Diaphorina citri psyllid: psy880

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---

MMEDESMLDTEWEDFDKLMTEYKRRRMHVTASPLLHRRHSSKHQTQSQSFYPCPPPANLGESDELQEYDASPGMYGRYTKELGEFAKEEAKKLNKKRKKDRLQADELRNKYRGRCATKFAAVFRFVWKHTFAKLGEDWVFLALLGIIMATISFFMDRGINIIGRSSGIPEMKTILRGVALKEYLTFNTLVAKIIGLTATLGSGLPLGKEGPFVHIASIVATLLSKLVTSFQGIYENESRNSEMLAAACAVGVGSCFGAPIGAT

cccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccccccccccccc

**********EWEDFD***************************************************YDASPGMYGRYTKELGEFAKEEAKKL**********ADELRNKYRGRCATKFAAVFRFVWKHTFAKLGEDWVFLALLGIIMATISFFMDRGINIIGRSSGIPEMKTILRGVALKEYLTFNTLVAKIIGLTATLGSGLPLGKEGPFVHIASIVATLLSKLVTSFQGIYENESRNSEMLAAACAVGVGSCFGAPIGAT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMEDESMLDTEWEDFDKLMTEYKRRRMHVTASPLLHRRHSSKHQTQSQSFYPCPPPANLGESDELQEYDASPGMYGRYTKELGExxxxxxxxxxxxxxxxxxxxxxxxxxYRGRCATKFAAVFRFVWKHTFAKLGEDWVFLALLGIIMATISFFMDRGINIIGRSSGIPEMKTILRGVALKEYLTFNTLVAKIIGLTATLGSGLPLGKEGPFVHIASIVATLLSKLVTSFQGIYENESRNSEMLAAACAVGVGSCFGAPIGAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chloride channel protein 2	Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.	confident	P35525
Chloride channel protein 2	Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.	confident	P51788
Chloride channel protein 2	Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.	confident	Q9VGH7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005575 [CC]	cellular_component	probable

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ORG, chain A
Confidence level:very confident
Coverage over the Query: 111-263
View the alignment between query and template
View the model in PyMOL