Diaphorina citri psyllid: psy8817

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MSWFFPFSDSWKKRACRYLLQRYLGQFLEEKLTLDQLSVDLYNGTGSVSDVCLDVQLEEEGMSLSSSKISWTVSRGEAAEWMLKSPSLKDLER
ccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEECccEEEEEEEECcHHHHHHHccccccccCEEEEEEEEEEEEEEccccccccc
*SWFFPFSDSWKKRACRYLLQRYLGQFLEEKLTLDQLSVDLYNGTGSVSDVCLDVQLEEEGMSLSSSKISWTVSRGEAAEWMLKSPSLKDL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWFFPFSDSWKKRACRYLLQRYLGQFLEEKLTLDQLSVDLYNGTGSVSDVCLDVQLEEEGMSLSSSKISWTVSRGEAAEWMLKSPSLKDLER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy-related protein 2 homolog B confidentQ96BY7
Autophagy-related protein 2 homolog B confidentQ80XK6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted