identities=11%  Similarity=0.100  Sum_probs=33.4

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .|.+-.|..+++.++-..     .|  |+...+.    -|.-   . -.-||..-...+. +++|.|.--|
T Consensus       141 ~l~lP~~~~v~~~~tS~D-----Vi--Hsf~vP~----lg~k---~-da~PG~~n~~~~~~~~~G~~~g~C  196 (228)
T MTH00076        141 RMVVPMESPIRMLITAED-----VL--HSWAVPS----LGIK---T-DAIPGRLNQTSFIASRPGVYYGQC  196 (228)
T ss_pred             eEEEecCCEEEEEEEecc-----cc--ccccccc----cCce---E-EccCCcceeEEEEeCCcEEEEEEC
Confidence            456666777777766542     22  5554442    2222   1 1447888887888 8899887666


No 252
>MTH00154 COX2 cytochrome c oxidase subunit II; Provisional
Probab=26.32  E-value=1.9e+02  Score=18.76  Aligned_cols=55  Identities=15%  Similarity=0.180  Sum_probs=33.7

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .|.+..|..+++.++-..  .   |  |+...+..    |.-    .-.-||..-...+. +++|+|.--|
T Consensus       141 ~l~lP~~~~v~~~~tS~D--V---i--Hsf~vp~l----~~k----~davPG~~~~~~~~~~~~G~y~g~C  196 (227)
T MTH00154        141 RLVLPMNTQIRILITAAD--V---I--HSWTVPSL----GVK----VDAVPGRLNQLNFLINRPGLFFGQC  196 (227)
T ss_pred             eEEEecCCEEEEEEEcCc--h---h--hheecccc----CCe----eecCCCceEEEEEEEcCceEEEEEe
Confidence            466777777777776542  1   2  44443321    111    12458888888888 8899887655


No 253
>PF07452 CHRD:  CHRD domain;  InterPro: IPR010895 CHRD (after SWISS-PROT abbreviation for chordin) is a novel domain identified in chordin, an inhibitor of bone morphogenetic proteins. This family includes bacterial homologues. It is anticipated to have an immunoglobulin-like beta-barrel structure based on limited similarity to superoxide dismutases but, as yet, no clear functional prediction can be made [].
Probab=26.27  E-value=1e+02  Score=17.30  Aligned_cols=18  Identities=11%  Similarity=0.147  Sum_probs=12.4

Q ss_pred             EEEEEeCCCCCCceEEeCC
Q psy88            14 VVDVRNSMDGLENTIHWHG   32 (75)
Q Consensus        14 ~i~~~N~~~~~~~~iH~HG   32 (75)
                      .|.+.|-.+ .++.+|+|+
T Consensus        38 ~i~~~gl~~-~~~~~hih~   55 (119)
T PF07452_consen   38 SITLSGLSS-PPTAAHIHQ   55 (119)
T ss_pred             EEEEeCCCC-CcEEEEEEc
Confidence            344455535 789999998


No 254
>TIGR02609 doc_partner putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids.
Probab=26.10  E-value=52  Score=17.42  Aligned_cols=16  Identities=31%  Similarity=0.430  Sum_probs=11.9

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      +.++.||.|.|...+.
T Consensus        22 lgl~~Gd~v~v~~~~~   37 (74)
T TIGR02609        22 LGLKEGDTLYVDEEEG   37 (74)
T ss_pred             cCcCCCCEEEEEEECC
Confidence            4567889988877664


No 255
>PRK06518 hypothetical protein; Provisional
Probab=25.93  E-value=1.5e+02  Score=18.58  Aligned_cols=69  Identities=10%  Similarity=0.101  Sum_probs=37.1

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCC---CCCC--Cccc------ccccCCCCEEEEEEc-CCCeeeEE
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQY---SDGV--PFVT------QCPITQGNTFRYQFT-ANAGTHFW   71 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~---~DG~--~~~~------~~~i~pG~~~~y~~~-~~~Gt~~Y   71 (75)
                      +++|.-||+|+|.-.+........|-+.|++.+....   .+|.  |.-.      ...| .|+..+.... +..|....
T Consensus        27 ~v~V~DGDTl~l~~~~~~~~~~~~VRL~GIDAPE~~Q~c~~~~~~wp~G~~A~~~L~~li-~gk~V~~~~~~D~ygR~lA  105 (177)
T PRK06518         27 RAQVTSGVTFKLIADGWRKEITRDIRLYGVDTCAPRQKARLGDQEWPCGAVATAWLVTKT-LNKWLSCRQARMENGVHYA  105 (177)
T ss_pred             eEEEEcCCEEEEeeccccCCCCeEEEEEEEcCCCCCCcccCCCCCCcHHHHHHHHHHHHH-CCCeEEEEEecccCCCEEE
Confidence            3578899999995221111125789999998764321   1121  1100      0112 4677766655 66666655


Q ss_pred             cc
Q psy88            72 HA   73 (75)
Q Consensus        72 H~   73 (75)
                      +|
T Consensus       106 ~~  107 (177)
T PRK06518        106 QC  107 (177)
T ss_pred             EE
Confidence            55


No 256
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis]
Probab=25.88  E-value=55  Score=18.92  Aligned_cols=15  Identities=33%  Similarity=0.271  Sum_probs=10.7

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .++++.||+|.|---
T Consensus         2 ~~~IrkGD~V~Vi~G   16 (104)
T COG0198           2 KMKVKKGDTVKVIAG   16 (104)
T ss_pred             CcceecCCEEEEEec
Confidence            357788999887543


No 257
>smart00841 Elong-fact-P_C Elongation factor P, C-terminal. These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology PUBMED:15210970.
Probab=25.87  E-value=54  Score=16.76  Aligned_cols=13  Identities=46%  Similarity=0.790  Sum_probs=9.5

Q ss_pred             cEEEecCCEEEEE
Q psy88             4 PKNVCEGDRVVVD   16 (75)
Q Consensus         4 ~i~~~~Gd~v~i~   16 (75)
                      ++-+++||.|+|.
T Consensus        35 P~FI~~Gd~I~V~   47 (56)
T smart00841       35 PLFINEGDKIKVD   47 (56)
T ss_pred             CCcccCCCEEEEE
Confidence            3456889998885


No 258
>PF01557 FAA_hydrolase:  Fumarylacetoacetate (FAA) hydrolase family Mutations in Swiss:P16930 cause inherited tyrosinemia type I.;  InterPro: IPR002529 Fumarylacetoacetase (3.7.1.2 from EC; also known as fumarylacetoacetate hydrolase or FAH) catalyses the hydrolytic cleavage of a carbon-carbon bond in fumarylacetoacetate to yield fumarate and acetoacetate as the final step in phenylalanine and tyrosine degradation []. This is an essential metabolic function in humans, the lack of FAH causing type I tyrosinaemia, which is associated with liver and kidney abnormalities and neurological disorders [, ]. The enzyme mechanism involves a catalytic metal ion, a Glu/His catalytic dyad, and a charged oxyanion hole []. FAH folds into two domains: an N-terminal domain SH3-like beta-barrel, and a C-terminal with an unusual fold consisting of three layers of beta-sheet structures []. This entry represents the C-terminal domain of fumarylacetoacetase, as well as other domains that share a homologous sequence, including:  5-carboxymethyl-2-hydroxymuconate delta-isomerase (CHM isomerase; 5.3.3.10 from EC), which catalyses the conversion of 5-carboxymethyl-2-hydroxymuconate to 5-carboxy-2-oxohept-3-enedioate []. 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase (OPET decarboxylase; 4.1.1.68 from EC), which catalyses the conversion of 5-oxopent-3-ene-1,2,5-tricarboxylate to 2-oxohept-3-enedioate and carbon dioxide. Bifunctional enzyme HpcE (OPET decarboxylase 4.1.1.68 from EC/HHDD isomerase 5.3.3.10 from EC), which is a duplication consisting of a tandem repeat of two FAH C-terminal-like domains. This enzyme is responsible for the degradation of 4-hydroxyphenylacetate, a product of tyrosine and phenylalanine metabolism also released by lignin catabolism [].  ; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1SAW_B 3LZK_B 3S52_B 2WQT_Q 1SV6_C 2DFU_B 1WZO_D 3QDF_A 1GTT_B 1I7O_C ....
Probab=25.73  E-value=91  Score=19.57  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=12.6

Q ss_pred             cccEEEecCCEEEEEE
Q psy88             2 LYPKNVCEGDRVVVDV   17 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~   17 (75)
                      ...+.++.||+|++.+
T Consensus       191 ~~~~~l~~Gd~v~~~~  206 (218)
T PF01557_consen  191 PPPVPLQPGDRVEAEI  206 (218)
T ss_dssp             SCCEEEBTT-EEEEEE
T ss_pred             cccccCCCCcEEEEEE
Confidence            3567899999999988


No 259
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain.
Probab=25.67  E-value=92  Score=14.92  Aligned_cols=16  Identities=31%  Similarity=0.216  Sum_probs=13.0

Q ss_pred             EEecCCEEEEEEEeCC
Q psy88             6 NVCEGDRVVVDVRNSM   21 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~   21 (75)
                      ..+.||.+++.+..-.
T Consensus        46 ~~~~G~~v~~~V~~~~   61 (72)
T smart00316       46 VLKVGDEVKVKVLSVD   61 (72)
T ss_pred             eecCCCEEEEEEEEEe
Confidence            3788999999988754


No 260
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=25.51  E-value=39  Score=16.95  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=8.5

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ..++.||+|+|-
T Consensus        48 ~~L~~gD~vei~   59 (65)
T PRK06944         48 RALAAGDRLDLV   59 (65)
T ss_pred             ccCCCCCEEEEE
Confidence            356788888773


No 261
>CHL00010 infA translation initiation factor 1
Probab=25.42  E-value=76  Score=17.03  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=10.7

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      +++..||.|.+.+...
T Consensus        45 i~~~vGD~V~ve~~~~   60 (78)
T CHL00010         45 IRILPGDRVKVELSPY   60 (78)
T ss_pred             cccCCCCEEEEEEccc
Confidence            4566788888876443


No 262
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies.
Probab=25.28  E-value=41  Score=15.37  Aligned_cols=15  Identities=20%  Similarity=0.160  Sum_probs=11.1

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .|.+++||.|.+.-.
T Consensus        15 ~l~~~~Gd~v~v~~~   29 (54)
T cd00174          15 ELSFKKGDIIEVLEK   29 (54)
T ss_pred             CCCCCCCCEEEEEEc
Confidence            466788999888644


No 263
>PF01345 DUF11:  Domain of unknown function DUF11;  InterPro: IPR001434 This group of sequences is represented by a conserved region of about 53 amino acids shared between regions, usually repeated, of proteins from a small number of phylogenetically distant prokaryotes. Examples include a 132-residue region found repeated in three of the five longest proteins of Bacillus anthracis, a 131-residue repeat in a cell wall-anchored protein of Enterococcus faecalis (Streptococcus faecalis), and a 120-residue repeat in Methanobacterium thermoautotrophicum. A similar region is found in some Chlamydia trachomatis outer membrane proteins.  In C. trachomatis, three cysteine-rich proteins (also believed to be lipoproteins), MOMP, OMP6 and OMP3, make up the extracellular matrix of the outer membrane []. They are involved in the essential structural integrity of both the elementary body (EB) and recticulate body (RB) phase. They are thought to be involved in porin formation and, as these bacteria lack the peptidoglycan layer common to most Gram-negative microbes, such proteins are highly important in the pathogenicity of the organism.; GO: 0005727 extrachromosomal circular DNA
Probab=25.25  E-value=60  Score=16.75  Aligned_cols=17  Identities=35%  Similarity=0.661  Sum_probs=13.6

Q ss_pred             ccCCCCEEEEEEc-CCCe
Q psy88            51 PITQGNTFRYQFT-ANAG   67 (75)
Q Consensus        51 ~i~pG~~~~y~~~-~~~G   67 (75)
                      .+.||+..+|.+. ...|
T Consensus        36 ~~~~Gd~v~ytitvtN~G   53 (76)
T PF01345_consen   36 TANPGDTVTYTITVTNTG   53 (76)
T ss_pred             cccCCCEEEEEEEEEECC
Confidence            3789999999998 5544


No 264
>PRK10897 phosphohistidinoprotein-hexose phosphotransferase component of N-regulated PTS system (Npr); Provisional
Probab=25.18  E-value=37  Score=18.81  Aligned_cols=18  Identities=11%  Similarity=0.265  Sum_probs=13.8

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +.|-++.||.|+|...=.
T Consensus        53 m~Lg~~~G~~i~v~~~G~   70 (90)
T PRK10897         53 LMLDSAKGRQIEVEATGP   70 (90)
T ss_pred             HHhCCCCCCEEEEEEECc
Confidence            467788999999987543


No 265
>PTZ00241 40S ribosomal protein S11; Provisional
Probab=25.08  E-value=37  Score=21.13  Aligned_cols=16  Identities=44%  Similarity=0.331  Sum_probs=12.2

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .++++.||.|+|.=.-
T Consensus       114 ~~~~kvGD~V~I~EcR  129 (158)
T PTZ00241        114 CFDVKEGDIVVVGQCR  129 (158)
T ss_pred             cCCCCCCCEEEEEEcC
Confidence            4678999999996433


No 266
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain. pNO40 is a nucleolar protein of unknown function with an N-terminal S1 RNA binding domain, a CCHC type zinc finger, and clusters of basic amino acids representing a potential nucleolar targeting signal.  pNO40 was identified through a yeast two-hybrid interaction screen of a human kidney cDNA library using the pinin (pnn) protein as bait. pNO40 is thought to play a role in ribosome maturation and/or biogenesis.
Probab=25.05  E-value=93  Score=15.95  Aligned_cols=15  Identities=33%  Similarity=0.317  Sum_probs=12.2

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||++++.+....
T Consensus        49 ~~~Gd~v~vkv~~vd   63 (73)
T cd05686          49 VDVGEKVWVKVIGRE   63 (73)
T ss_pred             ECCCCEEEEEEEEEC
Confidence            588999999987654


No 267
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated
Probab=24.84  E-value=64  Score=19.16  Aligned_cols=15  Identities=33%  Similarity=0.224  Sum_probs=11.4

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .+.++.||.|.|.--
T Consensus        43 ~~~IkkGD~V~VisG   57 (120)
T PRK01191         43 SLPVRKGDTVKVMRG   57 (120)
T ss_pred             cceEeCCCEEEEeec
Confidence            467889999988643


No 268
>PRK05863 sulfur carrier protein ThiS; Provisional
Probab=24.81  E-value=47  Score=16.99  Aligned_cols=10  Identities=30%  Similarity=0.458  Sum_probs=7.3

Q ss_pred             EecCCEEEEE
Q psy88             7 VCEGDRVVVD   16 (75)
Q Consensus         7 ~~~Gd~v~i~   16 (75)
                      +++||+|+|-
T Consensus        50 L~~gD~ieIv   59 (65)
T PRK05863         50 LRDGARLEVV   59 (65)
T ss_pred             cCCCCEEEEE
Confidence            5678888773


No 269
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 14 (hs14). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=24.69  E-value=60  Score=16.98  Aligned_cols=16  Identities=19%  Similarity=0.125  Sum_probs=13.6

Q ss_pred             EecCCEEEEEEEeCCC
Q psy88             7 VCEGDRVVVDVRNSMD   22 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~   22 (75)
                      +++||.|.-.+.|-.+
T Consensus         1 ~k~G~~V~g~V~~i~~   16 (74)
T cd05705           1 IKEGQLLRGYVSSVTK   16 (74)
T ss_pred             CCCCCEEEEEEEEEeC
Confidence            3789999999999876


No 270
>TIGR00638 Mop molybdenum-pterin binding domain. This model describes a multigene family of molybdenum-pterin binding proteins of about 70 amino acids in Clostridium pasteurianum, as a tandemly-repeated domain C-terminal to an unrelated domain in ModE, a molybdate transport gene repressor of E. coli, and in single or tandemly paired domains in several related proteins.
Probab=24.58  E-value=50  Score=16.48  Aligned_cols=15  Identities=13%  Similarity=0.209  Sum_probs=10.4

Q ss_pred             EEEecCCEEEEEEEe
Q psy88             5 KNVCEGDRVVVDVRN   19 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N   19 (75)
                      +.+++||.|.+.++-
T Consensus        47 l~l~~G~~v~~~ik~   61 (69)
T TIGR00638        47 LGLKPGKEVYAVIKA   61 (69)
T ss_pred             CCCCCCCEEEEEEEC
Confidence            345688888887753


No 271
>TIGR01646 vgr_GE Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
Probab=24.39  E-value=96  Score=22.01  Aligned_cols=24  Identities=13%  Similarity=-0.003  Sum_probs=19.5

Q ss_pred             EEEecCCEEEEEEEeCCCCCCceE
Q psy88             5 KNVCEGDRVVVDVRNSMDGLENTI   28 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~~~~~~i   28 (75)
                      +.-+.||+|.|.|.|..+++|..+
T Consensus       406 f~PrvG~EVlV~F~~GDpDrPvI~  429 (483)
T TIGR01646       406 AIPRVGQEVIVGFLDGDPDRPIVT  429 (483)
T ss_pred             ccCCCCCEEEEEEeCCCCCCCEEE
Confidence            445789999999999988777654


No 272
>TIGR01683 thiS thiamine biosynthesis protein ThiS. This model represents ThiS, a small thiamine-biosynthesis protein related to MoaD, a molybdenum cofactor biosynthesis protein. Both proteins are involved in sulfur transfer. ThiS has a conserved Gly-Gly C-terminus that is modified, in reactions requiring ThiI, ThiF, IscS, and a sulfur atom from Cys, into the thiocarboxylate that provides the sulfur for thiazole biosynthesis.
Probab=24.38  E-value=62  Score=16.33  Aligned_cols=12  Identities=33%  Similarity=0.482  Sum_probs=8.6

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ..++.||+|.|-
T Consensus        47 ~~L~~gD~veii   58 (64)
T TIGR01683        47 TILKEGDRIEIV   58 (64)
T ss_pred             eecCCCCEEEEE
Confidence            457788888763


No 273
>PF05489 Phage_tail_X:  Phage Tail Protein X;  InterPro: IPR008861 This entry is represented by Bacteriophage P2, GpX. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family is found in a family of phage tail proteins. Sequence analysis suggests that they are related to IPR002482 from INTERPRO which suggests a general peptidoglycan binding function.
Probab=24.35  E-value=35  Score=17.55  Aligned_cols=12  Identities=17%  Similarity=0.224  Sum_probs=7.6

Q ss_pred             ccEEEecCCEEE
Q psy88             3 YPKNVCEGDRVV   14 (75)
Q Consensus         3 ~~i~~~~Gd~v~   14 (75)
                      ++++.++||++.
T Consensus         1 m~v~t~~GDtlD   12 (60)
T PF05489_consen    1 MTVYTTQGDTLD   12 (60)
T ss_pred             CEEEEeCcCcHH
Confidence            356667777754


No 274
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein. ThiS (ThiaminS) is a sulfur carrier protein involved in thiamin biosynthesis in bacteria.  The ThiS fold, like those of two closely related proteins MoaD and Urm1, is similar to that of ubiquitin although there is little or no sequence similarity.
Probab=24.34  E-value=62  Score=16.36  Aligned_cols=12  Identities=25%  Similarity=0.520  Sum_probs=8.7

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ..++.||+|.|-
T Consensus        48 ~~L~~gD~V~ii   59 (65)
T cd00565          48 TPLQDGDRIEIV   59 (65)
T ss_pred             eecCCCCEEEEE
Confidence            467888888763


No 275
>COG3269 Predicted RNA-binding protein, contains TRAM domain [General function prediction only]
Probab=24.28  E-value=61  Score=17.58  Aligned_cols=17  Identities=24%  Similarity=0.266  Sum_probs=12.6

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      -++.||++.|.+.--.+
T Consensus        45 ~a~~Gd~V~vkI~~v~~   61 (73)
T COG3269          45 GAEVGDEVKVKITKVKP   61 (73)
T ss_pred             CCCCCCeeeEEEEEeec
Confidence            35789999998876543


No 276
>MTH00168 COX2 cytochrome c oxidase subunit II; Provisional
Probab=24.26  E-value=2.1e+02  Score=18.50  Aligned_cols=55  Identities=13%  Similarity=0.163  Sum_probs=33.3

Q ss_pred             cEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEcc
Q psy88             4 PKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHA   73 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~   73 (75)
                      .+.+-.|..+++.++-..     .|  |+...+..    |.   ... .-||..-...+. +++|+|.--|
T Consensus       141 ~l~lP~~~~v~~~~tS~D-----Vi--Hsf~vP~l----g~---k~d-aiPG~~n~~~~~~~~~G~~~g~C  196 (225)
T MTH00168        141 RLVLPMDSKIRVLVTSAD-----VL--HSWTLPSL----GL---KMD-AVPGRLNQLAFLSSRPGSFYGQC  196 (225)
T ss_pred             eEEEecCCEEEEEEEeCC-----hh--hccccccc----cc---ccc-CCCCeEEEEEEEcCCCEEEEEEc
Confidence            456666777777766553     12  44443321    11   111 348888888888 8999987766


No 277
>PF06205 GT36_AF:  Glycosyltransferase 36 associated family  ;  InterPro: IPR010403 This domain is found in the NvdB protein (P20471 from SWISSPROT), which is involved in the production of beta-(1-->2)-glucan.; PDB: 1V7V_A 1V7W_A 1V7X_A 3ACT_B 2CQT_A 3QFY_B 3QFZ_A 2CQS_A 3QG0_B 3AFJ_A ....
Probab=24.11  E-value=1.1e+02  Score=16.76  Aligned_cols=16  Identities=13%  Similarity=-0.045  Sum_probs=11.1

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .|+++.|++.+|.|.-
T Consensus        67 ~v~L~PGe~~~v~f~l   82 (90)
T PF06205_consen   67 RVTLEPGEEKEVVFLL   82 (90)
T ss_dssp             EEEE-TT-EEEEEEEE
T ss_pred             EEEECCCCEEEEEEEE
Confidence            4788999999998753


No 278
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=24.04  E-value=88  Score=16.65  Aligned_cols=14  Identities=14%  Similarity=0.007  Sum_probs=11.5

Q ss_pred             cEEEecCCEEEEEE
Q psy88             4 PKNVCEGDRVVVDV   17 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~   17 (75)
                      ++.+.+|+.|.|.=
T Consensus         1 ~v~~~~G~~vtl~C   14 (98)
T cd05716           1 VVTGELGGSVTIPC   14 (98)
T ss_pred             CEEEEeCCeEEEEe
Confidence            46789999999974


No 279
>PRK13831 conjugal transfer protein TrbI; Provisional
Probab=24.01  E-value=99  Score=22.37  Aligned_cols=21  Identities=14%  Similarity=0.039  Sum_probs=18.1

Q ss_pred             cccEEEecCCEEEEEEEeCCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~   22 (75)
                      ++||.+++|..|.|-+.-.+.
T Consensus       406 ~PTitirpG~~v~I~V~RDL~  426 (432)
T PRK13831        406 QPTLEIRPGYKFNVLVDQDIV  426 (432)
T ss_pred             CCceEeCCCCEEEEEeccCcc
Confidence            579999999999998877665


No 280
>PRK13881 conjugal transfer protein TrbI; Provisional
Probab=23.95  E-value=86  Score=22.93  Aligned_cols=21  Identities=24%  Similarity=0.158  Sum_probs=18.6

Q ss_pred             cccEEEecCCEEEEEEEeCCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~   22 (75)
                      ++||++++|+++.|-|...++
T Consensus       442 pPTItI~qG~rinIiVaRDLd  462 (472)
T PRK13881        442 APTLEIRPGYRFNVIVTKDMT  462 (472)
T ss_pred             CCceEECCCCEEEEEecCccc
Confidence            579999999999999888776


No 281
>PF11325 DUF3127:  Domain of unknown function (DUF3127);  InterPro: IPR021474  This bacterial family of proteins has no known function. 
Probab=23.87  E-value=71  Score=17.70  Aligned_cols=14  Identities=36%  Similarity=0.347  Sum_probs=11.0

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      .+++||.|+|.|.=
T Consensus        52 ~~~~Gd~V~Vsf~i   65 (84)
T PF11325_consen   52 NFQVGDEVKVSFNI   65 (84)
T ss_pred             cCCCCCEEEEEEEe
Confidence            56789999998753


No 282
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the catalytic or G-domain. The G-domain is composed of about 200 amino acid residues, arranged into a predominantly parallel six-stranded beta-sheet core surrounded by seven a-helices. Non-catalytic domains II and III are beta-barrels of seven and six, respectively, antiparallel beta-strands that share an extended interface. Either non-catalytic domain is composed of about 100 amino acid residues.  EF-Tu proteins exist in two principal conformations: in a compact one, EF-Tu*GTP, with tight interfaces between all three domains and a high affinity for aminoacyl-tRNA, and in an open one, EF-Tu*GDP, with essentially no G-domain-domain II interactions and a low affinity for aminoacyl-tRNA. EF-Tu has approximately a 100-fold higher
Probab=23.77  E-value=77  Score=16.95  Aligned_cols=14  Identities=36%  Similarity=0.382  Sum_probs=10.6

Q ss_pred             EEecCCEEEEEEEe
Q psy88             6 NVCEGDRVVVDVRN   19 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N   19 (75)
                      .+..||.+.+.|++
T Consensus        58 ~a~~G~~v~l~l~~   71 (87)
T cd03697          58 EAEAGDNVGVLLRG   71 (87)
T ss_pred             EECCCCEEEEEECC
Confidence            46678888888865


No 283
>PF03712 Cu2_monoox_C:  Copper type II ascorbate-dependent monooxygenase, C-terminal domain; PDB: 1YI9_A 3MLL_A 1SDW_A 3MID_A 1YIP_A 3PHM_A 3MIC_A 3MIB_A 1OPM_A 3MIG_A ....
Probab=23.69  E-value=74  Score=19.26  Aligned_cols=16  Identities=19%  Similarity=0.347  Sum_probs=11.3

Q ss_pred             ccEEEecCCEEEEEEE
Q psy88             3 YPKNVCEGDRVVVDVR   18 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~   18 (75)
                      .++.++.||.|+++-.
T Consensus        85 ~~v~i~~GD~l~~~C~  100 (156)
T PF03712_consen   85 EPVTIPPGDTLRTECT  100 (156)
T ss_dssp             EEEEE-TT-EEEEEEE
T ss_pred             CceEecCCCEEEEEEE
Confidence            4689999999998755


No 284
>COG2847 Copper(I)-binding protein [Inorganic ion transport and    metabolism]
Probab=23.56  E-value=59  Score=20.05  Aligned_cols=15  Identities=40%  Similarity=0.618  Sum_probs=9.8

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      .-.+++||+|.++|+
T Consensus       113 K~pl~eGd~v~vtL~  127 (151)
T COG2847         113 KKPLKEGDKVPVTLK  127 (151)
T ss_pred             CCCccCCCEEEEEEE
Confidence            334567777777665


No 285
>PF09347 DUF1989:  Domain of unknown function (DUF1989);  InterPro: IPR018959  This entry represents proteins that are functionally uncharacterised. ; PDB: 3ORU_A 3SIY_C 3DI4_A.
Probab=23.53  E-value=79  Score=19.57  Aligned_cols=13  Identities=15%  Similarity=0.174  Sum_probs=8.0

Q ss_pred             cEEEecCCEEEEE
Q psy88             4 PKNVCEGDRVVVD   16 (75)
Q Consensus         4 ~i~~~~Gd~v~i~   16 (75)
                      ..++++|+.++|.
T Consensus        11 a~~v~rG~~lri~   23 (166)
T PF09347_consen   11 AFRVKRGQVLRIT   23 (166)
T ss_dssp             EEEE-TT-EEEEE
T ss_pred             EEEECCCCEEEEE
Confidence            4678899987765


No 286
>PF10610 Tafi-CsgC:  Thin aggregative fimbriae synthesis protein;  InterPro: IPR014491 Thin aggressive fibres known as curli fibres or fimbriae (curli; Tafi) are cell-surface protein polymers found in Salmonella typhimurium and Escherichia coli that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation []. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), which differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp and the controlling operon termed agf; however subsequent isolation of the homologous operon in E coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix. The gene agfC is found to be transcribed at low levels, localised to the periplasm in a mature form, and in combination with AgfE is important for AgfA extracellular assembly, which facilitates the synthesis of Tafi. The genes involved in Tafi production are organised into two adjacent divergently transcribed operons, agfBAC and agfDEFG, both of which are required for biosynthesis and assembly [].; PDB: 2XSK_A 2Y2T_A 2Y2Y_A.
Probab=23.51  E-value=93  Score=18.09  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=11.2

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +-+.+..||+|.|.+.=.
T Consensus        71 ls~ni~p~D~v~I~VtvS   88 (106)
T PF10610_consen   71 LSFNISPGDKVKIIVTVS   88 (106)
T ss_dssp             EEEE--TT-EEEEEEEEE
T ss_pred             EEEEeCCCCeEEEEEEEc
Confidence            346778899999988744


No 287
>TIGR00046 RNA methyltransferase, RsmE family. Members of this protein family, previously called conserved hypothetical protein TIGR00046, include the YggJ protein of E. coli, which has now been shown to methylate U1498 in 16S rRNA.
Probab=23.36  E-value=44  Score=21.61  Aligned_cols=14  Identities=14%  Similarity=0.135  Sum_probs=11.5

Q ss_pred             cEEEecCCEEEEEE
Q psy88             4 PKNVCEGDRVVVDV   17 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~   17 (75)
                      .+|+++||.|+|.-
T Consensus        29 VlR~~~Gd~v~v~~   42 (240)
T TIGR00046        29 VLRLKKGDKLKLLD   42 (240)
T ss_pred             cccCCCCCEEEEEe
Confidence            67999999988753


No 288
>TIGR03361 VI_Rhs_Vgr type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
Probab=23.34  E-value=96  Score=22.22  Aligned_cols=23  Identities=22%  Similarity=0.055  Sum_probs=18.7

Q ss_pred             EEecCCEEEEEEEeCCCCCCceE
Q psy88             6 NVCEGDRVVVDVRNSMDGLENTI   28 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~~~~~~i   28 (75)
                      .-+.||+|.|.|.|..+.+|..+
T Consensus       418 ~PrvG~EVlV~F~~GDpdrPvI~  440 (513)
T TIGR03361       418 IPRVGQEVVVDFLEGDPDRPIVT  440 (513)
T ss_pred             CCCCCCEEEEEEcCCCCCCCEEE
Confidence            34789999999999988777654


No 289
>PRK10862 SoxR reducing system protein RseC; Provisional
Probab=23.33  E-value=37  Score=20.69  Aligned_cols=16  Identities=13%  Similarity=0.403  Sum_probs=11.6

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      +.++.||.|+|.+..+
T Consensus        57 ~~~~vGD~V~v~i~e~   72 (154)
T PRK10862         57 QPLVPGQKVELGIAEG   72 (154)
T ss_pred             CCCCCCCEEEEecchh
Confidence            3467788888877654


No 290
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=23.28  E-value=88  Score=15.11  Aligned_cols=14  Identities=43%  Similarity=0.536  Sum_probs=11.3

Q ss_pred             EecCCEEEEEEEeC
Q psy88             7 VCEGDRVVVDVRNS   20 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~   20 (75)
                      ++.||.+++.+...
T Consensus        45 ~~~Gd~v~v~v~~~   58 (69)
T cd05692          45 LKEGDKVKVKVLSI   58 (69)
T ss_pred             cCCCCEEEEEEEEE
Confidence            57899999988764


No 291
>PRK01777 hypothetical protein; Validated
Probab=23.27  E-value=46  Score=18.72  Aligned_cols=11  Identities=36%  Similarity=0.543  Sum_probs=8.7

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .++.||+|+|-
T Consensus        64 ~L~dGDRVeIy   74 (95)
T PRK01777         64 VLRDGDRVEIY   74 (95)
T ss_pred             cCCCCCEEEEe
Confidence            46789999884


No 292
>PF09285 Elong-fact-P_C:  Elongation factor P, C-terminal;  InterPro: IPR015365 These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology []. ; GO: 0043043 peptide biosynthetic process, 0005737 cytoplasm; PDB: 1YBY_A 3OYY_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H.
Probab=23.18  E-value=64  Score=16.49  Aligned_cols=11  Identities=45%  Similarity=0.730  Sum_probs=6.3

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      -+++||.|+|.
T Consensus        37 FI~~Gd~I~Vd   47 (56)
T PF09285_consen   37 FIEEGDKIKVD   47 (56)
T ss_dssp             T--TT-EEEEE
T ss_pred             eecCCCEEEEE
Confidence            35789999885


No 293
>PF11797 DUF3324:  Protein of unknown function C-terminal (DUF3324);  InterPro: IPR021759  This family consists of several hypothetical bacterial proteins of unknown function. 
Probab=23.15  E-value=1e+02  Score=18.25  Aligned_cols=22  Identities=9%  Similarity=0.329  Sum_probs=17.0

Q ss_pred             ccCCCCEEEEEEc-C----CCeeeEEc
Q psy88            51 PITQGNTFRYQFT-A----NAGTHFWH   72 (75)
Q Consensus        51 ~i~pG~~~~y~~~-~----~~Gt~~YH   72 (75)
                      -++|...|.|.+. +    .||+|-++
T Consensus        85 ~mAPNS~f~~~i~~~~~~lk~G~Y~l~  111 (140)
T PF11797_consen   85 QMAPNSNFNFPIPLGGKKLKPGKYTLK  111 (140)
T ss_pred             EECCCCeEEeEecCCCcCccCCEEEEE
Confidence            3789999999888 2    58888665


No 294
>PRK09798 antitoxin MazE; Provisional
Probab=23.03  E-value=61  Score=17.72  Aligned_cols=16  Identities=25%  Similarity=0.337  Sum_probs=11.5

Q ss_pred             EEEecCCEEEEEEEeC
Q psy88             5 KNVCEGDRVVVDVRNS   20 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~   20 (75)
                      +.++.||.|+|.+.|.
T Consensus        25 l~l~~g~~vei~v~~~   40 (82)
T PRK09798         25 LNLNIDDEVKIDLVDG   40 (82)
T ss_pred             cCCCCCCEEEEEEECC
Confidence            3456788888888764


No 295
>COG1596 Wza Periplasmic protein involved in polysaccharide export, contains    SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis]
Probab=22.90  E-value=92  Score=20.25  Aligned_cols=19  Identities=16%  Similarity=0.141  Sum_probs=15.4

Q ss_pred             ccEEEecCCEEEEEEEeCC
Q psy88             3 YPKNVCEGDRVVVDVRNSM   21 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~   21 (75)
                      ...++..||.|+|++.=.-
T Consensus        44 ~~y~lg~GD~l~I~v~e~~   62 (239)
T COG1596          44 SAYRLGPGDVLRITVFEAP   62 (239)
T ss_pred             CceeecCCCEEEEEecccC
Confidence            4578899999999987553


No 296
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=22.79  E-value=90  Score=16.33  Aligned_cols=29  Identities=14%  Similarity=0.289  Sum_probs=17.8

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +....+.+||.|.++=.=.....+..+.|
T Consensus         7 P~~~~v~~G~~V~L~C~~~~~p~~~~~~W   35 (78)
T cd05752           7 PPWTTIFQGEKVTLTCNGFNSPEQNSTQW   35 (78)
T ss_pred             CCCeEeeCCCCEEEEEeCCCCCCCccEEE
Confidence            34468899999998876332212334555


No 297
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=22.71  E-value=95  Score=15.44  Aligned_cols=15  Identities=27%  Similarity=0.266  Sum_probs=12.2

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||.+++.+.+-.
T Consensus        45 ~~~Gd~v~~~v~~~d   59 (73)
T cd05691          45 FKVGDEVEAKITNVD   59 (73)
T ss_pred             cCCCCEEEEEEEEEe
Confidence            578999999888754


No 298
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=22.58  E-value=93  Score=15.69  Aligned_cols=15  Identities=20%  Similarity=-0.051  Sum_probs=12.3

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      .+.||.+++.+.+..
T Consensus        48 ~~~Gd~v~~~V~~~d   62 (73)
T cd05706          48 FKKNDIVRACVLSVD   62 (73)
T ss_pred             cCCCCEEEEEEEEEe
Confidence            578999999988754


No 299
>TIGR03027 pepcterm_export putative polysaccharide export protein, PEP-CTERM sytem-associated. This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by Pfam model pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system.
Probab=22.42  E-value=69  Score=19.38  Aligned_cols=17  Identities=18%  Similarity=0.348  Sum_probs=14.0

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      ++..||.+.|.+....+
T Consensus         2 ~l~pGD~l~i~v~~~~~   18 (165)
T TIGR03027         2 VIGPGDSLNINVWRNPE   18 (165)
T ss_pred             CcCCCCEEEEEEcCCcc
Confidence            46789999999998643


No 300
>PRK08053 sulfur carrier protein ThiS; Provisional
Probab=22.23  E-value=56  Score=16.67  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=8.5

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ..+++||+|+|-
T Consensus        49 ~~L~~gD~Ieii   60 (66)
T PRK08053         49 HIVQDGDQILLF   60 (66)
T ss_pred             cccCCCCEEEEE
Confidence            457788888763


No 301
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=22.23  E-value=96  Score=15.45  Aligned_cols=16  Identities=13%  Similarity=-0.078  Sum_probs=12.7

Q ss_pred             EecCCEEEEEEEeCCC
Q psy88             7 VCEGDRVVVDVRNSMD   22 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~   22 (75)
                      ++.||.+++.+.+...
T Consensus        45 ~~~Gd~v~~~v~~~d~   60 (68)
T cd05707          45 FKVGQLVKGKIVSIDP   60 (68)
T ss_pred             cCCCCEEEEEEEEEeC
Confidence            5789999999887643


No 302
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.
Probab=22.19  E-value=59  Score=17.39  Aligned_cols=11  Identities=45%  Similarity=0.549  Sum_probs=8.8

Q ss_pred             EEecCCEEEEE
Q psy88             6 NVCEGDRVVVD   16 (75)
Q Consensus         6 ~~~~Gd~v~i~   16 (75)
                      .++.||.|+|+
T Consensus        44 ~~~~Gd~V~vt   54 (78)
T cd04486          44 DVAVGDLVRVT   54 (78)
T ss_pred             CCCCCCEEEEE
Confidence            45789999986


No 303
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 4 (hs4). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=22.14  E-value=93  Score=15.94  Aligned_cols=16  Identities=6%  Similarity=-0.062  Sum_probs=12.7

Q ss_pred             EecCCEEEEEEEeCCC
Q psy88             7 VCEGDRVVVDVRNSMD   22 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~   22 (75)
                      ++.||.+++.+.+-..
T Consensus        47 ~~vG~~v~~kV~~id~   62 (71)
T cd05696          47 FKAGTTHKARIIGYSP   62 (71)
T ss_pred             cCCCCEEEEEEEEEeC
Confidence            6789999999886543


No 304
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=22.13  E-value=1.3e+02  Score=15.46  Aligned_cols=29  Identities=21%  Similarity=0.254  Sum_probs=19.4

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+.+|+.+++.=.-........+.|
T Consensus         8 p~~~~v~~G~~v~L~C~~~~~~~~~~i~W   36 (85)
T cd05754           8 PRSQEVRPGADVSFICRAKSKSPAYTLVW   36 (85)
T ss_pred             CCceEEcCCCCEEEEEEcCCCCCCcEEEE
Confidence            45678899999998876432213456777


No 305
>PF12790 T6SS-SciN:  Type VI secretion lipoprotein;  InterPro: IPR017734 This entry represents a family of lipoproteins associated with IAHP-related loci, thought to be type VI secretion system protein []. ; PDB: 3RX9_A.
Probab=22.03  E-value=92  Score=18.39  Aligned_cols=17  Identities=6%  Similarity=0.161  Sum_probs=11.2

Q ss_pred             ccccCCCCEEEEEEc-CC
Q psy88            49 QCPITQGNTFRYQFT-AN   65 (75)
Q Consensus        49 ~~~i~pG~~~~y~~~-~~   65 (75)
                      +.-+.||++.++.+. +.
T Consensus        82 e~~l~Pg~~~~~~~~~~~   99 (142)
T PF12790_consen   82 EFVLQPGESRTLTLDRDP   99 (142)
T ss_dssp             EEEE-TT-EEEEEEE--T
T ss_pred             EEEECCCCcEeeeEccCC
Confidence            344899999999998 44


No 306
>PF12945 YcgR_2:  Flagellar protein YcgR; PDB: 2RDE_B 1YLN_A 3KYG_A.
Probab=21.96  E-value=99  Score=16.06  Aligned_cols=60  Identities=13%  Similarity=0.293  Sum_probs=26.8

Q ss_pred             EecCCEEEEEEEeCCCCCC--ceEEeCCcccc-----CCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEc
Q psy88             7 VCEGDRVVVDVRNSMDGLE--NTIHWHGIHQR-----GTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWH   72 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~~~~--~~iH~HG~~~~-----~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH   72 (75)
                      ++.|+.|+|.+.|... ..  ..--..|....     ..|..+|.    ..++..|+.....+. +.. .|-+-
T Consensus         1 L~iG~~i~i~i~~~~~-~~~~y~S~v~g~~~~~~l~i~~P~~~g~----~~~l~~g~~v~v~~~~~~~-~y~F~   68 (87)
T PF12945_consen    1 LKIGQKIEIEITNPTG-EKGRYKSRVIGIDDDRYLIISMPMEKGR----PIPLREGEEVIVRFISEDG-VYAFK   68 (87)
T ss_dssp             --TT-EEEEEEE-TTS--EEEEEEEEEEEETTTEEEEE---CCHH----HCCS-TT-EEEEEEEE-SC-EEEEE
T ss_pred             CCCCCEEEEEEECCCC-ceEEEEEEEEEECCCCEEEEEcCccCCc----EEeecCCCEEEEEEEECCe-EEEEE
Confidence            3679999999987763 22  22233333221     01112222    234778888888887 332 55443


No 307
>PF13157 DUF3992:  Protein of unknown function (DUF3992)
Probab=21.91  E-value=77  Score=17.88  Aligned_cols=13  Identities=15%  Similarity=0.424  Sum_probs=11.6

Q ss_pred             ccCCCCEEEEEEc
Q psy88            51 PITQGNTFRYQFT   63 (75)
Q Consensus        51 ~i~pG~~~~y~~~   63 (75)
                      -++||++..|.++
T Consensus        57 tV~pG~S~S~T~~   69 (92)
T PF13157_consen   57 TVQPGNSRSFTVR   69 (92)
T ss_pred             EECCCceEEEEec
Confidence            4899999999987


No 308
>cd09219 TLP-F thaumatin-like proteins: basidiomycete homologs. This subfamily is represented by Lentinula edodes TLG1, a thaumatin-like protein (TLP), as well as, other basidiomycete homologs.  In general, TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. TLG1 TLP is involved in lentinan degradation and fruiting body senescence.  TLG1 expressed in Escherichia coli and Aspergillus oryzae exhibited beta-1,3-glucanase activity and demonstrated lentinan degrading activity. TLG1 is proposed to be involved in lentinan and cell wall degradation during senescence following harvest and spore diffusion. TLPs are three-domain, crescent-fold structures with either an electronegative, electropositive, or neutral cleft occurring between domains I and II. TLG1 from Lentinula edodes contains the required acidic amino acids conserved in the appropriate positions to possess an electronegative cleft. TLPs within this subfamily contain 13 conserve
Probab=21.89  E-value=2.5e+02  Score=18.53  Aligned_cols=21  Identities=14%  Similarity=0.275  Sum_probs=16.1

Q ss_pred             cccCCCCEEEEEEc-CC-CeeeE
Q psy88            50 CPITQGNTFRYQFT-AN-AGTHF   70 (75)
Q Consensus        50 ~~i~pG~~~~y~~~-~~-~Gt~~   70 (75)
                      ..+.||+++++..+ .- +|..|
T Consensus        32 f~L~pg~s~~i~vp~~w~~GRiW   54 (229)
T cd09219          32 WEAAAGGQVEFTVPDNWTAGRIW   54 (229)
T ss_pred             EecCCCCeEEEECCCCCccccee
Confidence            34889999999998 43 37766


No 309
>TIGR02756 TraK_Ftype type-F conjugative transfer system secretin TraK. The TraK protein is predicted to interact with the TraV and TraB proteins as part of the scaffold which extends from the inner membrane, through the periplasm to the cell envelope and through which the F-type conjugative pilus passes. TraK is homologous to the P-type IV secretion system protein TrbG, the Ti-type protein VirB9 and the I-type TraN protein. The protein is related to the secretin family especially the HrcC subgroup of the type III secretion system. The protein is hypothesized to oligomerize to form a ring structure akin to other secretins.
Probab=21.85  E-value=1.1e+02  Score=19.92  Aligned_cols=21  Identities=5%  Similarity=0.215  Sum_probs=18.2

Q ss_pred             cccEEEecCCEEEEEEEeCCC
Q psy88             2 LYPKNVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~   22 (75)
                      .++|.+..||++.+.+.|...
T Consensus        19 ~~~i~~~~~~~v~~~lS~~~~   39 (232)
T TIGR02756        19 AVTVTFANGEDIAIALSSTDP   39 (232)
T ss_pred             ceEEEccCCCeEEEEEecCCC
Confidence            468899999999999998754


No 310
>cd09218 TLP-PA allergenic/antifungal thaumatin-like proteins: plant and animal homologs. This subfamily is represented by the thaumatin-like proteins (TLPs), Cherry Allergen Pru Av 2 TLP, Peach PpAZ44 TLP (a propylene-induced TLP in abscission), the Caenorhabditis elegans thaumatin family member (thn-6), and other plant and animal homologs. TLPs are involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Due to their inducible expression by environmental stresses such as pathogen/pest attack, drought and cold, plant TLPs are classified as the pathogenesis-related (PR) protein family 5 (PR5). Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun a 3; Arizona cypress, Cup a3; Japanese cedar, Cry j3). TLPs are three-domain, crescent-fold structures with either an electronegative, ele
Probab=21.83  E-value=2.4e+02  Score=18.39  Aligned_cols=22  Identities=9%  Similarity=0.141  Sum_probs=17.1

Q ss_pred             cccCCCCEEEEEEc-CCCeeeEE
Q psy88            50 CPITQGNTFRYQFT-ANAGTHFW   71 (75)
Q Consensus        50 ~~i~pG~~~~y~~~-~~~Gt~~Y   71 (75)
                      ..+.||+++++..+ .-.|.+|=
T Consensus        30 f~L~~g~s~~~~vp~~WsGriWa   52 (219)
T cd09218          30 FELAPGQSRTIDAPSGWSGRFWG   52 (219)
T ss_pred             EEcCCCCeEEEeCCCCcceeeee
Confidence            45889999999988 65677763


No 311
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=21.83  E-value=1.4e+02  Score=15.71  Aligned_cols=27  Identities=26%  Similarity=0.409  Sum_probs=19.8

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      .++.+.+|+.+.+...=... .+-.+.|
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~-P~P~v~W   29 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGE-PAPTVTW   29 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeec-CCCeEEE
Confidence            46889999999998875544 3446666


No 312
>PRK00004 rplX 50S ribosomal protein L24; Reviewed
Probab=21.83  E-value=59  Score=18.58  Aligned_cols=15  Identities=27%  Similarity=0.401  Sum_probs=10.6

Q ss_pred             EEEecCCEEEEEEEe
Q psy88             5 KNVCEGDRVVVDVRN   19 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N   19 (75)
                      +.++.||+|.|---+
T Consensus         3 ~~i~kGD~V~Vi~G~   17 (105)
T PRK00004          3 MKIKKGDTVIVIAGK   17 (105)
T ss_pred             CcccCCCEEEEeEcC
Confidence            467888988876443


No 313
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein. This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.
Probab=21.79  E-value=86  Score=16.51  Aligned_cols=16  Identities=13%  Similarity=0.196  Sum_probs=13.1

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .|++..|.+|+|++.-
T Consensus        21 ~i~~~~g~~i~l~f~~   36 (102)
T smart00042       21 TIRAPPGYRIELQFTD   36 (102)
T ss_pred             EEECCCCeEEEEEEEE
Confidence            5788889999998873


No 314
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 6 (hs6) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=21.74  E-value=1e+02  Score=15.36  Aligned_cols=15  Identities=27%  Similarity=0.142  Sum_probs=12.0

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||.+++.+..-.
T Consensus        45 ~~~G~~i~v~v~~~d   59 (70)
T cd05698          45 FRVGQVVKVKVLSCD   59 (70)
T ss_pred             ccCCCEEEEEEEEEc
Confidence            678999999987643


No 315
>PRK06488 sulfur carrier protein ThiS; Validated
Probab=21.71  E-value=59  Score=16.44  Aligned_cols=12  Identities=33%  Similarity=0.415  Sum_probs=8.8

Q ss_pred             EEEecCCEEEEE
Q psy88             5 KNVCEGDRVVVD   16 (75)
Q Consensus         5 i~~~~Gd~v~i~   16 (75)
                      ..++.||+|+|-
T Consensus        48 ~~L~dgD~Ieiv   59 (65)
T PRK06488         48 FVLHEGDRIEIL   59 (65)
T ss_pred             cccCCCCEEEEE
Confidence            457889988873


No 316
>cd09215 Thaumatin-like the sweet-tasting protein, thaumatin, and thaumatin-like proteins involved in host defense. This family is represented by the sweet-tasting protein thaumatin from the African berry Thaumatococcus daniellii and thaumatin-like proteins (TLPs) involved in host defense and a wide range of developmental processes in fungi, plants, and animals. Plant TLPs are classified as pathogenesis-related (PR) protein family 5 (PR5), their expression is induced by environmental stresses such as pathogen/pest attack, drought and cold. TLPs included in this family are such proteins as zeamatin, found in high concentrations in cereal seeds; osmotin, a salt-induced protein in osmotically stressed plants; and PpAZ44, a propylene-induced TLP in abscission of young fruit. Several members of the plant TLP family have been reported as food allergens from fruits (i.e., cherry, Pru av 2; bell pepper, Cap a1; tomatoes, Lyc e NP24) and pollen allergens from conifers (i.e., mountain cedar, Jun 
Probab=21.70  E-value=2.1e+02  Score=17.65  Aligned_cols=21  Identities=14%  Similarity=0.325  Sum_probs=16.4

Q ss_pred             cccCCCCEEEEEEc-CCCeeeE
Q psy88            50 CPITQGNTFRYQFT-ANAGTHF   70 (75)
Q Consensus        50 ~~i~pG~~~~y~~~-~~~Gt~~   70 (75)
                      ..+.||+++++..+ .-.|..|
T Consensus        28 f~L~~g~s~~~~~p~~wsGriW   49 (157)
T cd09215          28 FELNPGETKSFDVSAGWQGRIW   49 (157)
T ss_pred             EecCCCCeeEEecCCCCeEeee
Confidence            34889999999988 6567666


No 317
>PF13509 S1_2:  S1 domain; PDB: 3GO5_A.
Probab=21.58  E-value=1.3e+02  Score=15.13  Aligned_cols=17  Identities=29%  Similarity=0.172  Sum_probs=11.0

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      .++.||.|.+-+.....
T Consensus        37 ~~~~Gd~v~VFvY~D~~   53 (61)
T PF13509_consen   37 PLKVGDEVEVFVYLDKE   53 (61)
T ss_dssp             ---TTSEEEEEEEE-TT
T ss_pred             CCCCCCEEEEEEEECCC
Confidence            57889999999887654


No 318
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=21.40  E-value=50  Score=18.05  Aligned_cols=15  Identities=7%  Similarity=0.222  Sum_probs=8.9

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      +++.||+|.+.+...
T Consensus        42 ~L~pGq~l~f~~d~~   56 (85)
T PF04225_consen   42 RLKPGQTLEFQLDED   56 (85)
T ss_dssp             G--TT-EEEEEE-TT
T ss_pred             hCCCCCEEEEEECCC
Confidence            578999999988654


No 319
>PF08206 OB_RNB:  Ribonuclease B OB domain;  InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies.; PDB: 2ID0_D 2IX1_A 2IX0_A.
Probab=21.22  E-value=77  Score=15.80  Aligned_cols=13  Identities=31%  Similarity=0.672  Sum_probs=9.5

Q ss_pred             EecCCEEEEEEEe
Q psy88             7 VCEGDRVVVDVRN   19 (75)
Q Consensus         7 ~~~Gd~v~i~~~N   19 (75)
                      +..||+|.+.+..
T Consensus        32 A~~gD~V~v~i~~   44 (58)
T PF08206_consen   32 AMDGDKVLVRITP   44 (58)
T ss_dssp             S-TT-EEEEEEEE
T ss_pred             CCCCCEEEEEEec
Confidence            4569999999988


No 320
>PRK13782 phosphocarrier protein Chr; Provisional
Probab=21.20  E-value=50  Score=17.74  Aligned_cols=17  Identities=6%  Similarity=0.147  Sum_probs=13.0

Q ss_pred             ccEEEecCCEEEEEEEe
Q psy88             3 YPKNVCEGDRVVVDVRN   19 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N   19 (75)
                      +.|-+++||.|+|...-
T Consensus        51 lsLg~~~g~~v~v~~~G   67 (82)
T PRK13782         51 MSLAIGTGSMITIITEG   67 (82)
T ss_pred             HhcCCCCCCEEEEEEeC
Confidence            45678889999988654


No 321
>TIGR03630 arch_S17P archaeal ribosomal protein S17P. This model describes exclusively the archaeal ribosomal protein S17P. It excludes homologous ribosomal proteins S11 from eukaryotes and S17 from bacteria.
Probab=21.09  E-value=56  Score=18.84  Aligned_cols=13  Identities=38%  Similarity=0.539  Sum_probs=10.2

Q ss_pred             EEEecCCEEEEEE
Q psy88             5 KNVCEGDRVVVDV   17 (75)
Q Consensus         5 i~~~~Gd~v~i~~   17 (75)
                      ..++.||+|+|.=
T Consensus        74 n~~kvGD~V~I~E   86 (102)
T TIGR03630        74 IDVKEGDIVIIGE   86 (102)
T ss_pred             CCCCCCCEEEEEE
Confidence            3578999999863


No 322
>PF02933 CDC48_2:  Cell division protein 48 (CDC48), domain 2;  InterPro: IPR004201 This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C terminus. The VAT-N domain found in AAA ATPases (IPR003959 from INTERPRO) is a substrate 185-residue recognition domain [].; GO: 0005524 ATP binding; PDB: 1QDN_B 1QCS_A 1CR5_C 3QQ8_A 3HU2_A 3HU1_E 3HU3_A 3QWZ_A 3TIW_B 3QQ7_A ....
Probab=21.09  E-value=1.1e+02  Score=15.44  Aligned_cols=14  Identities=29%  Similarity=0.472  Sum_probs=9.5

Q ss_pred             EEEecCCEEEEEEE
Q psy88             5 KNVCEGDRVVVDVR   18 (75)
Q Consensus         5 i~~~~Gd~v~i~~~   18 (75)
                      .-+.+||.|.+.+.
T Consensus        17 ~pv~~Gd~i~~~~~   30 (64)
T PF02933_consen   17 RPVTKGDTIVFPFF   30 (64)
T ss_dssp             EEEETT-EEEEEET
T ss_pred             CCccCCCEEEEEeC
Confidence            34678888888775


No 323
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The  N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide.  The DEAH-box RNA helicases are thought to play key roles in pre-mRNA splicing and DHX8 facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. DHX8 is also known as HRH1 (human RNA helicase 1) in Homo sapiens and PRP22 in Saccharomyces cerevisiae.
Probab=20.99  E-value=1.3e+02  Score=15.48  Aligned_cols=15  Identities=33%  Similarity=0.328  Sum_probs=11.7

Q ss_pred             EEecCCEEEEEEEeC
Q psy88             6 NVCEGDRVVVDVRNS   20 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~   20 (75)
                      ..+.||.|++.+...
T Consensus        48 ~~~~Gd~v~v~v~~v   62 (79)
T cd05684          48 VVKRGQKVKVKVISI   62 (79)
T ss_pred             eeCCCCEEEEEEEEE
Confidence            358899999987764


No 324
>PRK08572 rps17p 30S ribosomal protein S17P; Reviewed
Probab=20.95  E-value=55  Score=19.07  Aligned_cols=13  Identities=23%  Similarity=0.312  Sum_probs=10.3

Q ss_pred             EEEecCCEEEEEE
Q psy88             5 KNVCEGDRVVVDV   17 (75)
Q Consensus         5 i~~~~Gd~v~i~~   17 (75)
                      ..++.||.|+|.=
T Consensus        76 n~~kvGD~V~I~E   88 (108)
T PRK08572         76 IDAKVGDKVKIAE   88 (108)
T ss_pred             CCCCCCCEEEEEE
Confidence            4588999999863


No 325
>cd00915 MD-1_MD-2 MD-1 and MD-2 are cofactors required for LPS signaling through cell surface receptors. MD-2 and its binding partner, Toll-like receptor 4 (TLR4), are essential for the innate immune responses of mammalian cells to bacterial lipopolysaccharide (LPS); MD-2 directly binds the lipid A moiety of LPS. The TLR4-like receptor, RP105, which mediates LPS-induced lymphocyte proliferation, interacts with MD-1; MD-1 enhances RP105-mediated LPS-induced growth of B cells. These proteins belong to the ML domain family.
Probab=20.85  E-value=1.1e+02  Score=18.33  Aligned_cols=14  Identities=29%  Similarity=0.544  Sum_probs=13.2

Q ss_pred             cccccCCCCEEEEE
Q psy88            48 TQCPITQGNTFRYQ   61 (75)
Q Consensus        48 ~~~~i~pG~~~~y~   61 (75)
                      +.||+..|++.+|.
T Consensus        81 s~CP~~kGet~~Y~   94 (130)
T cd00915          81 SFCGALKGETVYYV   94 (130)
T ss_pred             ccCCccCCceEEEe
Confidence            68999999999999


No 326
>PF14801 GCD14_N:  tRNA methyltransferase complex GCD14 subunit N-term; PDB: 1I9G_A.
Probab=20.80  E-value=78  Score=16.18  Aligned_cols=10  Identities=40%  Similarity=0.587  Sum_probs=5.0

Q ss_pred             EecCCEEEEE
Q psy88             7 VCEGDRVVVD   16 (75)
Q Consensus         7 ~~~Gd~v~i~   16 (75)
                      ++.||+|.++
T Consensus         6 f~~GdrVQlT   15 (54)
T PF14801_consen    6 FRAGDRVQLT   15 (54)
T ss_dssp             --TT-EEEEE
T ss_pred             CCCCCEEEEc
Confidence            4678887765


No 327
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.
Probab=20.76  E-value=1.1e+02  Score=16.16  Aligned_cols=17  Identities=12%  Similarity=0.133  Sum_probs=14.1

Q ss_pred             cEEEecCCEEEEEEEeC
Q psy88             4 PKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N~   20 (75)
                      .|++..|..|+|.|..-
T Consensus        31 ~i~~~~g~~i~l~f~~~   47 (113)
T cd00041          31 TIEAPPGYRIRLTFEDF   47 (113)
T ss_pred             EEEcCCCCEEEEEEeCc
Confidence            58889999999999853


No 328
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the human SOD1 gene causes familial amyotrophic lateral sclerosis (Lou Gehrig's disease). Cytoplasmic and periplasmic SODs exist as dimers, whereas chloroplastic and extracellular enzymes exist as tetramers. Structure supports independent functional evolution in prokaryotes (P-class) and eukaryotes (E-class) [PMID:.8176730].
Probab=20.59  E-value=2e+02  Score=17.04  Aligned_cols=24  Identities=13%  Similarity=0.106  Sum_probs=15.4

Q ss_pred             CCEEEEEEEeCCCCCCceEEeCCcc
Q psy88            10 GDRVVVDVRNSMDGLENTIHWHGIH   34 (75)
Q Consensus        10 Gd~v~i~~~N~~~~~~~~iH~HG~~   34 (75)
                      +-.|.+++.+-.+ -.+.+|.|-.-
T Consensus        26 ~v~v~~~l~GL~p-G~hg~HIHe~G   49 (144)
T cd00305          26 GVTITGELSGLTP-GLHGFHIHEFG   49 (144)
T ss_pred             CEEEEEEEECCCC-CceeEEEEecC
Confidence            4556666666554 57788887643


No 329
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=20.57  E-value=1e+02  Score=15.82  Aligned_cols=15  Identities=13%  Similarity=0.007  Sum_probs=12.2

Q ss_pred             EecCCEEEEEEEeCC
Q psy88             7 VCEGDRVVVDVRNSM   21 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~   21 (75)
                      ++.||.|++.+.+..
T Consensus        49 ~~~Gd~v~~kV~~~~   63 (72)
T cd05704          49 FKPGKIVRCCILSKK   63 (72)
T ss_pred             CCCCCEEEEEEEEec
Confidence            477999999988764


No 330
>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 3 (hs3). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=20.51  E-value=1.1e+02  Score=15.50  Aligned_cols=17  Identities=18%  Similarity=0.128  Sum_probs=13.1

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      +++.||.+.+.+.+-.+
T Consensus        42 ~~~~G~~i~~kVi~id~   58 (66)
T cd05695          42 TYKEGQKVRARILYVDP   58 (66)
T ss_pred             CcCCCCEEEEEEEEEeC
Confidence            37889999998886543


No 331
>PF04693 DDE_Tnp_2:  Archaeal putative transposase ISC1217;  InterPro: IPR006783 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element. Transposases have been grouped into various families [, , ]. This family includes the putative transposase ISC1217 from archaebacteria. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=20.49  E-value=48  Score=22.97  Aligned_cols=12  Identities=25%  Similarity=0.299  Sum_probs=9.8

Q ss_pred             CCCeeeEEccCC
Q psy88            64 ANAGTHFWHAHT   75 (75)
Q Consensus        64 ~~~Gt~~YH~H~   75 (75)
                      ..-|++||||++
T Consensus       105 s~~g~~~~~c~~  116 (327)
T PF04693_consen  105 SRNGTYAFYCRT  116 (327)
T ss_pred             ccCCcEEEEecc
Confidence            467999999974


No 332
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein, and Rrp40 and Csl4 proteins, also represented in this group, are subunits of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=20.41  E-value=99  Score=16.14  Aligned_cols=16  Identities=25%  Similarity=0.304  Sum_probs=13.5

Q ss_pred             EecCCEEEEEEEeCCC
Q psy88             7 VCEGDRVVVDVRNSMD   22 (75)
Q Consensus         7 ~~~Gd~v~i~~~N~~~   22 (75)
                      ++.||.+...+.+...
T Consensus        51 ~~~GD~i~~~V~~~~~   66 (82)
T cd04454          51 LQPGDLILAKVISLGD   66 (82)
T ss_pred             CCCCCEEEEEEEEeCC
Confidence            6899999999998654


No 333
>PTZ00194 60S ribosomal protein L26; Provisional
Probab=20.40  E-value=85  Score=19.21  Aligned_cols=16  Identities=25%  Similarity=0.198  Sum_probs=11.5

Q ss_pred             cEEEecCCEEEEEEEe
Q psy88             4 PKNVCEGDRVVVDVRN   19 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~N   19 (75)
                      .+.++.||+|.|.--.
T Consensus        44 s~~IkkGD~V~Vi~Gk   59 (143)
T PTZ00194         44 SMPVRKDDEVMVVRGH   59 (143)
T ss_pred             cceeecCCEEEEecCC
Confidence            3578899999886443


No 334
>cd08548 Type_I_cohesin_like Type I cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I cohesins; their interactions with dockerin mediate assembly of a range of dockerin-borne enzymes to the complex.
Probab=20.34  E-value=1.3e+02  Score=17.67  Aligned_cols=15  Identities=33%  Similarity=0.299  Sum_probs=11.5

Q ss_pred             cEEEecCCEEEEEEE
Q psy88             4 PKNVCEGDRVVVDVR   18 (75)
Q Consensus         4 ~i~~~~Gd~v~i~~~   18 (75)
                      ...++.||+|.|-+.
T Consensus         7 ~v~~~~G~tv~VpV~   21 (135)
T cd08548           7 SVSGKPGDTVTVPVT   21 (135)
T ss_pred             cEEecCCCEEEEEEE
Confidence            357889999887765


No 335
>PF00963 Cohesin:  Cohesin domain;  InterPro: IPR002102 Cohesin domains interact with a complementary domain, termed the dockerin domain (see IPR002105 from INTERPRO). The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome []. The scaffoldin component of the cellulolytic bacterium Clostridium thermocellum is a non-hydrolytic protein which organises the hydrolytic enzymes in a large complex, called the cellulosome. Scaffoldin comprises a series of functional domains, amongst which is a single cellulose-binding domain and nine cohesin domains which are responsible for integrating the individual enzymatic subunits into the complex.; GO: 0030246 carbohydrate binding, 0000272 polysaccharide catabolic process; PDB: 2BM3_A 3P0D_I 3KCP_A 2B59_A 3L8Q_B 3FNK_C 3GHP_B 2CCL_A 1ANU_A 1OHZ_A ....
Probab=20.30  E-value=1.2e+02  Score=17.50  Aligned_cols=14  Identities=29%  Similarity=0.356  Sum_probs=10.8

Q ss_pred             EEEecCCEEEEEEE
Q psy88             5 KNVCEGDRVVVDVR   18 (75)
Q Consensus         5 i~~~~Gd~v~i~~~   18 (75)
                      ..++.||+|.|.+.
T Consensus         8 ~~a~~G~tv~V~V~   21 (141)
T PF00963_consen    8 VSAKPGETVTVPVN   21 (141)
T ss_dssp             CEE-TTSEEEEEEE
T ss_pred             ceECCCCEEEEEEE
Confidence            46789999998887


No 336
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=20.25  E-value=1.7e+02  Score=16.05  Aligned_cols=26  Identities=19%  Similarity=0.247  Sum_probs=19.5

Q ss_pred             EEEecCCEEEEEEEeCCCCCCceEEeC
Q psy88             5 KNVCEGDRVVVDVRNSMDGLENTIHWH   31 (75)
Q Consensus         5 i~~~~Gd~v~i~~~N~~~~~~~~iH~H   31 (75)
                      +.+++||+|.+.=.=... ....|+|.
T Consensus         2 v~~~~G~~VtL~C~~s~~-~~~~i~W~   27 (94)
T cd07690           2 VLGKKGDTAELPCTASQK-KSIQFHWK   27 (94)
T ss_pred             eEeeCCCCEEEEEEeCCC-CCcEEEEE
Confidence            578999999998765433 45678885


No 337
>COG1278 CspC Cold shock proteins [Transcription]
Probab=20.18  E-value=95  Score=16.50  Aligned_cols=17  Identities=24%  Similarity=0.431  Sum_probs=13.6

Q ss_pred             EEecCCEEEEEEEeCCC
Q psy88             6 NVCEGDRVVVDVRNSMD   22 (75)
Q Consensus         6 ~~~~Gd~v~i~~~N~~~   22 (75)
                      ++++||+|.+.+.+...
T Consensus        41 ~L~eGQ~V~f~~~~g~k   57 (67)
T COG1278          41 TLREGQKVEFEVEQGRK   57 (67)
T ss_pred             ccCCCCEEEEEEecCCC
Confidence            46789999999888653


No 338
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=20.14  E-value=1.6e+02  Score=15.56  Aligned_cols=28  Identities=18%  Similarity=0.385  Sum_probs=19.6

Q ss_pred             ccEEEecCCEEEEEEEeCCCCCCceEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNSMDGLENTIHWH   31 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~~~~~~~~iH~H   31 (75)
                      ..+.+.+|+.+.++=.=... ....+.|-
T Consensus         5 ~~~~v~~G~~v~L~C~~~~~-~~~~v~W~   32 (95)
T cd05717           5 QDVTVVEGGTATLKCRVKNN-DNSSLQWS   32 (95)
T ss_pred             CcEEEcCCCCEEEEEEECCC-CCceEEEe
Confidence            46789999999997654333 24578883


No 339
>PRK13780 phosphocarrier protein HPr; Provisional
Probab=20.04  E-value=56  Score=17.96  Aligned_cols=18  Identities=11%  Similarity=0.303  Sum_probs=13.8

Q ss_pred             ccEEEecCCEEEEEEEeC
Q psy88             3 YPKNVCEGDRVVVDVRNS   20 (75)
Q Consensus         3 ~~i~~~~Gd~v~i~~~N~   20 (75)
                      +.|-++.||.|+|...-.
T Consensus        51 m~Lg~~~G~~v~i~a~G~   68 (88)
T PRK13780         51 MSLGVGQGADITISAEGA   68 (88)
T ss_pred             HhcCCCCCCEEEEEEeCc
Confidence            456788999999987643


No 340
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=20.02  E-value=1.6e+02  Score=15.55  Aligned_cols=29  Identities=10%  Similarity=0.006  Sum_probs=20.0

Q ss_pred             cccEEEecCCEEEEEEEeCCCCCCceEEe
Q psy88             2 LYPKNVCEGDRVVVDVRNSMDGLENTIHW   30 (75)
Q Consensus         2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~   30 (75)
                      +..+.+.+|+.+.+.-.=.....|..|.|
T Consensus         5 P~~~~v~~G~~v~l~C~a~G~P~P~~I~W   33 (81)
T cd05749           5 PEDLSVTANTPFNLTCQAVGPPEPVEILW   33 (81)
T ss_pred             CCceEEcCCCCEEEEEEeeeecCCeEEEE
Confidence            34578899999999887544313445777


Done!