Query psy8830
Match_columns 70
No_of_seqs 123 out of 826
Neff 6.7
Searched_HMMs 46136
Date Fri Aug 16 20:16:53 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy8830.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8830hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 cd08156 catalase_clade_3 Clade 99.7 2.8E-17 6.1E-22 119.3 3.9 67 1-69 324-392 (429)
2 cd08154 catalase_clade_1 Clade 99.7 4.8E-17 1E-21 119.1 4.1 67 1-69 366-432 (469)
3 PLN02609 catalase 99.6 4.8E-16 1E-20 114.3 4.3 67 1-69 381-447 (492)
4 cd08155 catalase_clade_2 Clade 99.6 5.3E-16 1.1E-20 113.0 4.1 67 1-69 332-405 (443)
5 KOG0047|consensus 99.6 1.3E-15 2.8E-20 110.5 3.3 68 1-69 389-458 (505)
6 cd08157 catalase_fungal Fungal 99.6 2.9E-15 6.4E-20 109.3 3.9 68 1-69 342-413 (451)
7 cd00328 catalase Catalase heme 99.5 2.3E-14 5E-19 104.3 3.7 67 1-69 324-395 (433)
8 COG0753 KatE Catalase [Inorgan 99.4 6.1E-14 1.3E-18 102.6 2.9 67 1-69 380-450 (496)
9 PRK11249 katE hydroperoxidase 99.4 3.9E-13 8.4E-18 102.9 4.1 67 1-69 446-521 (752)
10 PF06628 Catalase-rel: Catalas 99.0 7.1E-11 1.5E-15 66.8 -0.8 29 39-69 1-29 (68)
11 cd01390 HMGB-UBF_HMG-box HMGB- 49.5 8.4 0.00018 20.1 0.7 15 52-67 35-49 (66)
12 PF13945 NST1: Salt tolerance 49.1 6.8 0.00015 26.2 0.4 17 52-69 107-123 (190)
13 PF07813 LTXXQ: LTXXQ motif fa 47.6 7.9 0.00017 21.8 0.5 16 52-68 81-96 (100)
14 smart00398 HMG high mobility g 46.9 7.2 0.00016 20.4 0.2 16 52-68 36-51 (70)
15 cd01389 MATA_HMG-box MATA_HMG- 42.2 13 0.00028 20.5 0.8 15 52-67 36-50 (77)
16 PF09011 HMG_box_2: HMG-box do 42.2 7.4 0.00016 21.3 -0.2 19 47-67 35-53 (73)
17 cd00084 HMG-box High Mobility 40.5 14 0.0003 19.0 0.7 15 52-67 35-49 (66)
18 KOG0527|consensus 38.0 12 0.00025 27.1 0.2 20 48-69 94-113 (331)
19 PTZ00199 high mobility group p 36.2 18 0.00039 21.0 0.8 15 52-67 59-73 (94)
20 cd01388 SOX-TCF_HMG-box SOX-TC 32.8 22 0.00048 19.3 0.8 15 52-67 36-50 (72)
21 PF00505 HMG_box: HMG (high mo 32.7 15 0.00032 19.3 0.0 15 52-67 35-49 (69)
22 PF12650 DUF3784: Domain of un 31.6 23 0.00049 20.5 0.7 11 56-67 26-36 (97)
23 PF14803 Nudix_N_2: Nudix N-te 30.2 9.2 0.0002 18.7 -1.0 13 58-70 13-25 (34)
24 PF05001 RNA_pol_Rpb1_R: RNA p 28.6 21 0.00046 14.2 0.1 9 8-16 3-11 (14)
25 PLN02417 dihydrodipicolinate s 27.7 23 0.00049 24.3 0.3 19 48-69 42-60 (280)
26 PF02071 NSF: Aromatic-di-Alan 27.5 11 0.00023 14.4 -0.8 9 47-56 4-12 (12)
27 PF00701 DHDPS: Dihydrodipicol 26.6 26 0.00056 23.9 0.4 16 52-69 45-60 (289)
28 cd00408 DHDPS-like Dihydrodipi 26.3 24 0.00052 23.8 0.2 19 48-69 38-56 (281)
29 PF11918 DUF3436: Domain of un 26.1 61 0.0013 17.6 1.7 17 10-26 19-35 (55)
30 cd00950 DHDPS Dihydrodipicolin 26.0 26 0.00056 23.8 0.3 16 52-69 44-59 (284)
31 PRK12751 cpxP periplasmic stre 24.7 32 0.00069 22.3 0.5 14 54-68 125-138 (162)
32 PF05494 Tol_Tol_Ttg2: Toluene 24.4 29 0.00062 21.9 0.3 16 53-69 49-64 (170)
33 TIGR03249 KdgD 5-dehydro-4-deo 23.8 28 0.00061 24.0 0.2 19 48-69 46-64 (296)
34 PRK10455 periplasmic protein; 23.6 33 0.00071 22.1 0.4 13 55-68 126-138 (161)
35 PF10293 DUF2405: Domain of un 23.5 17 0.00038 23.3 -0.9 25 44-69 114-138 (157)
36 cd00951 KDGDH 5-dehydro-4-deox 23.0 30 0.00064 23.8 0.1 16 52-69 44-59 (289)
37 PRK03170 dihydrodipicolinate s 22.9 31 0.00067 23.6 0.2 19 48-69 42-60 (292)
38 PRK04147 N-acetylneuraminate l 22.2 32 0.00069 23.7 0.2 16 52-69 48-63 (293)
39 cd00953 KDG_aldolase KDG (2-ke 21.4 33 0.00072 23.5 0.1 16 52-69 43-58 (279)
40 COG4107 PhnK ABC-type phosphon 20.6 38 0.00083 23.3 0.3 19 48-69 69-87 (258)
41 TIGR03481 HpnM hopanoid biosyn 20.5 36 0.00079 22.4 0.2 16 53-69 75-90 (198)
42 TIGR00674 dapA dihydrodipicoli 20.4 37 0.00081 23.2 0.2 16 52-69 42-57 (285)
43 PRK12750 cpxP periplasmic repr 20.1 38 0.00083 22.0 0.2 13 55-68 133-145 (170)
No 1
>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes.
Probab=99.67 E-value=2.8e-17 Score=119.26 Aligned_cols=67 Identities=34% Similarity=0.522 Sum_probs=60.5
Q ss_pred Ccc-cCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAI-DNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~-~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++ .|.++.|||+|||++++.+.+.+.+++..++|.+.|+.+. ++|||+| ||+|| |+|+++||+|||
T Consensus 324 m~~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~g~~~r~~~~~~~d~f~Q-~~~~~-~~~~~~~q~~li 392 (429)
T cd08156 324 MRVDGNGGGAPNYEPNSFGGPPEDPEYAEPPLPVSGDADRYNYRDDDDDYTQ-AGDLY-RLVSEDERERLV 392 (429)
T ss_pred ccccCCCCCCCcccCCCCCCCccCCCcCCCCceEeeeEEEccccCccchhhh-hHHHH-hcCCHHHHHHHH
Confidence 677 5788899999999999888888888888999999999875 6799999 99999 899999999997
No 2
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 1 catalases are found in bacteria, algae, and plants; they have a relatively small subunit size of 55 to 69 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.66 E-value=4.8e-17 Score=119.08 Aligned_cols=67 Identities=19% Similarity=0.264 Sum_probs=60.5
Q ss_pred CcccCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++.+.++.|||+|||++++.+++.+.+++..++|.+.|+.+.++|||+| ||+|| |+|+++||+|||
T Consensus 366 m~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~Q-~~~~~-~~~~~~~~~~l~ 432 (469)
T cd08154 366 MNYGHDTSDVNYEPSRLDGLPEAPKYPYSQPPLSGTTQQAPIAKTNNFKQ-AGERY-RSFSEEEQENLI 432 (469)
T ss_pred ccccCCCCCCcccCCCCCCCccCCCcCCCCeeEeeeEEeccCCCCCcccC-cHHHH-HhCCHHHHHHHH
Confidence 66756778899999999999888888888889999999988877799999 99999 899999999997
No 3
>PLN02609 catalase
Probab=99.61 E-value=4.8e-16 Score=114.34 Aligned_cols=67 Identities=15% Similarity=0.187 Sum_probs=58.2
Q ss_pred CcccCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++++.++.|||+|||++++.+.+.+.++...+.|.+.++.+..+|||+| ||+|| |+|+++||++||
T Consensus 381 m~~~~~~~~~nY~pn~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~Q-~~~~~-~~~~~~~~~~lv 447 (492)
T PLN02609 381 MNFMHRDEEVNYFPSRFDPVRHAERVPIPHPPLSGRREKCKIEKENNFKQ-PGERY-RSWSPDRQERFI 447 (492)
T ss_pred ccccCCCCCCCccCCCCCCCccCCCcCCCCceeccceEEccCCCCCcccc-hhHHH-HhCCHHHHHHHH
Confidence 67744488999999999988777777777888899988888777899999 99999 799999999997
No 4
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 2 catalases are mostly found in bacteria and fungi; they have a large subunit size of 75 to 84 kDa, and bind a heme d group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.60 E-value=5.3e-16 Score=113.02 Aligned_cols=67 Identities=18% Similarity=0.209 Sum_probs=54.1
Q ss_pred CcccCCCCCCeecCCCCCCC--CCCC----CCCCCcccccCceeecccCC-CCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKGP--EPTP----RGAWSTYNATGDVKRGNYNN-GGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g~--~~~~----~~~~~~~~~~g~~~r~~~~~-~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++++.++.|||+|||++++ .+++ .+.+++..++|.+.|+.+.. +|||+| ||+|| |+|+++||+|||
T Consensus 332 m~~~~~~~~~nY~Pns~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~Q-~~~ly-~~~~~~e~~~lv 405 (443)
T cd08155 332 MRMTINKGRVNYFPNSLGAGPPRAASPAEGGFVHYPEKVEGPKIRIRSESFADHYSQ-ARLFW-NSMSPVEKEHII 405 (443)
T ss_pred ccccCCCCCCcccCCCCCCCCccccccccccccCCccceecceEecccCCCCccccc-cHHHH-hcCCHHHHHHHH
Confidence 66644445899999999873 3332 35577788999999988765 689999 99999 899999999997
No 5
>KOG0047|consensus
Probab=99.57 E-value=1.3e-15 Score=110.47 Aligned_cols=68 Identities=35% Similarity=0.535 Sum_probs=62.1
Q ss_pred Ccc-cCCCCCCeecCCCCCCCCCCCC-CCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAI-DNQNGAPNYYPNSFKGPEPTPR-GAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~-~n~~~~pnY~PNs~~g~~~~~~-~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++ +|+++.|||+|||+.+++..+. ..+++...+|++.||.+.+++||+| ||+||+.++++++|+|||
T Consensus 389 Mn~~~nqg~~pNYfpn~~~~~~~~~~~~~~~~~~~~G~~yr~~~~~d~nf~Q-pr~fy~~vl~~~q~kr~v 458 (505)
T KOG0047|consen 389 MNVNDNQGGAPNYFPNSFSGPRQQPDPVLEHTEVASGDVYRYEIGDDNNFEQ-PRAFYEKVLDKEQQKRLV 458 (505)
T ss_pred eeeccCCCCCCCcCcccCCccccCCccccCCceeeecceEEeeccCcccccc-hHHHHHHHhcHHHHHHHH
Confidence 788 7999999999999998888775 6778888999999999988999999 999998899999999986
No 6
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. This family of fungal catalases has a relatively small subunit size, and binds a protoheme IX (heme b) group buried deep inside the structure. Fungal catalases also bind NADPH as a second redox-active cofactor. They form tetramers; in eukaryotic cells, catalases are typically located in peroxisomes. Saccharomyces cerevisiae catalase T is found in the cytoplasm, though.
Probab=99.55 E-value=2.9e-15 Score=109.30 Aligned_cols=68 Identities=15% Similarity=0.133 Sum_probs=55.3
Q ss_pred Ccc-cCCCCCCeecCCCCCC--CCCCCCCCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAI-DNQNGAPNYYPNSFKG--PEPTPRGAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~-~n~~~~pnY~PNs~~g--~~~~~~~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++ .|.++.|||+|||+++ +..++...+++..++|.+.|+.+. ++|||+| ||+||+++|+++||++||
T Consensus 342 m~~~~~~~~~~nY~p~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~~~Q-~~~~y~~~~~~~~k~~li 413 (451)
T cd08157 342 MSVNGNYGGDPNYVSSILPPTYFKKRVDADGHHENWVGEVVAFLTEITDEDFVQ-PRALWEVVGKPGQQERFV 413 (451)
T ss_pred CcccCCCCCCCCcCCCCCCCCCcccccccCCCCceeeeeeEeecccccccchhc-cHHHHHhhCCHHHHHHHH
Confidence 677 6778899999999976 333344556777899999888863 5789999 999996689999999997
No 7
>cd00328 catalase Catalase heme-binding enzyme. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Most catalases exist as tetramers of 65KD subunits containing a protoheme IX group buried deep inside the structure. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.48 E-value=2.3e-14 Score=104.28 Aligned_cols=67 Identities=19% Similarity=0.223 Sum_probs=51.2
Q ss_pred CcccCCCCCCeecCCCCCCCCCCCCCCC----CcccccCceeeccc-CCCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKGPEPTPRGAW----STYNATGDVKRGNY-NNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~----~~~~~~g~~~r~~~-~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++.+..+.|||+|||++++.+++...+ +.+.+.|.+.++.. .++|||+| ||+|| |+|+++||+|||
T Consensus 324 m~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~~~Q-~~~~~-~~~~~~ek~~lv 395 (433)
T cd00328 324 GNMNDNTGVPNYEPNAKDVRYPAQGAPKFDRGHFSHWKSGVNREASTTNDDNFTQ-ARLFY-RSLTPGQQKRLV 395 (433)
T ss_pred ccccCCCCCCCccCCCCCCCCCCcccccccCCCceeeecceEEecccCCcchhhh-hHHHH-hcCCHHHHHHHH
Confidence 6663333489999999998776555443 34456777777764 45789999 99999 799999999997
No 8
>COG0753 KatE Catalase [Inorganic ion transport and metabolism]
Probab=99.43 E-value=6.1e-14 Score=102.62 Aligned_cols=67 Identities=22% Similarity=0.344 Sum_probs=52.7
Q ss_pred CcccCCCCCCeecCCCCCC---CCCCCCCCCCcccccCceee-cccCCCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKG---PEPTPRGAWSTYNATGDVKR-GNYNNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g---~~~~~~~~~~~~~~~g~~~r-~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++....+.+||+|||++. ..+++.+.+++..++|.+.+ ..+.++|+|+| ||+|| |+|+++||++||
T Consensus 380 m~~~~~~g~~~y~Pn~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~f~Q-~~~~~-~~~~~~ek~~l~ 450 (496)
T COG0753 380 MRMGINTGPANYEPNSFGDNPEAPEQPGFVEPPERVEGDKQRRRAISDDDYFSQ-PRALY-RSLSDAEKQHLV 450 (496)
T ss_pred cccccCCCCcccCccccccCccccccccccCCceeeccchhhhccccccccchh-HHHHH-HhCCHHHHHHHH
Confidence 6664333449999999964 33345577788889999885 44567899999 99999 799999999986
No 9
>PRK11249 katE hydroperoxidase II; Provisional
Probab=99.37 E-value=3.9e-13 Score=102.91 Aligned_cols=67 Identities=22% Similarity=0.300 Sum_probs=51.6
Q ss_pred CcccCCCCCCeecCCCCCC--CCCCCC------CCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830 1 MAIDNQNGAPNYYPNSFKG--PEPTPR------GAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 1 M~~~n~~~~pnY~PNs~~g--~~~~~~------~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|++.+..+.|||+|||+++ |.+.+. +...+..++|.+.|+.+. .+|||+| ||.|| |+|++.||+|||
T Consensus 446 ~~~~~~~g~~~Y~pns~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~r~~~~~~~d~~~Q-~~~~~-~~~~~~e~~~~~ 521 (752)
T PRK11249 446 HRMTIDTGPANYEPNSINGNWPRETPPAPKRGGFESYQERVEGNKVRERSPSFGDYYSQ-PRLFW-LSQTPIEQRHII 521 (752)
T ss_pred CcccCCCCCCcccCCCCCCCCcccCcccccccCccCCCceeeccEEeccCCCCCccccc-cHHHH-hcCCHHHHHHHH
Confidence 5664445589999999964 544443 224566788988888764 4789999 99999 899999999997
No 10
>PF06628 Catalase-rel: Catalase-related immune-responsive; InterPro: IPR010582 Catalases (1.11.1.6 from EC) are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects []. Hydrogen peroxide is produced as a consequence of oxidative cellular metabolism and can be converted to the highly reactive hydroxyl radical via transition metals, this radical being able to damage a wide variety of molecules within a cell, leading to oxidative stress and cell death. Catalases act to neutralise hydrogen peroxide toxicity, and are produced by all aerobic organisms ranging from bacteria to man. Most catalases are mono-functional, haem-containing enzymes, although there are also bifunctional haem-containing peroxidase/catalases (IPR000763 from INTERPRO) that are closely related to plant peroxidases, and non-haem, manganese-containing catalases (IPR007760 from INTERPRO) that are found in bacteria []. This entry represents a small conserved region within catalase enzymes that carries the immune-responsive amphipathic octa-peptide that is recognised by T cells [].; PDB: 2CAH_A 1NM0_A 1H7K_A 1E93_A 1H6N_A 3HB6_A 2CAG_A 1M85_A 1MQF_A 1A4E_C ....
Probab=98.96 E-value=7.1e-11 Score=66.79 Aligned_cols=29 Identities=17% Similarity=0.162 Sum_probs=25.0
Q ss_pred ecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830 39 RGNYNNGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 39 r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
|+.+.++|||+| ||+|| ++|+++||++||
T Consensus 1 R~~~~~~ddf~Q-a~~ly-~~l~~~er~~lv 29 (68)
T PF06628_consen 1 RYRSEKDDDFSQ-ARDLY-RVLSDEERERLV 29 (68)
T ss_dssp EHGHGGGCSSHH-HHHHH-HHSSHHHHHHHH
T ss_pred CCCCCCCcchhh-HHHHH-HHCCHHHHHHHH
Confidence 445556699999 99999 699999999997
No 11
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins. These proteins bind the minor groove of DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions.
Probab=49.47 E-value=8.4 Score=20.07 Aligned_cols=15 Identities=7% Similarity=-0.026 Sum_probs=13.0
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|..| +.||+++|..
T Consensus 35 ~~~~W-~~ls~~eK~~ 49 (66)
T cd01390 35 LGEKW-KELSEEEKKK 49 (66)
T ss_pred HHHHH-HhCCHHHHHH
Confidence 68899 8999999874
No 12
>PF13945 NST1: Salt tolerance down-regulator
Probab=49.11 E-value=6.8 Score=26.24 Aligned_cols=17 Identities=18% Similarity=0.202 Sum_probs=14.6
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
=.+|| ..|+++||..||
T Consensus 107 LkeFW-~SL~eeERr~LV 123 (190)
T PF13945_consen 107 LKEFW-ESLSEEERRSLV 123 (190)
T ss_pred HHHHH-HccCHHHHHHHH
Confidence 35789 899999999887
No 13
>PF07813 LTXXQ: LTXXQ motif family protein; InterPro: IPR012899 This five residue motif is found in a number of bacterial proteins bearing similarity to the protein CpxP (P32158 from SWISSPROT). This is a periplasmic protein that aids in combating extracytoplasmic protein-mediated toxicity, and may also be involved in the response to alkaline pH []. Another member of this family, Spy (P77754 from SWISSPROT) is also a periplasmic protein that may be involved in the response to stress []. The homology between CpxP and Spy may indicate that these two proteins are functionally related []. The motif is found repeated twice in many members of this entry. ; GO: 0042597 periplasmic space; PDB: 3ITF_B 3QZC_B 3OEO_D 3O39_A.
Probab=47.63 E-value=7.9 Score=21.78 Aligned_cols=16 Identities=0% Similarity=0.027 Sum_probs=11.8
Q ss_pred cchhhhccCChhhhccc
Q psy8830 52 KREVQDRRKPAVPRTNL 68 (70)
Q Consensus 52 ag~ly~r~m~~~er~~L 68 (70)
--.|| .+||+++|+.|
T Consensus 81 ~~~~~-~vLt~eQk~~~ 96 (100)
T PF07813_consen 81 QHALY-AVLTPEQKEKF 96 (100)
T ss_dssp HHHHH-TTS-HHHHHHH
T ss_pred HHHHH-hcCCHHHHHHH
Confidence 34678 89999999865
No 14
>smart00398 HMG high mobility group.
Probab=46.90 E-value=7.2 Score=20.40 Aligned_cols=16 Identities=6% Similarity=-0.110 Sum_probs=13.3
Q ss_pred cchhhhccCChhhhccc
Q psy8830 52 KREVQDRRKPAVPRTNL 68 (70)
Q Consensus 52 ag~ly~r~m~~~er~~L 68 (70)
.|..| +.|++++|...
T Consensus 36 ~~~~W-~~l~~~ek~~y 51 (70)
T smart00398 36 LGERW-KLLSEEEKAPY 51 (70)
T ss_pred HHHHH-HcCCHHHHHHH
Confidence 67889 89999998754
No 15
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include the fungal mating type gene products MC, MATA1 and Ste11.
Probab=42.23 E-value=13 Score=20.47 Aligned_cols=15 Identities=7% Similarity=0.020 Sum_probs=13.2
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|+.| +.|++++|+.
T Consensus 36 ~g~~W-k~ls~eeK~~ 50 (77)
T cd01389 36 IGRMW-RSESPEVKAY 50 (77)
T ss_pred HHHHH-hhCCHHHHHH
Confidence 78999 8999999874
No 16
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins. It has no known function. ; GO: 0005634 nucleus; PDB: 2EQZ_A 1V64_A 2CTO_A 1H5P_A 3TQ6_A 3FGH_A 3TMM_A 1J3X_A 2YRQ_A 1AAB_A ....
Probab=42.21 E-value=7.4 Score=21.29 Aligned_cols=19 Identities=5% Similarity=-0.011 Sum_probs=15.0
Q ss_pred CcccccchhhhccCChhhhcc
Q psy8830 47 LVLKSKREVQDRRKPAVPRTN 67 (70)
Q Consensus 47 df~Q~ag~ly~r~m~~~er~~ 67 (70)
-+.. .+..| +.||++||+.
T Consensus 35 ~~k~-~~~~W-k~Ls~~EK~~ 53 (73)
T PF09011_consen 35 VMKE-ISERW-KSLSEEEKEP 53 (73)
T ss_dssp HHHH-HHHHH-HHS-HHHHHH
T ss_pred HHHH-HHHHH-HhcCHHHHHH
Confidence 4667 89999 8999999874
No 17
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors. HMGs bind to the minor groove of DNA and have been classified by DNA binding preferences. Two phylogenically distinct groups of Class I proteins bind DNA in a sequence specific fashion and contain a single HMG box. One group (SOX-TCF) includes transcription factors, TCF-1, -3, -4; and also SRY and LEF-1, which bind four-way DNA junctions and duplex DNA targets. The second group (MATA) includes fungal mating type gene products MC, MATA1 and Ste11. Class II and III proteins (HMGB-UBF) bind DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III member
Probab=40.48 E-value=14 Score=18.97 Aligned_cols=15 Identities=7% Similarity=0.034 Sum_probs=12.7
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|..| +.|++++|+.
T Consensus 35 ~~~~W-~~l~~~~k~~ 49 (66)
T cd00084 35 LGEMW-KSLSEEEKKK 49 (66)
T ss_pred HHHHH-HhCCHHHHHH
Confidence 67889 8999999864
No 18
>KOG0527|consensus
Probab=38.05 E-value=12 Score=27.08 Aligned_cols=20 Identities=0% Similarity=-0.080 Sum_probs=16.1
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
=.+ =|..| |+|+++||.-+|
T Consensus 94 SK~-LG~~W-K~Lse~EKrPFi 113 (331)
T KOG0527|consen 94 SKR-LGAEW-KLLSEEEKRPFV 113 (331)
T ss_pred HHH-HHHHH-hhcCHhhhccHH
Confidence 346 79999 899999997654
No 19
>PTZ00199 high mobility group protein; Provisional
Probab=36.17 E-value=18 Score=20.99 Aligned_cols=15 Identities=7% Similarity=-0.006 Sum_probs=12.9
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|+.| +.|+++||..
T Consensus 59 ige~W-k~ls~eeK~~ 73 (94)
T PTZ00199 59 VGEAW-NKLSEEEKAP 73 (94)
T ss_pred HHHHH-HcCCHHHHHH
Confidence 58899 8999999864
No 20
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=32.82 E-value=22 Score=19.25 Aligned_cols=15 Identities=0% Similarity=-0.121 Sum_probs=13.0
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|+.| +.||+++|..
T Consensus 36 l~~~W-k~ls~~eK~~ 50 (72)
T cd01388 36 LGDRW-KALSNEEKQP 50 (72)
T ss_pred HHHHH-HcCCHHHHHH
Confidence 78899 8999999864
No 21
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=32.66 E-value=15 Score=19.29 Aligned_cols=15 Identities=0% Similarity=-0.015 Sum_probs=13.0
Q ss_pred cchhhhccCChhhhcc
Q psy8830 52 KREVQDRRKPAVPRTN 67 (70)
Q Consensus 52 ag~ly~r~m~~~er~~ 67 (70)
.|..| +.|++++|+.
T Consensus 35 ~~~~W-~~l~~~eK~~ 49 (69)
T PF00505_consen 35 LAQMW-KNLSEEEKAP 49 (69)
T ss_dssp HHHHH-HCSHHHHHHH
T ss_pred HHHHH-hcCCHHHHHH
Confidence 78899 8999999874
No 22
>PF12650 DUF3784: Domain of unknown function (DUF3784); InterPro: IPR017259 This group represents an uncharacterised conserved protein.
Probab=31.58 E-value=23 Score=20.48 Aligned_cols=11 Identities=0% Similarity=-0.058 Sum_probs=9.2
Q ss_pred hhccCChhhhcc
Q psy8830 56 QDRRKPAVPRTN 67 (70)
Q Consensus 56 y~r~m~~~er~~ 67 (70)
| +.||++||+.
T Consensus 26 y-ntms~eEk~~ 36 (97)
T PF12650_consen 26 Y-NTMSKEEKEK 36 (97)
T ss_pred c-ccCCHHHHHH
Confidence 7 7899999974
No 23
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C.
Probab=30.21 E-value=9.2 Score=18.66 Aligned_cols=13 Identities=31% Similarity=0.554 Sum_probs=6.5
Q ss_pred ccCChhhhccccC
Q psy8830 58 RRKPAVPRTNLIC 70 (70)
Q Consensus 58 r~m~~~er~~Lv~ 70 (70)
++...++|+|+||
T Consensus 13 ~ip~gd~r~R~vC 25 (34)
T PF14803_consen 13 RIPEGDDRERLVC 25 (34)
T ss_dssp E--TT-SS-EEEE
T ss_pred hcCCCCCccceEC
Confidence 5666777888776
No 24
>PF05001 RNA_pol_Rpb1_R: RNA polymerase Rpb1 C-terminal repeat ; InterPro: IPR000684 RNA polymerase II (2.7.7.6 from EC) [, ] is one of the three forms of RNA polymerase that exist in eukaryotic nuclei. The C-terminal region of the largest subunit of this oligomeric enzyme consists of the tandem repeat of a conserved heptapeptide []. The number of repeats varies according to the species (for example there are 17 in Plasmodium, 26 in yeast, 44 in Drosophila, and 52 in mammals). The region containing these repeats is essential for the function of polymerase II. This repeated heptapeptide (called CT7n or CTD) is rich in hydroxyl groups. It probably projects out of the globular catalytic domain and may interact with the acidic activator domains of transcriptional regulatory proteins. It is also known to bind by intercalation to DNA. RNA polymerase II is activated by phosphorylation. The serine and threonine residues in the CT7n repeats are the target of such phosphorylation.; GO: 0003677 DNA binding, 0006366 transcription from RNA polymerase II promoter, 0005665 DNA-directed RNA polymerase II, core complex; PDB: 2L0I_B 2GHQ_C 2GHT_C.
Probab=28.57 E-value=21 Score=14.19 Aligned_cols=9 Identities=44% Similarity=0.896 Sum_probs=4.0
Q ss_pred CCCeecCCC
Q psy8830 8 GAPNYYPNS 16 (70)
Q Consensus 8 ~~pnY~PNs 16 (70)
..|+|.|.|
T Consensus 3 ~SP~ysPtS 11 (14)
T PF05001_consen 3 TSPGYSPTS 11 (14)
T ss_dssp TB---BTTB
T ss_pred CCCCCCccC
Confidence 357888876
No 25
>PLN02417 dihydrodipicolinate synthase
Probab=27.74 E-value=23 Score=24.35 Aligned_cols=19 Identities=21% Similarity=-0.170 Sum_probs=15.9
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
... .|+.+ .||.+||.+|+
T Consensus 42 ~Gs-tGE~~--~ls~~Er~~~~ 60 (280)
T PLN02417 42 GGT-TGEGQ--LMSWDEHIMLI 60 (280)
T ss_pred Ccc-Ccchh--hCCHHHHHHHH
Confidence 355 89998 89999999875
No 26
>PF02071 NSF: Aromatic-di-Alanine (AdAR) repeat ; InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family. SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=27.47 E-value=11 Score=14.38 Aligned_cols=9 Identities=22% Similarity=-0.046 Sum_probs=5.7
Q ss_pred Ccccccchhh
Q psy8830 47 LVLKSKREVQ 56 (70)
Q Consensus 47 df~Q~ag~ly 56 (70)
+|.| |+++|
T Consensus 4 ~y~~-Aa~~y 12 (12)
T PF02071_consen 4 CYEK-AAECY 12 (12)
T ss_pred HHHH-HHhhC
Confidence 4666 77665
No 27
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue []. Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Rhizobium meliloti (Sinorhizobium meliloti) protein mosA [], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry []. Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 3B4U_B 3S8H_A 3QZE_B 1XXX_F 3L21_F 3IRD_A 3A5F_B 3G0S_B 3DAQ_C 3UQN_A ....
Probab=26.57 E-value=26 Score=23.87 Aligned_cols=16 Identities=19% Similarity=0.183 Sum_probs=13.0
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+.+ .||.+||.+|+
T Consensus 45 tGE~~--~Lt~~Er~~l~ 60 (289)
T PF00701_consen 45 TGEFY--SLTDEERKELL 60 (289)
T ss_dssp TTTGG--GS-HHHHHHHH
T ss_pred Ccccc--cCCHHHHHHHH
Confidence 78888 89999999875
No 28
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=26.32 E-value=24 Score=23.82 Aligned_cols=19 Identities=16% Similarity=0.120 Sum_probs=15.7
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
..- .|+.+ .||.+||.+|+
T Consensus 38 ~Gs-tGE~~--~ls~~Er~~l~ 56 (281)
T cd00408 38 LGT-TGEAP--TLTDEERKEVI 56 (281)
T ss_pred CCC-Ccccc--cCCHHHHHHHH
Confidence 445 89998 89999999875
No 29
>PF11918 DUF3436: Domain of unknown function (DUF3436); InterPro: IPR024591 This uncharacterised N-terminal domain is associated with the interphotoreceptor retinol-binding protein family. It is about 50 amino acids in length and has two conserved sequence motifs: DPRL and SYEP.
Probab=26.06 E-value=61 Score=17.61 Aligned_cols=17 Identities=24% Similarity=0.464 Sum_probs=12.7
Q ss_pred CeecCCCCCCCCCCCCC
Q psy8830 10 PNYYPNSFKGPEPTPRG 26 (70)
Q Consensus 10 pnY~PNs~~g~~~~~~~ 26 (70)
+.||||....|+..+..
T Consensus 19 ISYEP~~~eaP~~~p~~ 35 (55)
T PF11918_consen 19 ISYEPSYVEAPQQPPAL 35 (55)
T ss_pred EEeCCCCCCCCCCCCCC
Confidence 67999988777666554
No 30
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=26.02 E-value=26 Score=23.80 Aligned_cols=16 Identities=13% Similarity=0.063 Sum_probs=14.2
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+.+ .||.+||.+|+
T Consensus 44 tGE~~--~lt~~Er~~l~ 59 (284)
T cd00950 44 TGESP--TLSDEEHEAVI 59 (284)
T ss_pred Ccchh--hCCHHHHHHHH
Confidence 88998 89999999875
No 31
>PRK12751 cpxP periplasmic stress adaptor protein CpxP; Reviewed
Probab=24.67 E-value=32 Score=22.35 Aligned_cols=14 Identities=7% Similarity=0.055 Sum_probs=9.6
Q ss_pred hhhhccCChhhhccc
Q psy8830 54 EVQDRRKPAVPRTNL 68 (70)
Q Consensus 54 ~ly~r~m~~~er~~L 68 (70)
..| .+||++||+.|
T Consensus 125 qmy-~lLTPEQra~l 138 (162)
T PRK12751 125 QMY-NLLTPEQKEAL 138 (162)
T ss_pred HHH-HcCCHHHHHHH
Confidence 356 67888877755
No 32
>PF05494 Tol_Tol_Ttg2: Toluene tolerance, Ttg2 ; InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation []. Many proteins are involved in these processes. This family is a transporter which shows similarity to ABC transporters [].; PDB: 2QGU_A.
Probab=24.36 E-value=29 Score=21.88 Aligned_cols=16 Identities=13% Similarity=0.279 Sum_probs=11.9
Q ss_pred chhhhccCChhhhcccc
Q psy8830 53 REVQDRRKPAVPRTNLI 69 (70)
Q Consensus 53 g~ly~r~m~~~er~~Lv 69 (70)
|.-| +.+|++||++++
T Consensus 49 G~~w-~~~s~~q~~~F~ 64 (170)
T PF05494_consen 49 GRYW-RKASPAQRQRFV 64 (170)
T ss_dssp GGGT-TTS-HHHHHHHH
T ss_pred HHhH-hhCCHHHHHHHH
Confidence 5558 899999998764
No 33
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=23.81 E-value=28 Score=23.99 Aligned_cols=19 Identities=5% Similarity=-0.064 Sum_probs=16.0
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
..- .|+++ .||.+||.+|+
T Consensus 46 ~Gs-tGE~~--~Lt~eEr~~v~ 64 (296)
T TIGR03249 46 AGG-TGEFF--SLTPAEYEQVV 64 (296)
T ss_pred CCC-CcCcc--cCCHHHHHHHH
Confidence 456 89998 89999999875
No 34
>PRK10455 periplasmic protein; Reviewed
Probab=23.63 E-value=33 Score=22.14 Aligned_cols=13 Identities=0% Similarity=0.038 Sum_probs=10.5
Q ss_pred hhhccCChhhhccc
Q psy8830 55 VQDRRKPAVPRTNL 68 (70)
Q Consensus 55 ly~r~m~~~er~~L 68 (70)
+| .+||+++|+.|
T Consensus 126 iy-~vLTPEQr~q~ 138 (161)
T PRK10455 126 IY-NVLTPEQKKQF 138 (161)
T ss_pred HH-HhCCHHHHHHH
Confidence 67 79999998754
No 35
>PF10293 DUF2405: Domain of unknown function (DUF2405); InterPro: IPR019409 The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies []. This entry represents a conserved region found within FMP27.
Probab=23.49 E-value=17 Score=23.28 Aligned_cols=25 Identities=12% Similarity=-0.056 Sum_probs=21.0
Q ss_pred CCCCcccccchhhhccCChhhhcccc
Q psy8830 44 NGGLVLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 44 ~~ddf~Q~ag~ly~r~m~~~er~~Lv 69 (70)
+||-|.+.=|..| ++.-.|+|+||-
T Consensus 114 eDDPFE~~L~~Iy-~lGl~Eq~~Rl~ 138 (157)
T PF10293_consen 114 EDDPFESELGMIY-RLGLDEQRERLE 138 (157)
T ss_pred eCCHHHHHHHHHH-HHhhHHHHHHHH
Confidence 5667999678889 899999999873
No 36
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=22.99 E-value=30 Score=23.83 Aligned_cols=16 Identities=6% Similarity=-0.012 Sum_probs=14.1
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+++ .||.+||.+|+
T Consensus 44 tGE~~--~Ls~eEr~~l~ 59 (289)
T cd00951 44 TGEFF--SLTPDEYAQVV 59 (289)
T ss_pred CcCcc--cCCHHHHHHHH
Confidence 88888 89999999875
No 37
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=22.92 E-value=31 Score=23.58 Aligned_cols=19 Identities=21% Similarity=0.083 Sum_probs=15.6
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
..- .|+.+ .||.+||.+|+
T Consensus 42 ~Gs-~GE~~--~ls~~Er~~~~ 60 (292)
T PRK03170 42 VGT-TGESP--TLTHEEHEELI 60 (292)
T ss_pred CCc-CCccc--cCCHHHHHHHH
Confidence 345 89998 89999999875
No 38
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=22.23 E-value=32 Score=23.66 Aligned_cols=16 Identities=6% Similarity=0.057 Sum_probs=13.7
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+.+ .||.+||.+|+
T Consensus 48 tGE~~--~Ls~eEr~~~~ 63 (293)
T PRK04147 48 TGEAF--LLSTEEKKQVL 63 (293)
T ss_pred ccccc--cCCHHHHHHHH
Confidence 68888 89999998875
No 39
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=21.41 E-value=33 Score=23.52 Aligned_cols=16 Identities=6% Similarity=-0.087 Sum_probs=14.0
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+++ .||.+||.+|+
T Consensus 43 tGE~~--~Lt~eEr~~l~ 58 (279)
T cd00953 43 TGLGP--SLSFQEKLELL 58 (279)
T ss_pred CCCcc--cCCHHHHHHHH
Confidence 78888 89999999875
No 40
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=20.63 E-value=38 Score=23.32 Aligned_cols=19 Identities=16% Similarity=0.197 Sum_probs=16.0
Q ss_pred cccccchhhhccCChhhhcccc
Q psy8830 48 VLKSKREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 48 f~Q~ag~ly~r~m~~~er~~Lv 69 (70)
=.| +.+|| .|++.||.+|.
T Consensus 69 ~~~-~~dl~--~msEaeRR~L~ 87 (258)
T COG4107 69 DGQ-PRDLY--TMSEAERRRLL 87 (258)
T ss_pred CCC-chhHh--hhchHHHHHHh
Confidence 357 99999 69999998874
No 41
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM. The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins are members of the pfam05494 family of putative transporters known as "toluene tolerance protein Ttg2D", although it is unlikely that the members included here have anything to do with toluene per-se.
Probab=20.52 E-value=36 Score=22.42 Aligned_cols=16 Identities=13% Similarity=0.052 Sum_probs=12.6
Q ss_pred chhhhccCChhhhcccc
Q psy8830 53 REVQDRRKPAVPRTNLI 69 (70)
Q Consensus 53 g~ly~r~m~~~er~~Lv 69 (70)
|.-| |.+|++||++++
T Consensus 75 G~~W-~~~s~~Qr~~F~ 90 (198)
T TIGR03481 75 GSSW-TSLSPEQRRRFI 90 (198)
T ss_pred hhhh-hhCCHHHHHHHH
Confidence 4568 789999998764
No 42
>TIGR00674 dapA dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment.
Probab=20.39 E-value=37 Score=23.17 Aligned_cols=16 Identities=13% Similarity=0.079 Sum_probs=14.1
Q ss_pred cchhhhccCChhhhcccc
Q psy8830 52 KREVQDRRKPAVPRTNLI 69 (70)
Q Consensus 52 ag~ly~r~m~~~er~~Lv 69 (70)
.|+.+ .||.+||.+|+
T Consensus 42 tGE~~--~Ls~~Er~~~~ 57 (285)
T TIGR00674 42 TGESP--TLSHEEHKKVI 57 (285)
T ss_pred Ccccc--cCCHHHHHHHH
Confidence 89997 89999999875
No 43
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=20.07 E-value=38 Score=21.98 Aligned_cols=13 Identities=0% Similarity=-0.005 Sum_probs=10.2
Q ss_pred hhhccCChhhhccc
Q psy8830 55 VQDRRKPAVPRTNL 68 (70)
Q Consensus 55 ly~r~m~~~er~~L 68 (70)
+| .+||++||+.|
T Consensus 133 ~~-~vLTpEQRak~ 145 (170)
T PRK12750 133 ML-SILTPEQKAKF 145 (170)
T ss_pred HH-HhCCHHHHHHH
Confidence 56 78898888765
Done!