Query         psy8830
Match_columns 70
No_of_seqs    123 out of 826
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 20:16:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8830.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8830hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd08156 catalase_clade_3 Clade  99.7 2.8E-17 6.1E-22  119.3   3.9   67    1-69    324-392 (429)
  2 cd08154 catalase_clade_1 Clade  99.7 4.8E-17   1E-21  119.1   4.1   67    1-69    366-432 (469)
  3 PLN02609 catalase               99.6 4.8E-16   1E-20  114.3   4.3   67    1-69    381-447 (492)
  4 cd08155 catalase_clade_2 Clade  99.6 5.3E-16 1.1E-20  113.0   4.1   67    1-69    332-405 (443)
  5 KOG0047|consensus               99.6 1.3E-15 2.8E-20  110.5   3.3   68    1-69    389-458 (505)
  6 cd08157 catalase_fungal Fungal  99.6 2.9E-15 6.4E-20  109.3   3.9   68    1-69    342-413 (451)
  7 cd00328 catalase Catalase heme  99.5 2.3E-14   5E-19  104.3   3.7   67    1-69    324-395 (433)
  8 COG0753 KatE Catalase [Inorgan  99.4 6.1E-14 1.3E-18  102.6   2.9   67    1-69    380-450 (496)
  9 PRK11249 katE hydroperoxidase   99.4 3.9E-13 8.4E-18  102.9   4.1   67    1-69    446-521 (752)
 10 PF06628 Catalase-rel:  Catalas  99.0 7.1E-11 1.5E-15   66.8  -0.8   29   39-69      1-29  (68)
 11 cd01390 HMGB-UBF_HMG-box HMGB-  49.5     8.4 0.00018   20.1   0.7   15   52-67     35-49  (66)
 12 PF13945 NST1:  Salt tolerance   49.1     6.8 0.00015   26.2   0.4   17   52-69    107-123 (190)
 13 PF07813 LTXXQ:  LTXXQ motif fa  47.6     7.9 0.00017   21.8   0.5   16   52-68     81-96  (100)
 14 smart00398 HMG high mobility g  46.9     7.2 0.00016   20.4   0.2   16   52-68     36-51  (70)
 15 cd01389 MATA_HMG-box MATA_HMG-  42.2      13 0.00028   20.5   0.8   15   52-67     36-50  (77)
 16 PF09011 HMG_box_2:  HMG-box do  42.2     7.4 0.00016   21.3  -0.2   19   47-67     35-53  (73)
 17 cd00084 HMG-box High Mobility   40.5      14  0.0003   19.0   0.7   15   52-67     35-49  (66)
 18 KOG0527|consensus               38.0      12 0.00025   27.1   0.2   20   48-69     94-113 (331)
 19 PTZ00199 high mobility group p  36.2      18 0.00039   21.0   0.8   15   52-67     59-73  (94)
 20 cd01388 SOX-TCF_HMG-box SOX-TC  32.8      22 0.00048   19.3   0.8   15   52-67     36-50  (72)
 21 PF00505 HMG_box:  HMG (high mo  32.7      15 0.00032   19.3   0.0   15   52-67     35-49  (69)
 22 PF12650 DUF3784:  Domain of un  31.6      23 0.00049   20.5   0.7   11   56-67     26-36  (97)
 23 PF14803 Nudix_N_2:  Nudix N-te  30.2     9.2  0.0002   18.7  -1.0   13   58-70     13-25  (34)
 24 PF05001 RNA_pol_Rpb1_R:  RNA p  28.6      21 0.00046   14.2   0.1    9    8-16      3-11  (14)
 25 PLN02417 dihydrodipicolinate s  27.7      23 0.00049   24.3   0.3   19   48-69     42-60  (280)
 26 PF02071 NSF:  Aromatic-di-Alan  27.5      11 0.00023   14.4  -0.8    9   47-56      4-12  (12)
 27 PF00701 DHDPS:  Dihydrodipicol  26.6      26 0.00056   23.9   0.4   16   52-69     45-60  (289)
 28 cd00408 DHDPS-like Dihydrodipi  26.3      24 0.00052   23.8   0.2   19   48-69     38-56  (281)
 29 PF11918 DUF3436:  Domain of un  26.1      61  0.0013   17.6   1.7   17   10-26     19-35  (55)
 30 cd00950 DHDPS Dihydrodipicolin  26.0      26 0.00056   23.8   0.3   16   52-69     44-59  (284)
 31 PRK12751 cpxP periplasmic stre  24.7      32 0.00069   22.3   0.5   14   54-68    125-138 (162)
 32 PF05494 Tol_Tol_Ttg2:  Toluene  24.4      29 0.00062   21.9   0.3   16   53-69     49-64  (170)
 33 TIGR03249 KdgD 5-dehydro-4-deo  23.8      28 0.00061   24.0   0.2   19   48-69     46-64  (296)
 34 PRK10455 periplasmic protein;   23.6      33 0.00071   22.1   0.4   13   55-68    126-138 (161)
 35 PF10293 DUF2405:  Domain of un  23.5      17 0.00038   23.3  -0.9   25   44-69    114-138 (157)
 36 cd00951 KDGDH 5-dehydro-4-deox  23.0      30 0.00064   23.8   0.1   16   52-69     44-59  (289)
 37 PRK03170 dihydrodipicolinate s  22.9      31 0.00067   23.6   0.2   19   48-69     42-60  (292)
 38 PRK04147 N-acetylneuraminate l  22.2      32 0.00069   23.7   0.2   16   52-69     48-63  (293)
 39 cd00953 KDG_aldolase KDG (2-ke  21.4      33 0.00072   23.5   0.1   16   52-69     43-58  (279)
 40 COG4107 PhnK ABC-type phosphon  20.6      38 0.00083   23.3   0.3   19   48-69     69-87  (258)
 41 TIGR03481 HpnM hopanoid biosyn  20.5      36 0.00079   22.4   0.2   16   53-69     75-90  (198)
 42 TIGR00674 dapA dihydrodipicoli  20.4      37 0.00081   23.2   0.2   16   52-69     42-57  (285)
 43 PRK12750 cpxP periplasmic repr  20.1      38 0.00083   22.0   0.2   13   55-68    133-145 (170)

No 1  
>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes.
Probab=99.67  E-value=2.8e-17  Score=119.26  Aligned_cols=67  Identities=34%  Similarity=0.522  Sum_probs=60.5

Q ss_pred             Ccc-cCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAI-DNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~-~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++ .|.++.|||+|||++++.+.+.+.+++..++|.+.|+.+. ++|||+| ||+|| |+|+++||+|||
T Consensus       324 m~~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~g~~~r~~~~~~~d~f~Q-~~~~~-~~~~~~~q~~li  392 (429)
T cd08156         324 MRVDGNGGGAPNYEPNSFGGPPEDPEYAEPPLPVSGDADRYNYRDDDDDYTQ-AGDLY-RLVSEDERERLV  392 (429)
T ss_pred             ccccCCCCCCCcccCCCCCCCccCCCcCCCCceEeeeEEEccccCccchhhh-hHHHH-hcCCHHHHHHHH
Confidence            677 5788899999999999888888888888999999999875 6799999 99999 899999999997


No 2  
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 1 catalases are found in bacteria, algae, and plants; they have a relatively small subunit size of 55 to 69 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.66  E-value=4.8e-17  Score=119.08  Aligned_cols=67  Identities=19%  Similarity=0.264  Sum_probs=60.5

Q ss_pred             CcccCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++.+.++.|||+|||++++.+++.+.+++..++|.+.|+.+.++|||+| ||+|| |+|+++||+|||
T Consensus       366 m~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~Q-~~~~~-~~~~~~~~~~l~  432 (469)
T cd08154         366 MNYGHDTSDVNYEPSRLDGLPEAPKYPYSQPPLSGTTQQAPIAKTNNFKQ-AGERY-RSFSEEEQENLI  432 (469)
T ss_pred             ccccCCCCCCcccCCCCCCCccCCCcCCCCeeEeeeEEeccCCCCCcccC-cHHHH-HhCCHHHHHHHH
Confidence            66756778899999999999888888888889999999988877799999 99999 899999999997


No 3  
>PLN02609 catalase
Probab=99.61  E-value=4.8e-16  Score=114.34  Aligned_cols=67  Identities=15%  Similarity=0.187  Sum_probs=58.2

Q ss_pred             CcccCCCCCCeecCCCCCCCCCCCCCCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKGPEPTPRGAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++++.++.|||+|||++++.+.+.+.++...+.|.+.++.+..+|||+| ||+|| |+|+++||++||
T Consensus       381 m~~~~~~~~~nY~pn~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~Q-~~~~~-~~~~~~~~~~lv  447 (492)
T PLN02609        381 MNFMHRDEEVNYFPSRFDPVRHAERVPIPHPPLSGRREKCKIEKENNFKQ-PGERY-RSWSPDRQERFI  447 (492)
T ss_pred             ccccCCCCCCCccCCCCCCCccCCCcCCCCceeccceEEccCCCCCcccc-hhHHH-HhCCHHHHHHHH
Confidence            67744488999999999988777777777888899988888777899999 99999 799999999997


No 4  
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 2 catalases are mostly found in bacteria and fungi; they have a large subunit size of 75 to 84 kDa, and bind a heme d group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.60  E-value=5.3e-16  Score=113.02  Aligned_cols=67  Identities=18%  Similarity=0.209  Sum_probs=54.1

Q ss_pred             CcccCCCCCCeecCCCCCCC--CCCC----CCCCCcccccCceeecccCC-CCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKGP--EPTP----RGAWSTYNATGDVKRGNYNN-GGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g~--~~~~----~~~~~~~~~~g~~~r~~~~~-~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++++.++.|||+|||++++  .+++    .+.+++..++|.+.|+.+.. +|||+| ||+|| |+|+++||+|||
T Consensus       332 m~~~~~~~~~nY~Pns~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~Q-~~~ly-~~~~~~e~~~lv  405 (443)
T cd08155         332 MRMTINKGRVNYFPNSLGAGPPRAASPAEGGFVHYPEKVEGPKIRIRSESFADHYSQ-ARLFW-NSMSPVEKEHII  405 (443)
T ss_pred             ccccCCCCCCcccCCCCCCCCccccccccccccCCccceecceEecccCCCCccccc-cHHHH-hcCCHHHHHHHH
Confidence            66644445899999999873  3332    35577788999999988765 689999 99999 899999999997


No 5  
>KOG0047|consensus
Probab=99.57  E-value=1.3e-15  Score=110.47  Aligned_cols=68  Identities=35%  Similarity=0.535  Sum_probs=62.1

Q ss_pred             Ccc-cCCCCCCeecCCCCCCCCCCCC-CCCCcccccCceeecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAI-DNQNGAPNYYPNSFKGPEPTPR-GAWSTYNATGDVKRGNYNNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~-~n~~~~pnY~PNs~~g~~~~~~-~~~~~~~~~g~~~r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++ +|+++.|||+|||+.+++..+. ..+++...+|++.||.+.+++||+| ||+||+.++++++|+|||
T Consensus       389 Mn~~~nqg~~pNYfpn~~~~~~~~~~~~~~~~~~~~G~~yr~~~~~d~nf~Q-pr~fy~~vl~~~q~kr~v  458 (505)
T KOG0047|consen  389 MNVNDNQGGAPNYFPNSFSGPRQQPDPVLEHTEVASGDVYRYEIGDDNNFEQ-PRAFYEKVLDKEQQKRLV  458 (505)
T ss_pred             eeeccCCCCCCCcCcccCCccccCCccccCCceeeecceEEeeccCcccccc-hHHHHHHHhcHHHHHHHH
Confidence            788 7999999999999998888775 6778888999999999988999999 999998899999999986


No 6  
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. This family of fungal catalases has a relatively small subunit size, and binds a protoheme IX (heme b) group buried deep inside the structure. Fungal catalases also bind NADPH as a second redox-active cofactor. They form tetramers; in eukaryotic cells, catalases are typically located in peroxisomes. Saccharomyces cerevisiae catalase T is found in the cytoplasm, though.
Probab=99.55  E-value=2.9e-15  Score=109.30  Aligned_cols=68  Identities=15%  Similarity=0.133  Sum_probs=55.3

Q ss_pred             Ccc-cCCCCCCeecCCCCCC--CCCCCCCCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAI-DNQNGAPNYYPNSFKG--PEPTPRGAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~-~n~~~~pnY~PNs~~g--~~~~~~~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++ .|.++.|||+|||+++  +..++...+++..++|.+.|+.+. ++|||+| ||+||+++|+++||++||
T Consensus       342 m~~~~~~~~~~nY~p~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~~~Q-~~~~y~~~~~~~~k~~li  413 (451)
T cd08157         342 MSVNGNYGGDPNYVSSILPPTYFKKRVDADGHHENWVGEVVAFLTEITDEDFVQ-PRALWEVVGKPGQQERFV  413 (451)
T ss_pred             CcccCCCCCCCCcCCCCCCCCCcccccccCCCCceeeeeeEeecccccccchhc-cHHHHHhhCCHHHHHHHH
Confidence            677 6778899999999976  333344556777899999888863 5789999 999996689999999997


No 7  
>cd00328 catalase Catalase heme-binding enzyme. Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Most catalases exist as tetramers of 65KD subunits containing a protoheme IX group buried deep inside the structure. In eukaryotic cells, catalases are located in peroxisomes.
Probab=99.48  E-value=2.3e-14  Score=104.28  Aligned_cols=67  Identities=19%  Similarity=0.223  Sum_probs=51.2

Q ss_pred             CcccCCCCCCeecCCCCCCCCCCCCCCC----CcccccCceeeccc-CCCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKGPEPTPRGAW----STYNATGDVKRGNY-NNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g~~~~~~~~~----~~~~~~g~~~r~~~-~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++.+..+.|||+|||++++.+++...+    +.+.+.|.+.++.. .++|||+| ||+|| |+|+++||+|||
T Consensus       324 m~~~~~~~~~nY~pns~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~~~Q-~~~~~-~~~~~~ek~~lv  395 (433)
T cd00328         324 GNMNDNTGVPNYEPNAKDVRYPAQGAPKFDRGHFSHWKSGVNREASTTNDDNFTQ-ARLFY-RSLTPGQQKRLV  395 (433)
T ss_pred             ccccCCCCCCCccCCCCCCCCCCcccccccCCCceeeecceEEecccCCcchhhh-hHHHH-hcCCHHHHHHHH
Confidence            6663333489999999998776555443    34456777777764 45789999 99999 799999999997


No 8  
>COG0753 KatE Catalase [Inorganic ion transport and metabolism]
Probab=99.43  E-value=6.1e-14  Score=102.62  Aligned_cols=67  Identities=22%  Similarity=0.344  Sum_probs=52.7

Q ss_pred             CcccCCCCCCeecCCCCCC---CCCCCCCCCCcccccCceee-cccCCCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKG---PEPTPRGAWSTYNATGDVKR-GNYNNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g---~~~~~~~~~~~~~~~g~~~r-~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++....+.+||+|||++.   ..+++.+.+++..++|.+.+ ..+.++|+|+| ||+|| |+|+++||++||
T Consensus       380 m~~~~~~g~~~y~Pn~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~d~f~Q-~~~~~-~~~~~~ek~~l~  450 (496)
T COG0753         380 MRMGINTGPANYEPNSFGDNPEAPEQPGFVEPPERVEGDKQRRRAISDDDYFSQ-PRALY-RSLSDAEKQHLV  450 (496)
T ss_pred             cccccCCCCcccCccccccCccccccccccCCceeeccchhhhccccccccchh-HHHHH-HhCCHHHHHHHH
Confidence            6664333449999999964   33345577788889999885 44567899999 99999 799999999986


No 9  
>PRK11249 katE hydroperoxidase II; Provisional
Probab=99.37  E-value=3.9e-13  Score=102.91  Aligned_cols=67  Identities=22%  Similarity=0.300  Sum_probs=51.6

Q ss_pred             CcccCCCCCCeecCCCCCC--CCCCCC------CCCCcccccCceeecccC-CCCCcccccchhhhccCChhhhcccc
Q psy8830           1 MAIDNQNGAPNYYPNSFKG--PEPTPR------GAWSTYNATGDVKRGNYN-NGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus         1 M~~~n~~~~pnY~PNs~~g--~~~~~~------~~~~~~~~~g~~~r~~~~-~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |++.+..+.|||+|||+++  |.+.+.      +...+..++|.+.|+.+. .+|||+| ||.|| |+|++.||+|||
T Consensus       446 ~~~~~~~g~~~Y~pns~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~r~~~~~~~d~~~Q-~~~~~-~~~~~~e~~~~~  521 (752)
T PRK11249        446 HRMTIDTGPANYEPNSINGNWPRETPPAPKRGGFESYQERVEGNKVRERSPSFGDYYSQ-PRLFW-LSQTPIEQRHII  521 (752)
T ss_pred             CcccCCCCCCcccCCCCCCCCcccCcccccccCccCCCceeeccEEeccCCCCCccccc-cHHHH-hcCCHHHHHHHH
Confidence            5664445589999999964  544443      224566788988888764 4789999 99999 899999999997


No 10 
>PF06628 Catalase-rel:  Catalase-related immune-responsive;  InterPro: IPR010582 Catalases (1.11.1.6 from EC) are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects []. Hydrogen peroxide is produced as a consequence of oxidative cellular metabolism and can be converted to the highly reactive hydroxyl radical via transition metals, this radical being able to damage a wide variety of molecules within a cell, leading to oxidative stress and cell death. Catalases act to neutralise hydrogen peroxide toxicity, and are produced by all aerobic organisms ranging from bacteria to man. Most catalases are mono-functional, haem-containing enzymes, although there are also bifunctional haem-containing peroxidase/catalases (IPR000763 from INTERPRO) that are closely related to plant peroxidases, and non-haem, manganese-containing catalases (IPR007760 from INTERPRO) that are found in bacteria []. This entry represents a small conserved region within catalase enzymes that carries the immune-responsive amphipathic octa-peptide that is recognised by T cells [].; PDB: 2CAH_A 1NM0_A 1H7K_A 1E93_A 1H6N_A 3HB6_A 2CAG_A 1M85_A 1MQF_A 1A4E_C ....
Probab=98.96  E-value=7.1e-11  Score=66.79  Aligned_cols=29  Identities=17%  Similarity=0.162  Sum_probs=25.0

Q ss_pred             ecccCCCCCcccccchhhhccCChhhhcccc
Q psy8830          39 RGNYNNGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        39 r~~~~~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      |+.+.++|||+| ||+|| ++|+++||++||
T Consensus         1 R~~~~~~ddf~Q-a~~ly-~~l~~~er~~lv   29 (68)
T PF06628_consen    1 RYRSEKDDDFSQ-ARDLY-RVLSDEERERLV   29 (68)
T ss_dssp             EHGHGGGCSSHH-HHHHH-HHSSHHHHHHHH
T ss_pred             CCCCCCCcchhh-HHHHH-HHCCHHHHHHHH
Confidence            445556699999 99999 699999999997


No 11 
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins. These proteins bind the minor groove of DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions.
Probab=49.47  E-value=8.4  Score=20.07  Aligned_cols=15  Identities=7%  Similarity=-0.026  Sum_probs=13.0

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|..| +.||+++|..
T Consensus        35 ~~~~W-~~ls~~eK~~   49 (66)
T cd01390          35 LGEKW-KELSEEEKKK   49 (66)
T ss_pred             HHHHH-HhCCHHHHHH
Confidence            68899 8999999874


No 12 
>PF13945 NST1:  Salt tolerance down-regulator
Probab=49.11  E-value=6.8  Score=26.24  Aligned_cols=17  Identities=18%  Similarity=0.202  Sum_probs=14.6

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      =.+|| ..|+++||..||
T Consensus       107 LkeFW-~SL~eeERr~LV  123 (190)
T PF13945_consen  107 LKEFW-ESLSEEERRSLV  123 (190)
T ss_pred             HHHHH-HccCHHHHHHHH
Confidence            35789 899999999887


No 13 
>PF07813 LTXXQ:  LTXXQ motif family protein;  InterPro: IPR012899 This five residue motif is found in a number of bacterial proteins bearing similarity to the protein CpxP (P32158 from SWISSPROT). This is a periplasmic protein that aids in combating extracytoplasmic protein-mediated toxicity, and may also be involved in the response to alkaline pH []. Another member of this family, Spy (P77754 from SWISSPROT) is also a periplasmic protein that may be involved in the response to stress []. The homology between CpxP and Spy may indicate that these two proteins are functionally related []. The motif is found repeated twice in many members of this entry. ; GO: 0042597 periplasmic space; PDB: 3ITF_B 3QZC_B 3OEO_D 3O39_A.
Probab=47.63  E-value=7.9  Score=21.78  Aligned_cols=16  Identities=0%  Similarity=0.027  Sum_probs=11.8

Q ss_pred             cchhhhccCChhhhccc
Q psy8830          52 KREVQDRRKPAVPRTNL   68 (70)
Q Consensus        52 ag~ly~r~m~~~er~~L   68 (70)
                      --.|| .+||+++|+.|
T Consensus        81 ~~~~~-~vLt~eQk~~~   96 (100)
T PF07813_consen   81 QHALY-AVLTPEQKEKF   96 (100)
T ss_dssp             HHHHH-TTS-HHHHHHH
T ss_pred             HHHHH-hcCCHHHHHHH
Confidence            34678 89999999865


No 14 
>smart00398 HMG high mobility group.
Probab=46.90  E-value=7.2  Score=20.40  Aligned_cols=16  Identities=6%  Similarity=-0.110  Sum_probs=13.3

Q ss_pred             cchhhhccCChhhhccc
Q psy8830          52 KREVQDRRKPAVPRTNL   68 (70)
Q Consensus        52 ag~ly~r~m~~~er~~L   68 (70)
                      .|..| +.|++++|...
T Consensus        36 ~~~~W-~~l~~~ek~~y   51 (70)
T smart00398       36 LGERW-KLLSEEEKAPY   51 (70)
T ss_pred             HHHHH-HcCCHHHHHHH
Confidence            67889 89999998754


No 15 
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include the fungal mating type gene products MC, MATA1 and Ste11.
Probab=42.23  E-value=13  Score=20.47  Aligned_cols=15  Identities=7%  Similarity=0.020  Sum_probs=13.2

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|+.| +.|++++|+.
T Consensus        36 ~g~~W-k~ls~eeK~~   50 (77)
T cd01389          36 IGRMW-RSESPEVKAY   50 (77)
T ss_pred             HHHHH-hhCCHHHHHH
Confidence            78999 8999999874


No 16 
>PF09011 HMG_box_2:  HMG-box domain;  InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins. It has no known function. ; GO: 0005634 nucleus; PDB: 2EQZ_A 1V64_A 2CTO_A 1H5P_A 3TQ6_A 3FGH_A 3TMM_A 1J3X_A 2YRQ_A 1AAB_A ....
Probab=42.21  E-value=7.4  Score=21.29  Aligned_cols=19  Identities=5%  Similarity=-0.011  Sum_probs=15.0

Q ss_pred             CcccccchhhhccCChhhhcc
Q psy8830          47 LVLKSKREVQDRRKPAVPRTN   67 (70)
Q Consensus        47 df~Q~ag~ly~r~m~~~er~~   67 (70)
                      -+.. .+..| +.||++||+.
T Consensus        35 ~~k~-~~~~W-k~Ls~~EK~~   53 (73)
T PF09011_consen   35 VMKE-ISERW-KSLSEEEKEP   53 (73)
T ss_dssp             HHHH-HHHHH-HHS-HHHHHH
T ss_pred             HHHH-HHHHH-HhcCHHHHHH
Confidence            4667 89999 8999999874


No 17 
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors. HMGs bind to the minor groove of DNA and have been classified by DNA binding preferences. Two phylogenically distinct groups of Class I proteins bind DNA in a sequence specific fashion and contain a single HMG box. One group (SOX-TCF) includes transcription factors, TCF-1, -3, -4; and also SRY and LEF-1, which bind four-way DNA junctions and duplex DNA targets. The second group (MATA) includes fungal mating type gene products MC, MATA1 and Ste11. Class II and III proteins (HMGB-UBF) bind DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III member
Probab=40.48  E-value=14  Score=18.97  Aligned_cols=15  Identities=7%  Similarity=0.034  Sum_probs=12.7

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|..| +.|++++|+.
T Consensus        35 ~~~~W-~~l~~~~k~~   49 (66)
T cd00084          35 LGEMW-KSLSEEEKKK   49 (66)
T ss_pred             HHHHH-HhCCHHHHHH
Confidence            67889 8999999864


No 18 
>KOG0527|consensus
Probab=38.05  E-value=12  Score=27.08  Aligned_cols=20  Identities=0%  Similarity=-0.080  Sum_probs=16.1

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      =.+ =|..| |+|+++||.-+|
T Consensus        94 SK~-LG~~W-K~Lse~EKrPFi  113 (331)
T KOG0527|consen   94 SKR-LGAEW-KLLSEEEKRPFV  113 (331)
T ss_pred             HHH-HHHHH-hhcCHhhhccHH
Confidence            346 79999 899999997654


No 19 
>PTZ00199 high mobility group protein; Provisional
Probab=36.17  E-value=18  Score=20.99  Aligned_cols=15  Identities=7%  Similarity=-0.006  Sum_probs=12.9

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|+.| +.|+++||..
T Consensus        59 ige~W-k~ls~eeK~~   73 (94)
T PTZ00199         59 VGEAW-NKLSEEEKAP   73 (94)
T ss_pred             HHHHH-HcCCHHHHHH
Confidence            58899 8999999864


No 20 
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins. These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif.
Probab=32.82  E-value=22  Score=19.25  Aligned_cols=15  Identities=0%  Similarity=-0.121  Sum_probs=13.0

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|+.| +.||+++|..
T Consensus        36 l~~~W-k~ls~~eK~~   50 (72)
T cd01388          36 LGDRW-KALSNEEKQP   50 (72)
T ss_pred             HHHHH-HcCCHHHHHH
Confidence            78899 8999999864


No 21 
>PF00505 HMG_box:  HMG (high mobility group) box;  InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin. HMG1 (also called HMG-T in fish) and HMG2 are two highly related proteins that bind single-stranded DNA preferentially and unwind double-stranded DNA. Although they have no sequence specificity, they have a high affinity for bent or distorted DNA, and bend linear DNA. HMG1 and HMG2 contain two DNA-binding HMG-box domains (A and B) that show structural and functional differences, and have a long acidic C-terminal domain rich in aspartic and glutamic acid residues. The acidic tail modulates the affinity of the tandem HMG boxes in HMG1 and 2 for a variety of DNA targets. HMG1 and 2 appear to play important architectural roles in the assembly of nucleoprotein complexes in a variety of biological processes, for example V(D)J recombination, the initiation of transcription, and DNA repair []. The profile in this entry describing the HMG-domains is much more general than the signature. In addition to the HMG1 and HMG2 proteins, HMG-domains occur in single or multiple copies in the following protein classes; the SOX family of transcription factors; SRY sex determining region Y protein and related proteins []; LEF1 lymphoid enhancer binding factor 1 []; SSRP recombination signal recognition protein; MTF1 mitochondrial transcription factor 1; UBF1/2 nucleolar transcription factors; Abf2 yeast ARS-binding factor []; and Saccharomyces cerevisiae transcription factors Ixr1, Rox1, Nhp6a, Nhp6b and Spp41.; GO: 0003677 DNA binding; PDB: 1I11_A 1J3C_A 1J3D_A 1WZ6_A 1WGF_A 2D7L_A 1GT0_D 3U2B_C 2CRJ_A 2CS1_A ....
Probab=32.66  E-value=15  Score=19.29  Aligned_cols=15  Identities=0%  Similarity=-0.015  Sum_probs=13.0

Q ss_pred             cchhhhccCChhhhcc
Q psy8830          52 KREVQDRRKPAVPRTN   67 (70)
Q Consensus        52 ag~ly~r~m~~~er~~   67 (70)
                      .|..| +.|++++|+.
T Consensus        35 ~~~~W-~~l~~~eK~~   49 (69)
T PF00505_consen   35 LAQMW-KNLSEEEKAP   49 (69)
T ss_dssp             HHHHH-HCSHHHHHHH
T ss_pred             HHHHH-hcCCHHHHHH
Confidence            78899 8999999874


No 22 
>PF12650 DUF3784:  Domain of unknown function (DUF3784);  InterPro: IPR017259 This group represents an uncharacterised conserved protein.
Probab=31.58  E-value=23  Score=20.48  Aligned_cols=11  Identities=0%  Similarity=-0.058  Sum_probs=9.2

Q ss_pred             hhccCChhhhcc
Q psy8830          56 QDRRKPAVPRTN   67 (70)
Q Consensus        56 y~r~m~~~er~~   67 (70)
                      | +.||++||+.
T Consensus        26 y-ntms~eEk~~   36 (97)
T PF12650_consen   26 Y-NTMSKEEKEK   36 (97)
T ss_pred             c-ccCCHHHHHH
Confidence            7 7899999974


No 23 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=30.21  E-value=9.2  Score=18.66  Aligned_cols=13  Identities=31%  Similarity=0.554  Sum_probs=6.5

Q ss_pred             ccCChhhhccccC
Q psy8830          58 RRKPAVPRTNLIC   70 (70)
Q Consensus        58 r~m~~~er~~Lv~   70 (70)
                      ++...++|+|+||
T Consensus        13 ~ip~gd~r~R~vC   25 (34)
T PF14803_consen   13 RIPEGDDRERLVC   25 (34)
T ss_dssp             E--TT-SS-EEEE
T ss_pred             hcCCCCCccceEC
Confidence            5666777888776


No 24 
>PF05001 RNA_pol_Rpb1_R:  RNA polymerase Rpb1 C-terminal repeat ;  InterPro: IPR000684 RNA polymerase II (2.7.7.6 from EC) [, ] is one of the three forms of RNA polymerase that exist in eukaryotic nuclei. The C-terminal region of the largest subunit of this oligomeric enzyme consists of the tandem repeat of a conserved heptapeptide []. The number of repeats varies according to the species (for example there are 17 in Plasmodium, 26 in yeast, 44 in Drosophila, and 52 in mammals). The region containing these repeats is essential for the function of polymerase II. This repeated heptapeptide (called CT7n or CTD) is rich in hydroxyl groups. It probably projects out of the globular catalytic domain and may interact with the acidic activator domains of transcriptional regulatory proteins. It is also known to bind by intercalation to DNA. RNA polymerase II is activated by phosphorylation. The serine and threonine residues in the CT7n repeats are the target of such phosphorylation.; GO: 0003677 DNA binding, 0006366 transcription from RNA polymerase II promoter, 0005665 DNA-directed RNA polymerase II, core complex; PDB: 2L0I_B 2GHQ_C 2GHT_C.
Probab=28.57  E-value=21  Score=14.19  Aligned_cols=9  Identities=44%  Similarity=0.896  Sum_probs=4.0

Q ss_pred             CCCeecCCC
Q psy8830           8 GAPNYYPNS   16 (70)
Q Consensus         8 ~~pnY~PNs   16 (70)
                      ..|+|.|.|
T Consensus         3 ~SP~ysPtS   11 (14)
T PF05001_consen    3 TSPGYSPTS   11 (14)
T ss_dssp             TB---BTTB
T ss_pred             CCCCCCccC
Confidence            357888876


No 25 
>PLN02417 dihydrodipicolinate synthase
Probab=27.74  E-value=23  Score=24.35  Aligned_cols=19  Identities=21%  Similarity=-0.170  Sum_probs=15.9

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      ... .|+.+  .||.+||.+|+
T Consensus        42 ~Gs-tGE~~--~ls~~Er~~~~   60 (280)
T PLN02417         42 GGT-TGEGQ--LMSWDEHIMLI   60 (280)
T ss_pred             Ccc-Ccchh--hCCHHHHHHHH
Confidence            355 89998  89999999875


No 26 
>PF02071 NSF:  Aromatic-di-Alanine (AdAR) repeat ;  InterPro: IPR000744 Regulated exocytosis of neurotransmitters and hormones, as well as intracellular traffic, requires fusion of two lipid bilayers. SNARE proteins are thought to form a protein bridge, the SNARE complex, between an incoming vesicle and the acceptor compartment. SNARE proteins contribute to the specificity of membrane fusion, implying that the mechanisms by which SNAREs are targeted to subcellular compartments are important for specific docking and fusion of vesicles. This mechanism involves a family of conserved proteins, members of which appear to function at all sites of constitutive and regulated secretion in eukaryotes []. Among them are 2 types of cytosolic protein, NSF (N-ethyl-maleimide-sensitive protein) and the SNAPs (alpha-, beta- and gamma-soluble NSF attachment proteins). The yeast vesicular fusion protein, sec17, a cytoplasmic peripheral membrane protein involved in vesicular transport between the endoplasmic reticulum and the golgi apparatus, shows a high degree of sequence similarity to the alpha-SNAP family.  SNAP-25 and its non-neuronal homologue Syndet/SNAP-23 are synthesized as soluble proteins in the cytosol. Both SNAP-25 and Syndet/SNAP-23 are palmitoylated at cysteine residues clustered in a loop between two N- and C-terminal coils and palmitoylation is essential for membrane binding and plasma membrane targeting. The C-terminal and the N-terminal helices of SNAP-25, are each targeted to the plasma membrane by two distinct cysteine-rich domains and appear to regulate the availability of SNAP to form complexes with SNARE [].; GO: 0006886 intracellular protein transport
Probab=27.47  E-value=11  Score=14.38  Aligned_cols=9  Identities=22%  Similarity=-0.046  Sum_probs=5.7

Q ss_pred             Ccccccchhh
Q psy8830          47 LVLKSKREVQ   56 (70)
Q Consensus        47 df~Q~ag~ly   56 (70)
                      +|.| |+++|
T Consensus         4 ~y~~-Aa~~y   12 (12)
T PF02071_consen    4 CYEK-AAECY   12 (12)
T ss_pred             HHHH-HHhhC
Confidence            4666 77665


No 27 
>PF00701 DHDPS:  Dihydrodipicolinate synthetase family;  InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue []. Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Rhizobium meliloti (Sinorhizobium meliloti) protein mosA [], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry []. Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 3B4U_B 3S8H_A 3QZE_B 1XXX_F 3L21_F 3IRD_A 3A5F_B 3G0S_B 3DAQ_C 3UQN_A ....
Probab=26.57  E-value=26  Score=23.87  Aligned_cols=16  Identities=19%  Similarity=0.183  Sum_probs=13.0

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+.+  .||.+||.+|+
T Consensus        45 tGE~~--~Lt~~Er~~l~   60 (289)
T PF00701_consen   45 TGEFY--SLTDEERKELL   60 (289)
T ss_dssp             TTTGG--GS-HHHHHHHH
T ss_pred             Ccccc--cCCHHHHHHHH
Confidence            78888  89999999875


No 28 
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=26.32  E-value=24  Score=23.82  Aligned_cols=19  Identities=16%  Similarity=0.120  Sum_probs=15.7

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      ..- .|+.+  .||.+||.+|+
T Consensus        38 ~Gs-tGE~~--~ls~~Er~~l~   56 (281)
T cd00408          38 LGT-TGEAP--TLTDEERKEVI   56 (281)
T ss_pred             CCC-Ccccc--cCCHHHHHHHH
Confidence            445 89998  89999999875


No 29 
>PF11918 DUF3436:  Domain of unknown function (DUF3436);  InterPro: IPR024591 This uncharacterised N-terminal domain is associated with the interphotoreceptor retinol-binding protein family. It is about 50 amino acids in length and has two conserved sequence motifs: DPRL and SYEP.
Probab=26.06  E-value=61  Score=17.61  Aligned_cols=17  Identities=24%  Similarity=0.464  Sum_probs=12.7

Q ss_pred             CeecCCCCCCCCCCCCC
Q psy8830          10 PNYYPNSFKGPEPTPRG   26 (70)
Q Consensus        10 pnY~PNs~~g~~~~~~~   26 (70)
                      +.||||....|+..+..
T Consensus        19 ISYEP~~~eaP~~~p~~   35 (55)
T PF11918_consen   19 ISYEPSYVEAPQQPPAL   35 (55)
T ss_pred             EEeCCCCCCCCCCCCCC
Confidence            67999988777666554


No 30 
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=26.02  E-value=26  Score=23.80  Aligned_cols=16  Identities=13%  Similarity=0.063  Sum_probs=14.2

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+.+  .||.+||.+|+
T Consensus        44 tGE~~--~lt~~Er~~l~   59 (284)
T cd00950          44 TGESP--TLSDEEHEAVI   59 (284)
T ss_pred             Ccchh--hCCHHHHHHHH
Confidence            88998  89999999875


No 31 
>PRK12751 cpxP periplasmic stress adaptor protein CpxP; Reviewed
Probab=24.67  E-value=32  Score=22.35  Aligned_cols=14  Identities=7%  Similarity=0.055  Sum_probs=9.6

Q ss_pred             hhhhccCChhhhccc
Q psy8830          54 EVQDRRKPAVPRTNL   68 (70)
Q Consensus        54 ~ly~r~m~~~er~~L   68 (70)
                      ..| .+||++||+.|
T Consensus       125 qmy-~lLTPEQra~l  138 (162)
T PRK12751        125 QMY-NLLTPEQKEAL  138 (162)
T ss_pred             HHH-HcCCHHHHHHH
Confidence            356 67888877755


No 32 
>PF05494 Tol_Tol_Ttg2:  Toluene tolerance, Ttg2 ;  InterPro: IPR008869 Toluene tolerance is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation []. Many proteins are involved in these processes. This family is a transporter which shows similarity to ABC transporters [].; PDB: 2QGU_A.
Probab=24.36  E-value=29  Score=21.88  Aligned_cols=16  Identities=13%  Similarity=0.279  Sum_probs=11.9

Q ss_pred             chhhhccCChhhhcccc
Q psy8830          53 REVQDRRKPAVPRTNLI   69 (70)
Q Consensus        53 g~ly~r~m~~~er~~Lv   69 (70)
                      |.-| +.+|++||++++
T Consensus        49 G~~w-~~~s~~q~~~F~   64 (170)
T PF05494_consen   49 GRYW-RKASPAQRQRFV   64 (170)
T ss_dssp             GGGT-TTS-HHHHHHHH
T ss_pred             HHhH-hhCCHHHHHHHH
Confidence            5558 899999998764


No 33 
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=23.81  E-value=28  Score=23.99  Aligned_cols=19  Identities=5%  Similarity=-0.064  Sum_probs=16.0

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      ..- .|+++  .||.+||.+|+
T Consensus        46 ~Gs-tGE~~--~Lt~eEr~~v~   64 (296)
T TIGR03249        46 AGG-TGEFF--SLTPAEYEQVV   64 (296)
T ss_pred             CCC-CcCcc--cCCHHHHHHHH
Confidence            456 89998  89999999875


No 34 
>PRK10455 periplasmic protein; Reviewed
Probab=23.63  E-value=33  Score=22.14  Aligned_cols=13  Identities=0%  Similarity=0.038  Sum_probs=10.5

Q ss_pred             hhhccCChhhhccc
Q psy8830          55 VQDRRKPAVPRTNL   68 (70)
Q Consensus        55 ly~r~m~~~er~~L   68 (70)
                      +| .+||+++|+.|
T Consensus       126 iy-~vLTPEQr~q~  138 (161)
T PRK10455        126 IY-NVLTPEQKKQF  138 (161)
T ss_pred             HH-HhCCHHHHHHH
Confidence            67 79999998754


No 35 
>PF10293 DUF2405:  Domain of unknown function (DUF2405);  InterPro: IPR019409 The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies [].  This entry represents a conserved region found within FMP27.
Probab=23.49  E-value=17  Score=23.28  Aligned_cols=25  Identities=12%  Similarity=-0.056  Sum_probs=21.0

Q ss_pred             CCCCcccccchhhhccCChhhhcccc
Q psy8830          44 NGGLVLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        44 ~~ddf~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      +||-|.+.=|..| ++.-.|+|+||-
T Consensus       114 eDDPFE~~L~~Iy-~lGl~Eq~~Rl~  138 (157)
T PF10293_consen  114 EDDPFESELGMIY-RLGLDEQRERLE  138 (157)
T ss_pred             eCCHHHHHHHHHH-HHhhHHHHHHHH
Confidence            5667999678889 899999999873


No 36 
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=22.99  E-value=30  Score=23.83  Aligned_cols=16  Identities=6%  Similarity=-0.012  Sum_probs=14.1

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+++  .||.+||.+|+
T Consensus        44 tGE~~--~Ls~eEr~~l~   59 (289)
T cd00951          44 TGEFF--SLTPDEYAQVV   59 (289)
T ss_pred             CcCcc--cCCHHHHHHHH
Confidence            88888  89999999875


No 37 
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=22.92  E-value=31  Score=23.58  Aligned_cols=19  Identities=21%  Similarity=0.083  Sum_probs=15.6

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      ..- .|+.+  .||.+||.+|+
T Consensus        42 ~Gs-~GE~~--~ls~~Er~~~~   60 (292)
T PRK03170         42 VGT-TGESP--TLTHEEHEELI   60 (292)
T ss_pred             CCc-CCccc--cCCHHHHHHHH
Confidence            345 89998  89999999875


No 38 
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=22.23  E-value=32  Score=23.66  Aligned_cols=16  Identities=6%  Similarity=0.057  Sum_probs=13.7

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+.+  .||.+||.+|+
T Consensus        48 tGE~~--~Ls~eEr~~~~   63 (293)
T PRK04147         48 TGEAF--LLSTEEKKQVL   63 (293)
T ss_pred             ccccc--cCCHHHHHHHH
Confidence            68888  89999998875


No 39 
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=21.41  E-value=33  Score=23.52  Aligned_cols=16  Identities=6%  Similarity=-0.087  Sum_probs=14.0

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+++  .||.+||.+|+
T Consensus        43 tGE~~--~Lt~eEr~~l~   58 (279)
T cd00953          43 TGLGP--SLSFQEKLELL   58 (279)
T ss_pred             CCCcc--cCCHHHHHHHH
Confidence            78888  89999999875


No 40 
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=20.63  E-value=38  Score=23.32  Aligned_cols=19  Identities=16%  Similarity=0.197  Sum_probs=16.0

Q ss_pred             cccccchhhhccCChhhhcccc
Q psy8830          48 VLKSKREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        48 f~Q~ag~ly~r~m~~~er~~Lv   69 (70)
                      =.| +.+||  .|++.||.+|.
T Consensus        69 ~~~-~~dl~--~msEaeRR~L~   87 (258)
T COG4107          69 DGQ-PRDLY--TMSEAERRRLL   87 (258)
T ss_pred             CCC-chhHh--hhchHHHHHHh
Confidence            357 99999  69999998874


No 41 
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM. The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins are members of the pfam05494 family of putative transporters known as "toluene tolerance protein Ttg2D", although it is unlikely that the members included here have anything to do with toluene per-se.
Probab=20.52  E-value=36  Score=22.42  Aligned_cols=16  Identities=13%  Similarity=0.052  Sum_probs=12.6

Q ss_pred             chhhhccCChhhhcccc
Q psy8830          53 REVQDRRKPAVPRTNLI   69 (70)
Q Consensus        53 g~ly~r~m~~~er~~Lv   69 (70)
                      |.-| |.+|++||++++
T Consensus        75 G~~W-~~~s~~Qr~~F~   90 (198)
T TIGR03481        75 GSSW-TSLSPEQRRRFI   90 (198)
T ss_pred             hhhh-hhCCHHHHHHHH
Confidence            4568 789999998764


No 42 
>TIGR00674 dapA dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment.
Probab=20.39  E-value=37  Score=23.17  Aligned_cols=16  Identities=13%  Similarity=0.079  Sum_probs=14.1

Q ss_pred             cchhhhccCChhhhcccc
Q psy8830          52 KREVQDRRKPAVPRTNLI   69 (70)
Q Consensus        52 ag~ly~r~m~~~er~~Lv   69 (70)
                      .|+.+  .||.+||.+|+
T Consensus        42 tGE~~--~Ls~~Er~~~~   57 (285)
T TIGR00674        42 TGESP--TLSHEEHKKVI   57 (285)
T ss_pred             Ccccc--cCCHHHHHHHH
Confidence            89997  89999999875


No 43 
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=20.07  E-value=38  Score=21.98  Aligned_cols=13  Identities=0%  Similarity=-0.005  Sum_probs=10.2

Q ss_pred             hhhccCChhhhccc
Q psy8830          55 VQDRRKPAVPRTNL   68 (70)
Q Consensus        55 ly~r~m~~~er~~L   68 (70)
                      +| .+||++||+.|
T Consensus       133 ~~-~vLTpEQRak~  145 (170)
T PRK12750        133 ML-SILTPEQKAKF  145 (170)
T ss_pred             HH-HhCCHHHHHHH
Confidence            56 78898888765


Done!