Query         psy8831
Match_columns 88
No_of_seqs    118 out of 763
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:17:48 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8831.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8831hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00202 ZnF_GATA Zinc finger D  99.7 6.3E-18 1.4E-22  101.8   3.6   43   19-61      1-44  (54)
  2 smart00401 ZnF_GATA zinc finge  99.7 3.8E-17 8.3E-22   97.5   3.6   45   16-60      2-48  (52)
  3 PF00320 GATA:  GATA zinc finge  99.6 1.2E-16 2.6E-21   89.1   1.3   34   20-53      1-35  (36)
  4 COG5641 GAT1 GATA Zn-finger-co  99.0 2.2E-10 4.7E-15   93.8   2.6   49   17-65    158-212 (498)
  5 KOG1601|consensus               98.9 5.3E-10 1.2E-14   78.2   3.1   46   17-62    199-245 (340)
  6 COG5641 GAT1 GATA Zn-finger-co  94.5    0.02 4.3E-07   47.6   1.7   49   16-64    296-346 (498)
  7 KOG3554|consensus               93.9    0.16 3.4E-06   42.9   5.6   37   17-53    386-425 (693)
  8 PF01412 ArfGap:  Putative GTPa  88.7    0.39 8.5E-06   32.0   2.3   39   14-53     10-48  (116)
  9 PF08271 TF_Zn_Ribbon:  TFIIB z  88.2    0.13 2.8E-06   28.8  -0.2   28   19-48      2-29  (43)
 10 COG5347 GTPase-activating prot  86.7    0.39 8.4E-06   37.9   1.6   40   12-52     15-54  (319)
 11 smart00105 ArfGap Putative GTP  85.8    0.72 1.6E-05   30.6   2.3   38   16-54      2-39  (112)
 12 PRK03988 translation initiatio  82.2    0.35 7.6E-06   33.9  -0.4   29   18-46    103-131 (138)
 13 TIGR00311 aIF-2beta translatio  81.6    0.39 8.5E-06   33.5  -0.3   29   18-46     98-126 (133)
 14 smart00653 eIF2B_5 domain pres  81.6    0.39 8.4E-06   32.4  -0.3   29   18-46     81-109 (110)
 15 KOG3740|consensus               81.5    0.59 1.3E-05   40.3   0.6   31   16-46    461-495 (706)
 16 PF11781 RRN7:  RNA polymerase   79.5    0.64 1.4E-05   25.6   0.2   25   18-46      9-33  (36)
 17 PF06677 Auto_anti-p27:  Sjogre  77.6    0.92   2E-05   25.8   0.4   26   16-45     16-41  (41)
 18 PRK12336 translation initiatio  76.6    0.67 1.4E-05   34.0  -0.4   29   18-46     99-127 (201)
 19 PF15396 FAM60A:  Protein Famil  75.9     1.9   4E-05   32.6   1.8   15   37-52     49-63  (213)
 20 PF14803 Nudix_N_2:  Nudix N-te  73.9    0.91   2E-05   24.8  -0.2   28   19-46      2-30  (34)
 21 PF01873 eIF-5_eIF-2B:  Domain   73.4       1 2.2E-05   31.0  -0.2   29   18-46     94-122 (125)
 22 PRK00423 tfb transcription ini  72.9     1.6 3.6E-05   33.6   0.9   32   15-48      9-40  (310)
 23 PF06689 zf-C4_ClpX:  ClpX C4-t  71.2     1.5 3.2E-05   24.6   0.2   30   18-47      2-33  (41)
 24 PLN03114 ADP-ribosylation fact  70.2     3.2 6.8E-05   33.9   1.9   39   14-53     19-57  (395)
 25 PRK12286 rpmF 50S ribosomal pr  68.9     1.6 3.6E-05   26.3   0.1   26   15-48     25-50  (57)
 26 PRK14892 putative transcriptio  68.6     1.9 4.2E-05   28.8   0.4   36   14-50     18-54  (99)
 27 KOG0706|consensus               68.4     2.8   6E-05   34.8   1.3   41   13-54     19-59  (454)
 28 PRK00420 hypothetical protein;  66.2       3 6.4E-05   28.5   0.9   29   16-48     22-50  (112)
 29 COG3529 Predicted nucleic-acid  65.6     1.6 3.5E-05   27.3  -0.4   34   16-49      9-43  (66)
 30 KOG0703|consensus               65.5     2.3 4.9E-05   33.4   0.3   34   16-50     24-57  (287)
 31 PF09526 DUF2387:  Probable met  65.0     2.1 4.6E-05   26.9  -0.0   34   16-49      7-41  (71)
 32 COG1405 SUA7 Transcription ini  64.6     2.7 5.8E-05   32.6   0.5   29   18-48      2-30  (285)
 33 COG1645 Uncharacterized Zn-fin  64.0     2.6 5.5E-05   29.7   0.3   27   15-46     26-52  (131)
 34 PF13248 zf-ribbon_3:  zinc-rib  63.1     4.9 0.00011   20.2   1.2   22   18-46      3-24  (26)
 35 PF01096 TFIIS_C:  Transcriptio  60.1     1.2 2.6E-05   24.7  -1.6   30   19-48      2-38  (39)
 36 PF07282 OrfB_Zn_ribbon:  Putat  59.1     4.4 9.6E-05   24.1   0.7   34   11-47     22-55  (69)
 37 PF13240 zinc_ribbon_2:  zinc-r  58.4       6 0.00013   19.6   1.0   20   20-46      2-21  (23)
 38 PF02701 zf-Dof:  Dof domain, z  57.0      25 0.00055   21.9   3.8   45   15-59      3-51  (63)
 39 TIGR02443 conserved hypothetic  57.0     3.7   8E-05   25.3   0.1   33   16-48      8-41  (59)
 40 KOG1598|consensus               55.2     6.7 0.00015   33.1   1.3   28   18-47      1-28  (521)
 41 smart00778 Prim_Zn_Ribbon Zinc  54.0     7.9 0.00017   21.5   1.1   28   18-45      4-32  (37)
 42 cd07172 NR_DBD_GR_PR DNA-bindi  53.4      10 0.00022   23.8   1.7   32   18-53      3-34  (78)
 43 cd07168 NR_DBD_DHR4_like DNA-b  53.3     9.8 0.00021   24.5   1.6   34   16-53      5-38  (90)
 44 cd07171 NR_DBD_ER DNA-binding   53.2      11 0.00023   23.9   1.8   32   18-53      4-35  (82)
 45 smart00659 RPOLCX RNA polymera  52.4     5.6 0.00012   22.7   0.3   24   19-46      4-27  (44)
 46 cd07170 NR_DBD_ERR DNA-binding  51.3      11 0.00024   24.7   1.7   31   18-52      5-35  (97)
 47 cd07169 NR_DBD_GCNF_like DNA-b  51.0      13 0.00027   24.0   1.9   33   16-52      5-37  (90)
 48 PF01783 Ribosomal_L32p:  Ribos  50.9     4.1 8.9E-05   24.1  -0.4   24   16-47     25-48  (56)
 49 smart00440 ZnF_C2C2 C2C2 Zinc   50.9     3.8 8.3E-05   22.7  -0.5   30   19-48      2-38  (40)
 50 TIGR01384 TFS_arch transcripti  50.5     5.2 0.00011   25.7  -0.0   35   15-49     60-101 (104)
 51 PF12760 Zn_Tnp_IS1595:  Transp  50.0     6.8 0.00015   22.0   0.4   27   17-45     18-44  (46)
 52 TIGR01385 TFSII transcription   49.9     6.4 0.00014   30.7   0.4   38   13-50    254-298 (299)
 53 cd07160 NR_DBD_LXR DNA-binding  49.8      11 0.00024   24.9   1.5   34   16-53     17-50  (101)
 54 cd07173 NR_DBD_AR DNA-binding   48.9      14 0.00029   23.5   1.8   31   18-52      4-34  (82)
 55 PLN03119 putative ADP-ribosyla  47.0      10 0.00022   32.8   1.1   34   14-48     20-53  (648)
 56 cd07155 NR_DBD_ER_like DNA-bin  46.9      12 0.00026   23.1   1.3   29   20-52      1-29  (75)
 57 cd07165 NR_DBD_DmE78_like DNA-  46.7      14  0.0003   23.2   1.5   29   20-52      1-29  (81)
 58 cd06968 NR_DBD_ROR DNA-binding  45.8      15 0.00032   24.0   1.6   32   17-52      5-36  (95)
 59 PF09297 zf-NADH-PPase:  NADH p  45.6     4.6  0.0001   21.1  -0.7   27   17-47      3-30  (32)
 60 KOG1597|consensus               45.6      10 0.00022   30.2   0.9   33   19-51      2-34  (308)
 61 cd06955 NR_DBD_VDR DNA-binding  45.5     8.8 0.00019   25.7   0.5   33   16-52      5-37  (107)
 62 cd07166 NR_DBD_REV_ERB DNA-bin  45.2     8.9 0.00019   24.6   0.5   32   17-52      3-34  (89)
 63 cd07162 NR_DBD_PXR DNA-binding  45.1      15 0.00033   23.3   1.6   29   20-52      2-30  (87)
 64 PF12773 DZR:  Double zinc ribb  45.1      15 0.00033   20.4   1.4   27   16-46     11-37  (50)
 65 PHA00626 hypothetical protein   45.1     7.4 0.00016   24.0   0.1   32   19-50      2-35  (59)
 66 PLN03131 hypothetical protein;  45.0      11 0.00024   32.8   1.2   35   14-49     20-54  (705)
 67 PF04161 Arv1:  Arv1-like famil  44.8      10 0.00022   27.7   0.8   27   19-45      2-31  (208)
 68 PRK00085 recO DNA repair prote  44.7      11 0.00024   27.2   1.0   29   17-45    149-177 (247)
 69 COG1326 Uncharacterized archae  44.4     4.3 9.4E-05   30.4  -1.2   35   14-48      3-40  (201)
 70 cd07158 NR_DBD_Ppar_like The D  44.4      15 0.00032   22.5   1.3   29   20-52      1-29  (73)
 71 cd07161 NR_DBD_EcR DNA-binding  44.1      16 0.00036   23.6   1.6   31   19-53      3-33  (91)
 72 KOG0818|consensus               43.9      15 0.00033   31.6   1.7   37   15-52      6-42  (669)
 73 cd06963 NR_DBD_GR_like The DNA  43.9      14 0.00031   22.8   1.2   30   20-53      1-30  (73)
 74 COG1066 Sms Predicted ATP-depe  43.8     9.3  0.0002   31.8   0.5   25   16-47      6-30  (456)
 75 cd06956 NR_DBD_RXR DNA-binding  43.5      16 0.00035   22.7   1.4   31   19-53      2-32  (77)
 76 cd07179 2DBD_NR_DBD2 The secon  43.5      16 0.00035   22.5   1.4   30   20-53      1-30  (74)
 77 KOG0909|consensus               42.7     6.4 0.00014   33.0  -0.6   45   16-60    160-216 (500)
 78 cd06966 NR_DBD_CAR DNA-binding  41.5     9.7 0.00021   24.8   0.2   30   19-52      2-31  (94)
 79 cd06964 NR_DBD_RAR DNA-binding  41.3     7.5 0.00016   24.8  -0.3   33   16-52      3-35  (85)
 80 cd06965 NR_DBD_Ppar DNA-bindin  40.6      12 0.00025   23.8   0.5   29   20-52      2-30  (84)
 81 COG2816 NPY1 NTP pyrophosphohy  39.5      11 0.00024   29.4   0.3   32   15-49    109-140 (279)
 82 PF00105 zf-C4:  Zinc finger, C  39.0      12 0.00026   22.4   0.3   29   19-51      2-30  (70)
 83 cd06961 NR_DBD_TR DNA-binding   38.7      17 0.00038   23.0   1.1   30   20-53      2-31  (85)
 84 TIGR01031 rpmF_bact ribosomal   38.3      12 0.00026   22.2   0.3   26   15-48     24-49  (55)
 85 cd07164 NR_DBD_PNR_like_1 DNA-  37.8      19 0.00041   22.4   1.1   30   20-53      1-30  (78)
 86 KOG0704|consensus               37.6     8.1 0.00017   31.5  -0.7   39   14-53     16-54  (386)
 87 cd07163 NR_DBD_TLX DNA-binding  37.2     9.3  0.0002   24.7  -0.4   33   16-52      5-37  (92)
 88 PF09723 Zn-ribbon_8:  Zinc rib  36.8      11 0.00024   20.9  -0.0   28   19-46      7-34  (42)
 89 cd06960 NR_DBD_HNF4A DNA-bindi  36.2      12 0.00025   23.1  -0.0   29   20-52      1-29  (76)
 90 PF03604 DNA_RNApol_7kD:  DNA d  35.3      21 0.00045   19.1   0.9   24   19-46      2-25  (32)
 91 COG1601 GCD7 Translation initi  35.3      11 0.00024   26.9  -0.2   30   17-46    105-134 (151)
 92 PRK01110 rpmF 50S ribosomal pr  35.2      13 0.00028   22.5   0.0   24   17-49     27-50  (60)
 93 PRK11823 DNA repair protein Ra  34.2      20 0.00044   29.0   1.0   26   15-47      5-30  (446)
 94 smart00399 ZnF_C4 c4 zinc fing  34.2      23  0.0005   21.3   1.1   28   20-51      2-29  (70)
 95 COG3952 Predicted membrane pro  33.8     9.3  0.0002   26.3  -0.8   18   31-49     77-94  (113)
 96 cd01121 Sms Sms (bacterial rad  33.2      18 0.00039   28.8   0.6   22   19-47      2-23  (372)
 97 cd06959 NR_DBD_EcR_like The DN  33.1      24 0.00052   21.6   1.0   29   20-52      2-30  (73)
 98 PF14471 DUF4428:  Domain of un  32.9      27 0.00059   20.3   1.2   27   19-46      1-28  (51)
 99 PHA02998 RNA polymerase subuni  32.8      18 0.00039   27.0   0.5   34   16-49    142-182 (195)
100 cd07157 2DBD_NR_DBD1 The first  32.6      11 0.00023   24.1  -0.7   30   19-52      2-31  (86)
101 PRK00432 30S ribosomal protein  32.2      17 0.00037   21.2   0.2   28   16-47     19-46  (50)
102 PRK08351 DNA-directed RNA poly  32.2      28  0.0006   21.4   1.2   15   18-32     16-31  (61)
103 PF02591 DUF164:  Putative zinc  32.0      12 0.00027   21.7  -0.4   30   16-46     21-54  (56)
104 cd06958 NR_DBD_COUP_TF DNA-bin  31.6      22 0.00049   21.8   0.7   16   37-52     14-29  (73)
105 cd06967 NR_DBD_TR2_like DNA-bi  31.5      13 0.00029   23.7  -0.3   32   17-52      3-34  (87)
106 COG2888 Predicted Zn-ribbon RN  31.3      16 0.00035   22.6   0.0    8   39-46     51-58  (61)
107 PRK06393 rpoE DNA-directed RNA  31.1      30 0.00064   21.5   1.2   16   17-32     17-33  (64)
108 smart00834 CxxC_CXXC_SSSS Puta  30.0      18 0.00038   19.1   0.0   27   19-46      7-34  (41)
109 smart00661 RPOL9 RNA polymeras  29.8      24 0.00052   19.6   0.6   28   19-48      2-30  (52)
110 PF09698 GSu_C4xC__C2xCH:  Geob  29.6      32 0.00069   18.6   1.0   18   25-44     18-35  (36)
111 PHA02942 putative transposase;  29.5      30 0.00065   27.6   1.3   33   11-47    319-351 (383)
112 COG5349 Uncharacterized protei  29.2      25 0.00054   24.6   0.7   36   15-52     19-54  (126)
113 cd06962 NR_DBD_FXR DNA-binding  29.2      15 0.00032   23.4  -0.4   31   19-53      3-33  (84)
114 PRK03564 formate dehydrogenase  29.1      22 0.00048   28.0   0.5   35   17-51    226-265 (309)
115 cd07156 NR_DBD_VDR_like The DN  29.1      26 0.00056   21.4   0.7   17   37-53     14-30  (72)
116 PF09889 DUF2116:  Uncharacteri  29.0      33 0.00071   20.9   1.1   28   17-51      3-31  (59)
117 PF04810 zf-Sec23_Sec24:  Sec23  29.0      27 0.00058   19.1   0.7   30   17-46      2-32  (40)
118 COG0675 Transposase and inacti  28.9      28  0.0006   25.2   0.9   26   13-46    305-330 (364)
119 KOG0317|consensus               28.6      58  0.0013   25.8   2.7   45   15-60    237-281 (293)
120 TIGR00613 reco DNA repair prot  28.0      30 0.00064   24.9   0.9   30   17-46    147-176 (241)
121 cd07167 NR_DBD_Lrh-1_like The   28.0      34 0.00073   22.2   1.1   16   37-52     14-29  (93)
122 TIGR03573 WbuX N-acetyl sugar   27.8      56  0.0012   25.4   2.5   32   17-50      1-33  (343)
123 PRK14890 putative Zn-ribbon RN  27.8      20 0.00044   22.0   0.0    8   39-46     49-56  (59)
124 TIGR00244 transcriptional regu  27.7      34 0.00075   24.4   1.2   36   18-53      1-43  (147)
125 PF08274 PhnA_Zn_Ribbon:  PhnA   27.5      16 0.00034   19.4  -0.4   24   18-46      3-27  (30)
126 PRK00398 rpoP DNA-directed RNA  27.4      22 0.00047   19.8   0.1   27   18-47      4-30  (46)
127 TIGR02605 CxxC_CxxC_SSSS putat  27.2      23  0.0005   19.9   0.2   27   19-46      7-34  (52)
128 PF08273 Prim_Zn_Ribbon:  Zinc-  27.2      26 0.00056   19.7   0.4   26   19-44      5-32  (40)
129 cd02337 ZZ_CBP Zinc finger, ZZ  27.1      44 0.00096   18.6   1.4   28   19-46      2-30  (41)
130 PRK06556 vitamin B12-dependent  26.7      24 0.00053   31.8   0.3   27   14-46    921-948 (953)
131 PF03811 Zn_Tnp_IS1:  InsA N-te  26.7      41 0.00088   18.4   1.1   28   16-44      4-35  (36)
132 PF07754 DUF1610:  Domain of un  26.4      31 0.00067   17.5   0.6   23   20-45      1-23  (24)
133 cd06916 NR_DBD_like DNA-bindin  25.6      14 0.00031   22.5  -0.9   29   20-52      1-29  (72)
134 PRK13715 conjugal transfer pro  25.4      51  0.0011   20.6   1.6   37   17-53     34-70  (73)
135 KOG2767|consensus               25.3      41 0.00089   27.6   1.4   32   18-49     97-129 (400)
136 smart00290 ZnF_UBP Ubiquitin C  25.3      28 0.00061   19.2   0.3   19   19-46      1-19  (50)
137 COG1997 RPL43A Ribosomal prote  25.0      27 0.00058   23.1   0.2   33   13-48     31-63  (89)
138 COG1734 DksA DnaK suppressor p  24.9      31 0.00068   23.6   0.5   34   18-51     81-114 (120)
139 PF13878 zf-C2H2_3:  zinc-finge  24.9      15 0.00032   20.5  -0.9   13   37-49     12-24  (41)
140 TIGR00416 sms DNA repair prote  24.7      35 0.00076   27.8   0.9   26   15-47      5-30  (454)
141 KOG2691|consensus               24.3      32  0.0007   23.7   0.5   34   15-48     71-111 (113)
142 cd06970 NR_DBD_PNR DNA-binding  24.1      22 0.00048   23.0  -0.3   32   17-52      6-37  (92)
143 COG4260 Membrane protease subu  24.0      42  0.0009   27.0   1.1   27   17-46    315-342 (345)
144 PRK14559 putative protein seri  24.0      42 0.00091   29.0   1.2   36   13-48     11-51  (645)
145 PF14122 YokU:  YokU-like prote  22.9      25 0.00054   23.2  -0.2   13   39-51     36-48  (87)
146 PF10058 DUF2296:  Predicted in  22.4      38 0.00081   20.0   0.5   36   11-46     16-52  (54)
147 PF01258 zf-dskA_traR:  Prokary  21.9      14 0.00031   19.6  -1.3   29   18-46      4-32  (36)
148 COG3058 FdhE Uncharacterized p  21.8      56  0.0012   26.0   1.5   32   18-50    226-264 (308)
149 PRK04023 DNA polymerase II lar  21.7      50  0.0011   30.5   1.3   31   16-46    637-671 (1121)
150 PF01286 XPA_N:  XPA protein N-  20.5      46   0.001   18.2   0.6   26   17-44      3-30  (34)
151 PF10080 DUF2318:  Predicted me  20.3      17 0.00038   24.2  -1.4   14   38-51     52-65  (102)

No 1  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=99.71  E-value=6.3e-18  Score=101.84  Aligned_cols=43  Identities=42%  Similarity=0.853  Sum_probs=39.2

Q ss_pred             ccccCCCCCCCccccCCCCC-CccchhHHHHhhhCCCCCCccCC
Q psy8831          19 SCANCSTTCTTLWRRNNNGE-PVCNACGLIMNTVDINAPEKIMP   61 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~~~~~~Rp~~~~~   61 (88)
                      .|+||++++||+||++++|. .|||||||||++++..||.....
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            59999999999999999544 99999999999999999998864


No 2  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=99.67  E-value=3.8e-17  Score=97.53  Aligned_cols=45  Identities=47%  Similarity=0.854  Sum_probs=41.2

Q ss_pred             CCcccccCCCCCCCccccCCCCC-CccchhHHHHhhhCCC-CCCccC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGE-PVCNACGLIMNTVDIN-APEKIM   60 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~~~~~~-Rp~~~~   60 (88)
                      ....|+||++++||+||+++.|. .|||||||||++++.. ||..+.
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~~rp~~~~   48 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGLKRPLSLK   48 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCCCCccccc
Confidence            46789999999999999999998 9999999999999998 887764


No 3  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=99.62  E-value=1.2e-16  Score=89.09  Aligned_cols=34  Identities=50%  Similarity=1.012  Sum_probs=28.4

Q ss_pred             cccCCCCCCCccccCCCCCC-ccchhHHHHhhhCC
Q psy8831          20 CANCSTTCTTLWRRNNNGEP-VCNACGLIMNTVDI   53 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~-lCNaCgl~~~~~~~   53 (88)
                      |++|++++||+||++++|.. |||||||||++++.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~~   35 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYGK   35 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHSS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhCC
Confidence            89999999999999999995 99999999999975


No 4  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=98.98  E-value=2.2e-10  Score=93.82  Aligned_cols=49  Identities=37%  Similarity=0.725  Sum_probs=43.7

Q ss_pred             CcccccCCCCCCCccccCCC-----CCCccchhHHHHhhhCCCC-CCccCCCchh
Q psy8831          17 GVSCANCSTTCTTLWRRNNN-----GEPVCNACGLIMNTVDINA-PEKIMPPIES   65 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~-----G~~lCNaCgl~~~~~~~~R-p~~~~~~~~~   65 (88)
                      ..+|.||.|+.||+|||+..     |.+||||||||++.||.+| |..++....+
T Consensus       158 ~~vc~Nc~t~stPlwrR~~~~~s~~~n~lcnaCgl~~klhg~~r~P~t~ks~~~k  212 (498)
T COG5641         158 PHVCSNCKTTSTPLWRRASSESSLPGNNLCNACGLYLKLHGSPRAPISLKSDSIK  212 (498)
T ss_pred             cchhccccccCCccccccccccccCCccccccccccccccCCcCCCccccccccc
Confidence            34999999999999999998     8899999999999999999 9988755443


No 5  
>KOG1601|consensus
Probab=98.95  E-value=5.3e-10  Score=78.23  Aligned_cols=46  Identities=41%  Similarity=0.793  Sum_probs=40.2

Q ss_pred             CcccccCCCCCCCccccCCCC-CCccchhHHHHhhhCCCCCCccCCC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNG-EPVCNACGLIMNTVDINAPEKIMPP   62 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G-~~lCNaCgl~~~~~~~~Rp~~~~~~   62 (88)
                      ...|++|++++||+||+++.| ..+|||||||++.++..|++.....
T Consensus       199 ~~~c~~~~~~~t~~~r~~~~g~~~~cnacgl~~k~~~~~r~~~~~~~  245 (340)
T KOG1601|consen  199 LRQCSNCGTTKTPLWRRGPEGPKSLCNACGLRYKKGGVRRPLPEKRP  245 (340)
T ss_pred             CcccCCCCCCCCcceecCCCCCccccccchhhhhhcCccccccccCc
Confidence            589999999999999999999 5999999999999986676665433


No 6  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=94.50  E-value=0.02  Score=47.56  Aligned_cols=49  Identities=29%  Similarity=0.407  Sum_probs=38.8

Q ss_pred             CCcccccCCC-CCCCccccCC-CCCCccchhHHHHhhhCCCCCCccCCCch
Q psy8831          16 SGVSCANCST-TCTTLWRRNN-NGEPVCNACGLIMNTVDINAPEKIMPPIE   64 (88)
Q Consensus        16 ~~~~C~nC~t-t~Tp~WRrg~-~G~~lCNaCgl~~~~~~~~Rp~~~~~~~~   64 (88)
                      ....+.+|.+ +.||.||+.. .+-++||+|+++.+.++..+|+..+...-
T Consensus       296 s~~~~s~~~~~~~tp~~~r~~~~~s~~~n~~~~~~~~~~~~~p~~pk~d~n  346 (498)
T COG5641         296 SDKKRSTLTTSTATPLWRRTSDKSSFSCNASGSALKPPGSKRPLLPKPDPN  346 (498)
T ss_pred             hhcCcccccccccCcccccccccccccccccccccCCcccccccCCCCChh
Confidence            3667888887 6789888775 44489999999999999999988754433


No 7  
>KOG3554|consensus
Probab=93.87  E-value=0.16  Score=42.93  Aligned_cols=37  Identities=24%  Similarity=0.539  Sum_probs=30.5

Q ss_pred             CcccccCCCCCCCcccc-C-CCCC-CccchhHHHHhhhCC
Q psy8831          17 GVSCANCSTTCTTLWRR-N-NNGE-PVCNACGLIMNTVDI   53 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRr-g-~~G~-~lCNaCgl~~~~~~~   53 (88)
                      .+-|.+|+|+++-.|=. | ++.+ .||-.|-+||+++|-
T Consensus       386 g~~CEsC~ttqs~qWYsWGppnmqcrLCasCWiyWKKygG  425 (693)
T KOG3554|consen  386 GRACESCYTTQSLQWYSWGPPNMQCRLCASCWIYWKKYGG  425 (693)
T ss_pred             CCcccccccccccceeccCCCCccchhhHHHHHHHHHhcC
Confidence            67899999999999843 3 4444 799999999999875


No 8  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=88.68  E-value=0.39  Score=31.99  Aligned_cols=39  Identities=26%  Similarity=0.588  Sum_probs=27.5

Q ss_pred             CCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ......|++|+.. -|.|-.-.-|-.||-.|.-..+..|.
T Consensus        10 ~~~N~~CaDCg~~-~p~w~s~~~GiflC~~Cag~HR~lg~   48 (116)
T PF01412_consen   10 KPGNKVCADCGAP-NPTWASLNYGIFLCLECAGIHRSLGV   48 (116)
T ss_dssp             STTCTB-TTT-SB-S--EEETTTTEEE-HHHHHHHHHHTT
T ss_pred             CcCcCcCCCCCCC-CCCEEEeecChhhhHHHHHHHHHhcc
Confidence            3467899999944 46999999999999999888887774


No 9  
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=88.19  E-value=0.13  Score=28.81  Aligned_cols=28  Identities=36%  Similarity=0.959  Sum_probs=19.9

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      .|.+|+.+. .++ ....|..+|..||+-.
T Consensus         2 ~Cp~Cg~~~-~~~-D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    2 KCPNCGSKE-IVF-DPERGELVCPNCGLVL   29 (43)
T ss_dssp             SBTTTSSSE-EEE-ETTTTEEEETTT-BBE
T ss_pred             CCcCCcCCc-eEE-cCCCCeEECCCCCCEe
Confidence            699999876 343 3456778999999843


No 10 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=86.72  E-value=0.39  Score=37.92  Aligned_cols=40  Identities=23%  Similarity=0.526  Sum_probs=32.6

Q ss_pred             CCCCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          12 GNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        12 ~~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ........|+.|++.. |.|-.-.-|..||-.|.=..|.-|
T Consensus        15 ~~~~~Nk~CaDCga~~-P~W~S~nlGvfiCi~CagvHRsLG   54 (319)
T COG5347          15 KSDSSNKKCADCGAPN-PTWASVNLGVFLCIDCAGVHRSLG   54 (319)
T ss_pred             hhccccCccccCCCCC-CceEecccCeEEEeecchhhhccc
Confidence            3556788999999999 999999999999999965444433


No 11 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=85.77  E-value=0.72  Score=30.61  Aligned_cols=38  Identities=21%  Similarity=0.535  Sum_probs=31.8

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCCC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDIN   54 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~   54 (88)
                      ....|++|+. .-|.|-.-.-|..||-.|.-..+..|.+
T Consensus         2 ~N~~CaDC~~-~~p~w~s~~~GifvC~~CsgiHR~lg~h   39 (112)
T smart00105        2 GNKKCFDCGA-PNPTWASVNLGVFLCIECSGIHRSLGVH   39 (112)
T ss_pred             CCCcccCCCC-CCCCcEEeccceeEhHHhHHHHHhcCCC
Confidence            3578999998 5599999999999999998888877654


No 12 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=82.23  E-value=0.35  Score=33.91  Aligned_cols=29  Identities=31%  Similarity=0.600  Sum_probs=21.3

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..|+..+|-+=+.+..=...|+|||-
T Consensus       103 VlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988        103 VICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            47999999999996643221245999985


No 13 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=81.62  E-value=0.39  Score=33.47  Aligned_cols=29  Identities=28%  Similarity=0.606  Sum_probs=21.2

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..|+..+|-+-+.+.--...|+|||-
T Consensus        98 VlC~~C~sPdT~l~k~~r~~~l~C~ACGa  126 (133)
T TIGR00311        98 VICRECNRPDTRIIKEGRVSLLKCEACGA  126 (133)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEecccCCC
Confidence            47999999999987643221135999985


No 14 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=81.62  E-value=0.39  Score=32.44  Aligned_cols=29  Identities=34%  Similarity=0.595  Sum_probs=21.1

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..|+..+|-+=+.+..=...|+|||-
T Consensus        81 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       81 VLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            47999999999997652211134999984


No 15 
>KOG3740|consensus
Probab=81.45  E-value=0.59  Score=40.33  Aligned_cols=31  Identities=29%  Similarity=0.740  Sum_probs=27.3

Q ss_pred             CCcccccCCCCCCCccccCCCC----CCccchhHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNG----EPVCNACGL   46 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G----~~lCNaCgl   46 (88)
                      ..-.|..|.|.-||.|+.-+.+    .++|.+|..
T Consensus       461 ~P~~caqcktdftp~wk~ekstq~d~~i~cE~cvt  495 (706)
T KOG3740|consen  461 EPYACAQCKTDFTPAWKKEKSTQADAAIVCENCVT  495 (706)
T ss_pred             CchhhhhcccccccccccccccCcchHHHHHhhhh
Confidence            3679999999999999998888    588999954


No 16 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=79.51  E-value=0.64  Score=25.61  Aligned_cols=25  Identities=28%  Similarity=0.848  Sum_probs=20.3

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..|+..    |-...+|.+.|..||-
T Consensus         9 ~~C~~C~~~----~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSR----WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCe----EeEccCCEEEhhhCce
Confidence            459999977    6667889999999985


No 17 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=77.63  E-value=0.92  Score=25.79  Aligned_cols=26  Identities=35%  Similarity=0.896  Sum_probs=20.4

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACG   45 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCg   45 (88)
                      ....|..|+   +|+.| ..+|+.+|-+|+
T Consensus        16 L~~~Cp~C~---~PL~~-~k~g~~~Cv~C~   41 (41)
T PF06677_consen   16 LDEHCPDCG---TPLMR-DKDGKIYCVSCG   41 (41)
T ss_pred             hcCccCCCC---CeeEE-ecCCCEECCCCC
Confidence            466788894   89988 557788999884


No 18 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=76.62  E-value=0.67  Score=34.00  Aligned_cols=29  Identities=31%  Similarity=0.598  Sum_probs=21.2

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      -.|..|+..+|-+-+.+..=..-|+|||-
T Consensus        99 V~C~~C~~pdT~l~k~~~~~~l~C~aCGa  127 (201)
T PRK12336         99 VICSECGLPDTRLVKEDRVLMLRCDACGA  127 (201)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            57999999999996643211135999986


No 19 
>PF15396 FAM60A:  Protein Family FAM60A
Probab=75.88  E-value=1.9  Score=32.62  Aligned_cols=15  Identities=47%  Similarity=1.024  Sum_probs=11.7

Q ss_pred             CCCccchhHHHHhhhC
Q psy8831          37 GEPVCNACGLIMNTVD   52 (88)
Q Consensus        37 G~~lCNaCgl~~~~~~   52 (88)
                      |+ +||||.|+.++..
T Consensus        49 Ge-ICNACVLLVKRwK   63 (213)
T PF15396_consen   49 GE-ICNACVLLVKRWK   63 (213)
T ss_pred             ch-hhHHHHHHHHHHh
Confidence            44 8999999877653


No 20 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=73.87  E-value=0.91  Score=24.84  Aligned_cols=28  Identities=29%  Similarity=0.666  Sum_probs=12.9

Q ss_pred             ccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      .|.+||..-+..-=.|++-. .+|.+||.
T Consensus         2 fC~~CG~~l~~~ip~gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    2 FCPQCGGPLERRIPEGDDRERLVCPACGF   30 (34)
T ss_dssp             B-TTT--B-EEE--TT-SS-EEEETTTTE
T ss_pred             ccccccChhhhhcCCCCCccceECCCCCC
Confidence            58899976432211233333 68999985


No 21 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=73.42  E-value=1  Score=31.03  Aligned_cols=29  Identities=31%  Similarity=0.563  Sum_probs=21.7

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..|+..+|-+=..+..=...|+|||-
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  122 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGA  122 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSC
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCC
Confidence            46999999999997763332245999984


No 22 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=72.87  E-value=1.6  Score=33.56  Aligned_cols=32  Identities=31%  Similarity=0.792  Sum_probs=22.9

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      .....|.+|+.  +++--.-..|+++|..||+-.
T Consensus         9 ~~~~~Cp~Cg~--~~iv~d~~~Ge~vC~~CG~Vl   40 (310)
T PRK00423          9 EEKLVCPECGS--DKLIYDYERGEIVCADCGLVI   40 (310)
T ss_pred             ccCCcCcCCCC--CCeeEECCCCeEeecccCCcc
Confidence            44568999996  333333468899999999844


No 23 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=71.24  E-value=1.5  Score=24.56  Aligned_cols=30  Identities=23%  Similarity=0.525  Sum_probs=18.3

Q ss_pred             cccccCCCCCCCccc--cCCCCCCccchhHHH
Q psy8831          18 VSCANCSTTCTTLWR--RNNNGEPVCNACGLI   47 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WR--rg~~G~~lCNaCgl~   47 (88)
                      ..|+-||.+++..=+  .|++|..+|+.|...
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            579999998875422  566667899999763


No 24 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=70.16  E-value=3.2  Score=33.91  Aligned_cols=39  Identities=18%  Similarity=0.529  Sum_probs=31.1

Q ss_pred             CCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ......|+.|+... |.|-.-.-|..||..|.=..|..|+
T Consensus        19 kPgNk~CaDCga~n-PtWASvn~GIFLCl~CSGVHRsLGv   57 (395)
T PLN03114         19 KSDNKICFDCNAKN-PTWASVTYGIFLCIDCSAVHRSLGV   57 (395)
T ss_pred             CcCCCcCccCCCCC-CCceeeccceeehhhhhHhhccCCC
Confidence            34678999999764 9999999999999999665555544


No 25 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=68.87  E-value=1.6  Score=26.29  Aligned_cols=26  Identities=31%  Similarity=0.677  Sum_probs=19.1

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      -....|.+||...-|        +.+|..||+|.
T Consensus        25 ~~l~~C~~CG~~~~~--------H~vC~~CG~Y~   50 (57)
T PRK12286         25 PGLVECPNCGEPKLP--------HRVCPSCGYYK   50 (57)
T ss_pred             CcceECCCCCCccCC--------eEECCCCCcCC
Confidence            345679999976644        46899999764


No 26 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=68.64  E-value=1.9  Score=28.75  Aligned_cols=36  Identities=19%  Similarity=0.470  Sum_probs=22.9

Q ss_pred             CCCCcccccCCCCCCCc-cccCCCCCCccchhHHHHhh
Q psy8831          14 KRSGVSCANCSTTCTTL-WRRNNNGEPVCNACGLIMNT   50 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~-WRrg~~G~~lCNaCgl~~~~   50 (88)
                      ......|.+|+...-++ -.+ .-++..|-.||+|+..
T Consensus        18 lpt~f~CP~Cge~~v~v~~~k-~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         18 LPKIFECPRCGKVSISVKIKK-NIAIITCGNCGLYTEF   54 (99)
T ss_pred             CCcEeECCCCCCeEeeeecCC-CcceEECCCCCCccCE
Confidence            34567899999432221 122 3445889999998754


No 27 
>KOG0706|consensus
Probab=68.37  E-value=2.8  Score=34.83  Aligned_cols=41  Identities=15%  Similarity=0.494  Sum_probs=32.9

Q ss_pred             CCCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCCC
Q psy8831          13 NKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDIN   54 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~   54 (88)
                      .....+.|+.|+ ...|-|-.-..|..||-.|---.|--|++
T Consensus        19 s~~~NKvCFDCg-AknPtWaSVTYGIFLCiDCSAvHRnLGVH   59 (454)
T KOG0706|consen   19 SQSENKVCFDCG-AKNPTWASVTYGIFLCIDCSAVHRNLGVH   59 (454)
T ss_pred             cCCCCceecccC-CCCCCceeecceEEEEEecchhhhccccc
Confidence            345688999999 56799999999999999997755555554


No 28 
>PRK00420 hypothetical protein; Validated
Probab=66.20  E-value=3  Score=28.48  Aligned_cols=29  Identities=28%  Similarity=0.622  Sum_probs=22.2

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      ....|..|+   +|+.+- .+|+.+|-.||-.+
T Consensus        22 l~~~CP~Cg---~pLf~l-k~g~~~Cp~Cg~~~   50 (112)
T PRK00420         22 LSKHCPVCG---LPLFEL-KDGEVVCPVHGKVY   50 (112)
T ss_pred             ccCCCCCCC---Ccceec-CCCceECCCCCCee
Confidence            557899999   677763 66788999998743


No 29 
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=65.62  E-value=1.6  Score=27.33  Aligned_cols=34  Identities=35%  Similarity=0.710  Sum_probs=24.9

Q ss_pred             CCcccccCCCCCCCc-cccCCCCCCccchhHHHHh
Q psy8831          16 SGVSCANCSTTCTTL-WRRNNNGEPVCNACGLIMN   49 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~-WRrg~~G~~lCNaCgl~~~   49 (88)
                      ....|-.|.+.+|-. ||.+.-....|-+||...+
T Consensus         9 AGA~CP~C~~~Dtl~mW~En~ve~vECV~CG~~~~   43 (66)
T COG3529           9 AGAVCPACQAQDTLAMWRENNVEIVECVKCGHHMR   43 (66)
T ss_pred             ccCCCcccchhhHHHHHHhcCCceEehhhcchHhh
Confidence            467899999999985 5544333356999998653


No 30 
>KOG0703|consensus
Probab=65.47  E-value=2.3  Score=33.39  Aligned_cols=34  Identities=26%  Similarity=0.572  Sum_probs=28.0

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhh
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNT   50 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~   50 (88)
                      ....|+.|++. .|.|-.-.-|..+|--|.=..|.
T Consensus        24 ~N~~CADC~a~-~P~WaSwnlGvFiC~~C~giHR~   57 (287)
T KOG0703|consen   24 DNKVCADCGAK-GPRWASWNLGVFICLRCAGIHRS   57 (287)
T ss_pred             ccCcccccCCC-CCCeEEeecCeEEEeeccccccc
Confidence            48899999988 99999889999999999543333


No 31 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=64.95  E-value=2.1  Score=26.92  Aligned_cols=34  Identities=29%  Similarity=0.603  Sum_probs=26.0

Q ss_pred             CCcccccCCCCCCCccccCCCCC-CccchhHHHHh
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGE-PVCNACGLIMN   49 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~   49 (88)
                      ..-.|-.|.+..|.+|.+..+-+ .-|-+||....
T Consensus         7 AGa~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~   41 (71)
T PF09526_consen    7 AGAVCPKCQAMDTIMMWRENGVEYVECVECGYTER   41 (71)
T ss_pred             cCccCCCCcCccEEEEEEeCCceEEEecCCCCeec
Confidence            46789999999999766555455 56999998544


No 32 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=64.60  E-value=2.7  Score=32.64  Aligned_cols=29  Identities=38%  Similarity=0.954  Sum_probs=20.8

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      ..|.+|+.+  -+=..-..|+.+|-.||+-.
T Consensus         2 ~~CpeCg~~--~~~~d~~~ge~VC~~CG~Vi   30 (285)
T COG1405           2 MSCPECGST--NIITDYERGEIVCADCGLVL   30 (285)
T ss_pred             CCCCCCCCc--cceeeccCCeEEeccCCEEe
Confidence            579999988  22223346889999999843


No 33 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=63.96  E-value=2.6  Score=29.65  Aligned_cols=27  Identities=37%  Similarity=0.919  Sum_probs=22.2

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .....|.-||   +||+|  .+|..+|--||.
T Consensus        26 ML~~hCp~Cg---~PLF~--KdG~v~CPvC~~   52 (131)
T COG1645          26 MLAKHCPKCG---TPLFR--KDGEVFCPVCGY   52 (131)
T ss_pred             HHHhhCcccC---Cccee--eCCeEECCCCCc
Confidence            3456788888   79999  788899999995


No 34 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=63.08  E-value=4.9  Score=20.22  Aligned_cols=22  Identities=27%  Similarity=0.815  Sum_probs=15.4

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|.+|++..       +.+..+|-.||-
T Consensus         3 ~~Cp~Cg~~~-------~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEI-------DPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcC-------CcccccChhhCC
Confidence            5789999854       334568888874


No 35 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=60.06  E-value=1.2  Score=24.65  Aligned_cols=30  Identities=23%  Similarity=0.603  Sum_probs=18.3

Q ss_pred             ccccCCCCCCCcc----ccCCCCC---CccchhHHHH
Q psy8831          19 SCANCSTTCTTLW----RRNNNGE---PVCNACGLIM   48 (88)
Q Consensus        19 ~C~nC~tt~Tp~W----Rrg~~G~---~lCNaCgl~~   48 (88)
                      .|.+|+..+.-.|    |.++++.   +.|..||-.|
T Consensus         2 ~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~w   38 (39)
T PF01096_consen    2 KCPKCGHNEAVFFQIQTRSADEPMTLFYVCCNCGHRW   38 (39)
T ss_dssp             --SSS-SSEEEEEEESSSSSSSSSEEEEEESSSTEEE
T ss_pred             CCcCCCCCeEEEEEeeccCCCCCCeEEEEeCCCCCee
Confidence            5888998876555    4455555   4599998654


No 36 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=59.11  E-value=4.4  Score=24.09  Aligned_cols=34  Identities=18%  Similarity=0.490  Sum_probs=23.5

Q ss_pred             cCCCCCCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          11 TGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        11 ~~~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      +...+....|..||....-   +.......|..||+.
T Consensus        22 v~~~~TSq~C~~CG~~~~~---~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   22 VDEAYTSQTCPRCGHRNKK---RRSGRVFTCPNCGFE   55 (69)
T ss_pred             ECCCCCccCccCccccccc---ccccceEEcCCCCCE
Confidence            4466678899999987755   112223679999974


No 37 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=58.37  E-value=6  Score=19.62  Aligned_cols=20  Identities=30%  Similarity=0.944  Sum_probs=12.4

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHH
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      |.+||...       +++..+|..||.
T Consensus         2 Cp~CG~~~-------~~~~~fC~~CG~   21 (23)
T PF13240_consen    2 CPNCGAEI-------EDDAKFCPNCGT   21 (23)
T ss_pred             CcccCCCC-------CCcCcchhhhCC
Confidence            67777654       334457877774


No 38 
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=57.02  E-value=25  Score=21.89  Aligned_cols=45  Identities=16%  Similarity=0.355  Sum_probs=33.8

Q ss_pred             CCCcccccCCCCCCCc--cccCCCCC--CccchhHHHHhhhCCCCCCcc
Q psy8831          15 RSGVSCANCSTTCTTL--WRRNNNGE--PVCNACGLIMNTVDINAPEKI   59 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~--WRrg~~G~--~lCNaCgl~~~~~~~~Rp~~~   59 (88)
                      .....|..|..+.|-.  .-.....|  ++|-+|--||..-|..|-+-+
T Consensus         3 ~~~~~CPRC~S~nTKFcYyNNy~~~QPR~~Ck~C~rywT~GG~lRnVPv   51 (63)
T PF02701_consen    3 EQPLPCPRCDSTNTKFCYYNNYNLSQPRYFCKSCRRYWTHGGTLRNVPV   51 (63)
T ss_pred             ccCCCCCCcCCCCCEEEeecCCCCCCcchhhHHHHHHHHhcceecCCcc
Confidence            3567899999988764  44444444  789999999999999886644


No 39 
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=56.96  E-value=3.7  Score=25.29  Aligned_cols=33  Identities=33%  Similarity=0.575  Sum_probs=24.6

Q ss_pred             CCcccccCCCCCCCccccCCCCC-CccchhHHHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGE-PVCNACGLIM   48 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~   48 (88)
                      ..-.|-.|++-.|-+|.+..+-+ ..|-+||...
T Consensus         8 AGA~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~   41 (59)
T TIGR02443         8 AGAVCPACSAQDTLAMWKENNIELVECVECGYQE   41 (59)
T ss_pred             ccccCCCCcCccEEEEEEeCCceEEEeccCCCcc
Confidence            46789999999999755444334 6699999844


No 40 
>KOG1598|consensus
Probab=55.15  E-value=6.7  Score=33.14  Aligned_cols=28  Identities=32%  Similarity=0.773  Sum_probs=20.4

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      +.|.||+.++ +. ++-..|...|.+||..
T Consensus         1 ~~C~~C~~s~-fe-~d~a~g~~~C~~CG~v   28 (521)
T KOG1598|consen    1 MVCKNCGGSN-FE-RDEATGNLYCTACGTV   28 (521)
T ss_pred             CcCCCCCCCC-cc-cccccCCceeccccce
Confidence            3699999765 22 3346778899999974


No 41 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=54.04  E-value=7.9  Score=21.49  Aligned_cols=28  Identities=25%  Similarity=0.659  Sum_probs=20.4

Q ss_pred             cccccCCCCCCCcccc-CCCCCCccchhH
Q psy8831          18 VSCANCSTTCTTLWRR-NNNGEPVCNACG   45 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRr-g~~G~~lCNaCg   45 (88)
                      .-|-.|+.+..=.|.. ...|..+|+.|+
T Consensus         4 ~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg   32 (37)
T smart00778        4 GPCPNCGGSDRFRFDDKDGRGTWFCSVCG   32 (37)
T ss_pred             cCCCCCCCccccccccCCCCcCEEeCCCC
Confidence            4588999888666643 345678999996


No 42 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=53.43  E-value=10  Score=23.81  Aligned_cols=32  Identities=19%  Similarity=0.446  Sum_probs=21.8

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ..|..|+...+-.    --|.+.|+||..|+++.-.
T Consensus         3 ~~C~VCg~~a~g~----hyGv~sC~aC~~FFRR~v~   34 (78)
T cd07172           3 KICLVCSDEASGC----HYGVLTCGSCKVFFKRAVE   34 (78)
T ss_pred             CCCeecCCcCcce----EECceeehhhHHhHHHHee
Confidence            4588888544333    2355679999999987644


No 43 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=53.26  E-value=9.8  Score=24.50  Aligned_cols=34  Identities=24%  Similarity=0.420  Sum_probs=23.6

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ....|.-|+...+-.    --|...|+||..|+++.-.
T Consensus         5 ~~~~C~VCg~~~~g~----hyGv~sC~aCk~FFRR~v~   38 (90)
T cd07168           5 SPKLCSICEDKATGL----HYGIITCEGCKGFFKRTVQ   38 (90)
T ss_pred             cCCCCcccCCcCcce----EECceehhhhhHhhhhhhc
Confidence            456799998654433    2355779999999987543


No 44 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=53.23  E-value=11  Score=23.93  Aligned_cols=32  Identities=22%  Similarity=0.384  Sum_probs=22.2

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ..|.-|+...+-.    --|...|+||..|+++.-.
T Consensus         4 ~~C~VCg~~~~g~----hyGv~sC~aC~~FFRR~v~   35 (82)
T cd07171           4 HFCAVCSDYASGY----HYGVWSCEGCKAFFKRSIQ   35 (82)
T ss_pred             CCCeecCCcCcce----EECceeehhhHHhHHHHee
Confidence            4688888654433    2355679999999987643


No 45 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=52.37  E-value=5.6  Score=22.70  Aligned_cols=24  Identities=21%  Similarity=0.613  Sum_probs=17.7

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .|.+||...+..    ..+..-|..||-
T Consensus         4 ~C~~Cg~~~~~~----~~~~irC~~CG~   27 (44)
T smart00659        4 ICGECGRENEIK----SKDVVRCRECGY   27 (44)
T ss_pred             ECCCCCCEeecC----CCCceECCCCCc
Confidence            699999877654    223467999985


No 46 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=51.33  E-value=11  Score=24.72  Aligned_cols=31  Identities=19%  Similarity=0.468  Sum_probs=21.3

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ..|.-|+...+-.    --|.+.|+||..|+++.-
T Consensus         5 ~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   35 (97)
T cd07170           5 RLCLVCGDIASGY----HYGVASCEACKAFFKRTI   35 (97)
T ss_pred             CCCeecCCcCcce----EECceeehhhhHHHHHHh
Confidence            4588898544322    245577999999998753


No 47 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=50.99  E-value=13  Score=24.03  Aligned_cols=33  Identities=21%  Similarity=0.397  Sum_probs=23.5

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ....|.-|+...+-.+    -|.+.|+||..||++.-
T Consensus         5 ~~~~C~VCg~~a~g~h----yGv~sC~aCk~FFRR~v   37 (90)
T cd07169           5 EQRTCLICGDRATGLH----YGIISCEGCKGFFKRSI   37 (90)
T ss_pred             cCCCCeecCCcCcceE----ECcceehhhHHHHHHHh
Confidence            4566999986554432    35567999999998764


No 48 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=50.91  E-value=4.1  Score=24.13  Aligned_cols=24  Identities=33%  Similarity=0.771  Sum_probs=16.7

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      ....|.+||.-.-|        +.+|.+||.|
T Consensus        25 ~l~~c~~cg~~~~~--------H~vc~~cG~y   48 (56)
T PF01783_consen   25 NLVKCPNCGEPKLP--------HRVCPSCGYY   48 (56)
T ss_dssp             SEEESSSSSSEEST--------TSBCTTTBBS
T ss_pred             ceeeeccCCCEecc--------cEeeCCCCeE
Confidence            45679999954322        4699999954


No 49 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=50.86  E-value=3.8  Score=22.74  Aligned_cols=30  Identities=27%  Similarity=0.659  Sum_probs=20.3

Q ss_pred             ccccCCCCCCCcc----ccCCCCC---CccchhHHHH
Q psy8831          19 SCANCSTTCTTLW----RRNNNGE---PVCNACGLIM   48 (88)
Q Consensus        19 ~C~nC~tt~Tp~W----Rrg~~G~---~lCNaCgl~~   48 (88)
                      .|.+|+-.+.-.|    |..+++.   +.|-.||-.|
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~w   38 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHRW   38 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCEe
Confidence            5888987765554    4556665   5699998655


No 50 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=50.47  E-value=5.2  Score=25.73  Aligned_cols=35  Identities=29%  Similarity=0.758  Sum_probs=24.6

Q ss_pred             CCCcccccCCCCCCCcc----ccCCCCC---CccchhHHHHh
Q psy8831          15 RSGVSCANCSTTCTTLW----RRNNNGE---PVCNACGLIMN   49 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~W----Rrg~~G~---~lCNaCgl~~~   49 (88)
                      .....|..|+-.+--.|    |..++|.   ++|-.||..|+
T Consensus        60 ~~~~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        60 TTRVECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cccCCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCCCeeE
Confidence            34679999997764444    4555666   56999998775


No 51 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=49.98  E-value=6.8  Score=22.02  Aligned_cols=27  Identities=30%  Similarity=0.756  Sum_probs=17.9

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACG   45 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCg   45 (88)
                      ..+|..|+.+ ...|-++ .+.+.|++|+
T Consensus        18 g~~CP~Cg~~-~~~~~~~-~~~~~C~~C~   44 (46)
T PF12760_consen   18 GFVCPHCGST-KHYRLKT-RGRYRCKACR   44 (46)
T ss_pred             CCCCCCCCCe-eeEEeCC-CCeEECCCCC
Confidence            3679999987 4444333 4457798885


No 52 
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=49.87  E-value=6.4  Score=30.74  Aligned_cols=38  Identities=18%  Similarity=0.421  Sum_probs=26.6

Q ss_pred             CCCCCcccccCCCCCCCcc----ccCCCCC---CccchhHHHHhh
Q psy8831          13 NKRSGVSCANCSTTCTTLW----RRNNNGE---PVCNACGLIMNT   50 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~W----Rrg~~G~---~lCNaCgl~~~~   50 (88)
                      +......|..|+-.+...|    |..+++-   +.|..||..|++
T Consensus       254 ~~t~~~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~Cg~~w~f  298 (299)
T TIGR01385       254 AVTDLFTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEECGNRWKF  298 (299)
T ss_pred             CCcccccCCCCCCccceEEEecccCCCCCCeEEEEcCCCCCeeee
Confidence            4445789999998887665    3344443   469999988763


No 53 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=49.78  E-value=11  Score=24.94  Aligned_cols=34  Identities=15%  Similarity=0.392  Sum_probs=23.8

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ....|.-|+...+-.    --|.+.|+||..||++.-.
T Consensus        17 ~~~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v~   50 (101)
T cd07160          17 GNEVCSVCGDKASGF----HYNVLSCEGCKGFFRRSVI   50 (101)
T ss_pred             CCCCCeecCCcCcce----EECcceehhhhhhhhhccc
Confidence            356799999654433    2355789999999987643


No 54 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=48.92  E-value=14  Score=23.51  Aligned_cols=31  Identities=16%  Similarity=0.547  Sum_probs=21.8

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ..|..|+...+-.    --|.+.|+||..|+++.-
T Consensus         4 ~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   34 (82)
T cd07173           4 KTCLICGDEASGC----HYGALTCGSCKVFFKRAA   34 (82)
T ss_pred             CCCeecCCcCcce----EECcchhhhHHHHHHHHh
Confidence            4588888654433    235567999999998764


No 55 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=47.04  E-value=10  Score=32.84  Aligned_cols=34  Identities=24%  Similarity=0.339  Sum_probs=27.7

Q ss_pred             CCCCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      ......|++|+... |.|-.-.-|-.+|-.|.=..
T Consensus        20 lPgNk~CADCgs~~-P~WASiNlGIFICi~CSGIH   53 (648)
T PLN03119         20 LPPNRRCINCNSLG-PQYVCTTFWTFVCMACSGIH   53 (648)
T ss_pred             CcCCCccccCCCCC-CCceeeccceEEeccchhhh
Confidence            45678999999765 99999899999999995433


No 56 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=46.94  E-value=12  Score=23.10  Aligned_cols=29  Identities=21%  Similarity=0.547  Sum_probs=18.3

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|.+.|+||..++++.-
T Consensus         1 C~VC~~~~~g~----hygv~sC~aCk~FFRR~~   29 (75)
T cd07155           1 CLVCGDIASGY----HYGVASCEACKAFFKRTI   29 (75)
T ss_pred             CcccCccCcce----EEChhhhhhhHHHHHHHh
Confidence            45566443322    235567999999998753


No 57 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=46.73  E-value=14  Score=23.22  Aligned_cols=29  Identities=17%  Similarity=0.486  Sum_probs=18.8

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|...|+||..|+++.-
T Consensus         1 C~VCg~~~~g~----hyG~~sC~aC~~FFRR~~   29 (81)
T cd07165           1 CKVCGDKASGY----HYGVTSCEGCKGFFRRSI   29 (81)
T ss_pred             CCccCccCcce----EECchhhhhHHHHHHhHh
Confidence            45566544322    235567999999998764


No 58 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=45.76  E-value=15  Score=23.99  Aligned_cols=32  Identities=16%  Similarity=0.472  Sum_probs=22.8

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ...|.-|+...+-.+    -|...|+||..|+++.-
T Consensus         5 ~~~C~VCg~~~~g~h----yGv~sC~aC~~FFRR~v   36 (95)
T cd06968           5 VIPCKICGDKSSGIH----YGVITCEGCKGFFRRSQ   36 (95)
T ss_pred             ccCCcccCCcCcceE----ECceeehhhHHhhHHhe
Confidence            456899986554432    35567999999998764


No 59 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=45.63  E-value=4.6  Score=21.09  Aligned_cols=27  Identities=22%  Similarity=0.511  Sum_probs=15.0

Q ss_pred             CcccccCCCCCCCccccCCCCC-CccchhHHH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGE-PVCNACGLI   47 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~   47 (88)
                      .+.|..||+...+.    +.|. .+|.+||..
T Consensus         3 ~rfC~~CG~~t~~~----~~g~~r~C~~Cg~~   30 (32)
T PF09297_consen    3 HRFCGRCGAPTKPA----PGGWARRCPSCGHE   30 (32)
T ss_dssp             TSB-TTT--BEEE-----SSSS-EEESSSS-E
T ss_pred             CcccCcCCccccCC----CCcCEeECCCCcCE
Confidence            46799999877665    2233 689999873


No 60 
>KOG1597|consensus
Probab=45.62  E-value=10  Score=30.17  Aligned_cols=33  Identities=27%  Similarity=0.801  Sum_probs=25.2

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhh
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTV   51 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~   51 (88)
                      .|..|....-.+--+-..|.++|-.|||-+.-+
T Consensus         2 ~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl~~r   34 (308)
T KOG1597|consen    2 TCPDCKRHPENLVEDHSAGDTVCSECGLVLEDR   34 (308)
T ss_pred             CCCCCCCCCCCeeeeccCCceecccCCeeeccc
Confidence            588888776667666778889999999965433


No 61 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=45.50  E-value=8.8  Score=25.72  Aligned_cols=33  Identities=15%  Similarity=0.312  Sum_probs=23.3

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ....|..|+...+-.+    -|...|+||..|+++.-
T Consensus         5 ~~~~C~VCg~~a~g~h----yGv~sC~aCk~FFRR~v   37 (107)
T cd06955           5 VPRICGVCGDRATGFH----FNAMTCEGCKGFFRRSM   37 (107)
T ss_pred             CCCCCeecCCcCcccE----ECcceeeeecceeccee
Confidence            4466999986554332    35567999999988754


No 62 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=45.21  E-value=8.9  Score=24.64  Aligned_cols=32  Identities=19%  Similarity=0.419  Sum_probs=22.5

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ...|.-|+...+-.+    -|...|+||..|+++.-
T Consensus         3 ~~~C~VCg~~a~g~h----yGv~sC~aCk~FFRR~v   34 (89)
T cd07166           3 VVLCKVCGDKASGFH----YGVHACEGCKGFFRRSI   34 (89)
T ss_pred             CCCCcccCccCcceE----EChhhhhhHhhEeccee
Confidence            346889986554432    45567999999988753


No 63 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=45.15  E-value=15  Score=23.35  Aligned_cols=29  Identities=17%  Similarity=0.427  Sum_probs=19.4

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|.+.|+||..|+++.-
T Consensus         2 C~VCg~~~~g~----hygv~sC~aC~~FFRR~v   30 (87)
T cd07162           2 CRVCGDRATGY----HFNAMTCEGCKGFFRRAM   30 (87)
T ss_pred             CcccCCcCcce----EECcceehhhHHHHHhhh
Confidence            66777543332    234567999999998764


No 64 
>PF12773 DZR:  Double zinc ribbon
Probab=45.13  E-value=15  Score=20.40  Aligned_cols=27  Identities=22%  Similarity=0.679  Sum_probs=15.0

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ....|.+||+...    .......+|..||-
T Consensus        11 ~~~fC~~CG~~l~----~~~~~~~~C~~Cg~   37 (50)
T PF12773_consen   11 DAKFCPHCGTPLP----PPDQSKKICPNCGA   37 (50)
T ss_pred             cccCChhhcCChh----hccCCCCCCcCCcC
Confidence            4667777776665    11111245777765


No 65 
>PHA00626 hypothetical protein
Probab=45.06  E-value=7.4  Score=23.95  Aligned_cols=32  Identities=25%  Similarity=0.482  Sum_probs=20.6

Q ss_pred             ccccCCCCCCCc--cccCCCCCCccchhHHHHhh
Q psy8831          19 SCANCSTTCTTL--WRRNNNGEPVCNACGLIMNT   50 (88)
Q Consensus        19 ~C~nC~tt~Tp~--WRrg~~G~~lCNaCgl~~~~   50 (88)
                      .|-+|+..+=..  -=+++...++|..||.++.+
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~   35 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSK   35 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeech
Confidence            588999753211  00244567999999987654


No 66 
>PLN03131 hypothetical protein; Provisional
Probab=45.00  E-value=11  Score=32.82  Aligned_cols=35  Identities=20%  Similarity=0.347  Sum_probs=27.9

Q ss_pred             CCCCcccccCCCCCCCccccCCCCCCccchhHHHHh
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMN   49 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~   49 (88)
                      .-....|++|+.. -|.|-.-.-|-.||-.|.=..|
T Consensus        20 ~PgNk~CADCga~-~P~WASiNlGIFICi~CSGIHR   54 (705)
T PLN03131         20 LPPNRRCINCNSL-GPQFVCTNFWTFICMTCSGIHR   54 (705)
T ss_pred             CcCCCccccCCCC-CCCeeEeccceEEchhchhhhc
Confidence            4567899999975 5999998899999999954333


No 67 
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=44.84  E-value=10  Score=27.67  Aligned_cols=27  Identities=30%  Similarity=0.867  Sum_probs=22.2

Q ss_pred             ccccCCCCCCCccccCCCCC---CccchhH
Q psy8831          19 SCANCSTTCTTLWRRNNNGE---PVCNACG   45 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~---~lCNaCg   45 (88)
                      .|.+||.....+++.-.+|.   ..|..|+
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~   31 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPGNIRLTKCPNCG   31 (208)
T ss_pred             EeccCCCcchhhhhccCCCcEEEeeccccC
Confidence            69999999988998866665   4599996


No 68 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=44.73  E-value=11  Score=27.20  Aligned_cols=29  Identities=28%  Similarity=0.619  Sum_probs=23.7

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACG   45 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCg   45 (88)
                      ...|..||......|-.-.+|..+|..|+
T Consensus       149 l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        149 LDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             hhhHhcCCCCCCceEEecccCCccccccc
Confidence            34799999887766777778889999996


No 69 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=44.39  E-value=4.3  Score=30.43  Aligned_cols=35  Identities=14%  Similarity=0.488  Sum_probs=22.4

Q ss_pred             CCCCcccccCCCCCCC--cccc-CCCCCCccchhHHHH
Q psy8831          14 KRSGVSCANCSTTCTT--LWRR-NNNGEPVCNACGLIM   48 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp--~WRr-g~~G~~lCNaCgl~~   48 (88)
                      ..+-..|-+|+.-+++  +-+. |.+--.-|++||..+
T Consensus         3 ~~iy~~Cp~Cg~eev~hEVik~~g~~~lvrC~eCG~V~   40 (201)
T COG1326           3 EEIYIECPSCGSEEVSHEVIKERGREPLVRCEECGTVH   40 (201)
T ss_pred             ceEEEECCCCCcchhhHHHHHhcCCceEEEccCCCcEe
Confidence            3456789999955553  3343 333123499999976


No 70 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=44.35  E-value=15  Score=22.52  Aligned_cols=29  Identities=17%  Similarity=0.507  Sum_probs=18.5

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|...|+||..++++.-
T Consensus         1 C~VCg~~~~g~----hyGv~~C~aC~~FFRR~v   29 (73)
T cd07158           1 CKVCGDKASGF----HYGVHSCEGCKGFFRRTI   29 (73)
T ss_pred             CcccCccCcce----EECcchhhHHHHHHhhhh
Confidence            45566444332    235567999999998754


No 71 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=44.11  E-value=16  Score=23.57  Aligned_cols=31  Identities=13%  Similarity=0.363  Sum_probs=21.1

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      .|.-|+...+-.    --|...|+||..|+++.-.
T Consensus         3 ~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v~   33 (91)
T cd07161           3 LCLVCGDRASGY----HYNALTCEGCKGFFRRSVT   33 (91)
T ss_pred             CCeeCCCcCcce----EECceeehhhHHHHHHHhc
Confidence            488888544332    2355679999999987643


No 72 
>KOG0818|consensus
Probab=43.93  E-value=15  Score=31.58  Aligned_cols=37  Identities=27%  Similarity=0.637  Sum_probs=29.3

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      -...+|..|+.. -|-|..-.-|-.||..|.-+.+--|
T Consensus         6 l~~evC~DC~~~-dp~WASvnrGt~lC~eCcsvHrsLG   42 (669)
T KOG0818|consen    6 LSSEVCADCSGP-DPSWASVNRGTFLCDECCSVHRSLG   42 (669)
T ss_pred             hhhhhhcccCCC-CCcceeecCceEehHhhhHHHhhhc
Confidence            356789999965 5999999999999999976655443


No 73 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=43.86  E-value=14  Score=22.77  Aligned_cols=30  Identities=17%  Similarity=0.516  Sum_probs=18.6

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      |.-|+...+-.    --|...|+||..++++.-.
T Consensus         1 C~VCg~~a~~~----hygv~sC~aCk~FFRR~~~   30 (73)
T cd06963           1 CLICGDEASGC----HYGVLTCGSCKVFFKRAAE   30 (73)
T ss_pred             CcccCccCcce----EECceeehhhhHhHHHhhc
Confidence            44565433322    2345679999999987643


No 74 
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=43.76  E-value=9.3  Score=31.84  Aligned_cols=25  Identities=32%  Similarity=0.942  Sum_probs=19.1

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      ..-.|.+|| .++|.|-    |+  |.+||-|
T Consensus         6 t~f~C~~CG-~~s~KW~----Gk--Cp~Cg~W   30 (456)
T COG1066           6 TAFVCQECG-YVSPKWL----GK--CPACGAW   30 (456)
T ss_pred             cEEEcccCC-CCCcccc----cc--CCCCCCc
Confidence            567899999 5678883    44  9999864


No 75 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=43.52  E-value=16  Score=22.70  Aligned_cols=31  Identities=19%  Similarity=0.399  Sum_probs=20.6

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      .|.-|+...+-.    --|.+.|+||..++++.-.
T Consensus         2 ~C~VC~~~~~g~----hygv~sC~aC~~FFRR~v~   32 (77)
T cd06956           2 ICAICGDRASGK----HYGVYSCEGCKGFFKRTVR   32 (77)
T ss_pred             CCcccCCcCcce----EECceeehhHHHHHHHHhh
Confidence            367777544433    2355679999999987643


No 76 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=43.50  E-value=16  Score=22.54  Aligned_cols=30  Identities=17%  Similarity=0.574  Sum_probs=18.9

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      |.-|+...+-.    --|...|+||..++++.-.
T Consensus         1 C~VCg~~~~g~----hygv~sC~aC~~FFRR~~~   30 (74)
T cd07179           1 CRVCGGKSSGF----HFGALTCEGCKGFFRRTEL   30 (74)
T ss_pred             CcccCccCcce----EECceeehhHHHHHHHHhh
Confidence            45566443332    1355679999999987643


No 77 
>KOG0909|consensus
Probab=42.69  E-value=6.4  Score=32.98  Aligned_cols=45  Identities=27%  Similarity=0.510  Sum_probs=31.1

Q ss_pred             CCcccccCCCCC-CCccccCCC------CC-----CccchhHHHHhhhCCCCCCccC
Q psy8831          16 SGVSCANCSTTC-TTLWRRNNN------GE-----PVCNACGLIMNTVDINAPEKIM   60 (88)
Q Consensus        16 ~~~~C~nC~tt~-Tp~WRrg~~------G~-----~lCNaCgl~~~~~~~~Rp~~~~   60 (88)
                      ..+-|..||... +++=.-.|.      |.     +.||.||.-.++-..+.|..+.
T Consensus       160 N~PpC~~CG~et~~~l~~~~p~eeE~~~Ga~rVEiy~C~~C~~~~RFPRYNdp~kLL  216 (500)
T KOG0909|consen  160 NNPPCNKCGGETSSGLGNQPPNEEEKKFGAGRVEIYKCNRCGTETRFPRYNDPIKLL  216 (500)
T ss_pred             CCCCcccccccccccccCCCCchhHhhcCCceEEEEEecCCCCcccCcccCCHHHHH
Confidence            457899999877 444331121      22     5799999988888888887764


No 78 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=41.47  E-value=9.7  Score=24.76  Aligned_cols=30  Identities=17%  Similarity=0.440  Sum_probs=20.4

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      .|.-|+...+-.    --|.+.|+||..||++.-
T Consensus         2 ~C~VCg~~a~g~----hyGv~sC~aC~~FFRR~v   31 (94)
T cd06966           2 ICGVCGDKALGY----NFNAITCESCKAFFRRNA   31 (94)
T ss_pred             CCeeCCCcCcce----EECcceeeeehheehhcc
Confidence            477888644333    235567999999988754


No 79 
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=41.29  E-value=7.5  Score=24.80  Aligned_cols=33  Identities=15%  Similarity=0.325  Sum_probs=22.9

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      +...|.-|+...+-.+    -|.+.|+||..|+++.-
T Consensus         3 ~~~~C~VCg~~~~g~h----yGv~sC~aC~~FFRR~v   35 (85)
T cd06964           3 IYKPCFVCQDKSSGYH----YGVSACEGCKGFFRRSI   35 (85)
T ss_pred             cCCCCcccCCcCcccE----ECcceeeeeeeEEeeee
Confidence            4457888986544332    35567999999988753


No 80 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=40.63  E-value=12  Score=23.79  Aligned_cols=29  Identities=17%  Similarity=0.494  Sum_probs=19.5

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.+    -|...|+||..|+++.-
T Consensus         2 C~VCg~~~~g~h----yGv~sC~aCk~FFRR~v   30 (84)
T cd06965           2 CRVCGDKASGFH----YGVHACEGCKGFFRRTI   30 (84)
T ss_pred             CcccCccCcceE----EChhhhhhhhhheeeee
Confidence            667775443332    35567999999998754


No 81 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=39.47  E-value=11  Score=29.45  Aligned_cols=32  Identities=28%  Similarity=0.444  Sum_probs=22.7

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHHh
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMN   49 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~   49 (88)
                      ...+.|..||+...+.   ...-..+|+.||.++.
T Consensus       109 ~~~RFCg~CG~~~~~~---~~g~~~~C~~cg~~~f  140 (279)
T COG2816         109 RSHRFCGRCGTKTYPR---EGGWARVCPKCGHEHF  140 (279)
T ss_pred             hhCcCCCCCCCcCccc---cCceeeeCCCCCCccC
Confidence            3467899999888775   1111378999998654


No 82 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=38.97  E-value=12  Score=22.42  Aligned_cols=29  Identities=24%  Similarity=0.651  Sum_probs=19.3

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhh
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTV   51 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~   51 (88)
                      .|.-|+-. +...   ..|...|++|-.|+++.
T Consensus         2 ~C~VCg~~-~~~~---~ygv~sC~~C~~FFrR~   30 (70)
T PF00105_consen    2 KCKVCGDP-ASGY---HYGVLSCNACKMFFRRS   30 (70)
T ss_dssp             BSTTTSSB-ESEE---ETTEEEEHHHHHHHHHH
T ss_pred             CCeECCCc-cCcc---cccccccccceeeeeec
Confidence            57778742 2222   24567899999988874


No 83 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=38.73  E-value=17  Score=23.03  Aligned_cols=30  Identities=17%  Similarity=0.371  Sum_probs=19.5

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      |.-|+...+-.    --|...|+||..|+++.-.
T Consensus         2 C~VCg~~~~g~----hygv~sC~aC~~FFRR~v~   31 (85)
T cd06961           2 CVVCGDKATGY----HYRCITCEGCKGFFRRTVQ   31 (85)
T ss_pred             CceeCCcCcce----EEChhhhhhhhHhhHhhhc
Confidence            66677543332    2345679999999987543


No 84 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=38.29  E-value=12  Score=22.25  Aligned_cols=26  Identities=31%  Similarity=0.646  Sum_probs=17.7

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      -....|.+||...-|        +.+|-.||.|-
T Consensus        24 p~l~~C~~cG~~~~~--------H~vc~~cG~Y~   49 (55)
T TIGR01031        24 PTLVVCPNCGEFKLP--------HRVCPSCGYYK   49 (55)
T ss_pred             CcceECCCCCCcccC--------eeECCccCeEC
Confidence            345679999865432        36899999654


No 85 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=37.84  E-value=19  Score=22.39  Aligned_cols=30  Identities=20%  Similarity=0.519  Sum_probs=18.7

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      |.-|+...+-.    --|...|+||..++++.-.
T Consensus         1 C~VCg~~~~g~----hyG~~~C~~C~~FFRR~~~   30 (78)
T cd07164           1 CRVCGDRASGK----HYGVPSCDGCRGFFKRSIR   30 (78)
T ss_pred             CcccCccCcce----EECcchhhhhhhhhhhhcc
Confidence            45566433332    2355679999999987643


No 86 
>KOG0704|consensus
Probab=37.60  E-value=8.1  Score=31.50  Aligned_cols=39  Identities=15%  Similarity=0.411  Sum_probs=29.8

Q ss_pred             CCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ......|+.|++ .-|+|-.-..|..+|-.|.=..|--|+
T Consensus        16 ~deNk~CfeC~a-~NPQWvSvsyGIfICLECSG~HRgLGV   54 (386)
T KOG0704|consen   16 QDENKKCFECGA-PNPQWVSVSYGIFICLECSGKHRGLGV   54 (386)
T ss_pred             cccCCceeecCC-CCCCeEeecccEEEEEecCCcccccce
Confidence            347889999995 569999999999999999543443333


No 87 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=37.15  E-value=9.3  Score=24.70  Aligned_cols=33  Identities=15%  Similarity=0.418  Sum_probs=22.8

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      +...|.-|+...+-.    --|...|+||..|+++.-
T Consensus         5 ~~~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   37 (92)
T cd07163           5 LDIPCKVCGDRSSGK----HYGIYACDGCSGFFKRSI   37 (92)
T ss_pred             cCCCCcccCCcCccc----EECceeeeeeeeEEeeee
Confidence            466799998644433    235567999999988753


No 88 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=36.76  E-value=11  Score=20.86  Aligned_cols=28  Identities=21%  Similarity=0.573  Sum_probs=15.9

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .|..|+..-+-+..-.......|-+||-
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    7 RCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            5777876554443333323356888864


No 89 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=36.23  E-value=12  Score=23.13  Aligned_cols=29  Identities=28%  Similarity=0.518  Sum_probs=18.2

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|.+.|+||..++++.-
T Consensus         1 C~vCg~~~~~~----hygv~~C~aC~~FFrR~~   29 (76)
T cd06960           1 CAVCGDRATGK----HYGVLSCNGCKGFFRRSV   29 (76)
T ss_pred             CCccCccCccc----EECcceeeeehheeCccc
Confidence            45566443322    235567999999987653


No 90 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=35.33  E-value=21  Score=19.14  Aligned_cols=24  Identities=21%  Similarity=0.518  Sum_probs=15.0

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .|..|+....-..    ...+-|..||-
T Consensus         2 ~C~~Cg~~~~~~~----~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVELKP----GDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-BST----SSTSSBSSSS-
T ss_pred             CCCcCCCeeEcCC----CCcEECCcCCC
Confidence            5889998877321    22356999985


No 91 
>COG1601 GCD7 Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]
Probab=35.28  E-value=11  Score=26.86  Aligned_cols=30  Identities=30%  Similarity=0.524  Sum_probs=21.8

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      -..|..|+..+|++-+.+..=...|.|||-
T Consensus       105 yv~C~~c~s~dt~l~~~~R~~~l~c~acGa  134 (151)
T COG1601         105 YVKCKECGSPDTELIKEERLLFLKCEACGA  134 (151)
T ss_pred             eeEeccCCCCchhhhhhhhhHhhHHHHhCC
Confidence            357999999999997663222245999975


No 92 
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=35.16  E-value=13  Score=22.52  Aligned_cols=24  Identities=8%  Similarity=-0.169  Sum_probs=16.3

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHh
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMN   49 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~   49 (88)
                      ...|.+|+...-|-        -+|. ||+|..
T Consensus        27 ~~~c~~cg~~~~pH--------~vc~-cG~Y~g   50 (60)
T PRK01110         27 LSVDKTTGEYHLPH--------HVSP-KGYYKG   50 (60)
T ss_pred             eeEcCCCCceeccc--------eecC-CcccCC
Confidence            56788888765442        4788 987653


No 93 
>PRK11823 DNA repair protein RadA; Provisional
Probab=34.20  E-value=20  Score=28.98  Aligned_cols=26  Identities=23%  Similarity=0.779  Sum_probs=17.9

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      +..-.|.+||.+ ++.|-      --|.+|+-+
T Consensus         5 ~~~y~C~~Cg~~-~~~~~------g~Cp~C~~w   30 (446)
T PRK11823          5 KTAYVCQECGAE-SPKWL------GRCPECGAW   30 (446)
T ss_pred             CCeEECCcCCCC-CcccC------eeCcCCCCc
Confidence            456789999954 56652      248888764


No 94 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=34.19  E-value=23  Score=21.34  Aligned_cols=28  Identities=21%  Similarity=0.585  Sum_probs=18.0

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhh
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTV   51 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~   51 (88)
                      |..|+...+-.    .-|...|+||..++++.
T Consensus         2 C~vC~~~~~~~----hygv~~C~aC~~FFRR~   29 (70)
T smart00399        2 CCVCGDHASGF----HFGVCSCRACKAFFRRT   29 (70)
T ss_pred             CeEeCCcCccc----EeCCcEechhhhhhhhh
Confidence            55666443322    23456799999999875


No 95 
>COG3952 Predicted membrane protein [Function unknown]
Probab=33.85  E-value=9.3  Score=26.28  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=11.7

Q ss_pred             cccCCCCCCccchhHHHHh
Q psy8831          31 WRRNNNGEPVCNACGLIMN   49 (88)
Q Consensus        31 WRrg~~G~~lCNaCgl~~~   49 (88)
                      ||.++-+ .+|++|||+-.
T Consensus        77 ~~~DpV~-Vl~~~~glF~~   94 (113)
T COG3952          77 RRQDPVF-VLGQACGLFIY   94 (113)
T ss_pred             HhcchHH-HHHHhhhHHHH
Confidence            4444432 68999999643


No 96 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=33.19  E-value=18  Score=28.76  Aligned_cols=22  Identities=32%  Similarity=0.954  Sum_probs=15.6

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      .|.+||. ++|.|-    |  -|.+|+-+
T Consensus         2 ~c~~cg~-~~~~~~----g--~cp~c~~w   23 (372)
T cd01121           2 VCSECGY-VSPKWL----G--KCPECGEW   23 (372)
T ss_pred             CCCCCCC-CCCCcc----E--ECcCCCCc
Confidence            6999995 567662    2  48888764


No 97 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=33.06  E-value=24  Score=21.61  Aligned_cols=29  Identities=17%  Similarity=0.497  Sum_probs=18.9

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|.+.|+||..++++.-
T Consensus         2 C~vCg~~~~~~----hygv~sC~aC~~FFRR~v   30 (73)
T cd06959           2 CVVCGDKASGF----HYGVLSCEGCKGFFRRSV   30 (73)
T ss_pred             CceeCCcCcce----EECceeehhhHHHHHHhh
Confidence            55666433322    235567999999998763


No 98 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=32.90  E-value=27  Score=20.34  Aligned_cols=27  Identities=22%  Similarity=0.514  Sum_probs=17.7

Q ss_pred             ccccCCCCCCCcc-ccCCCCCCccchhHH
Q psy8831          19 SCANCSTTCTTLW-RRNNNGEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~W-Rrg~~G~~lCNaCgl   46 (88)
                      .|+-|+....-+= .+-.+| ++|..|.=
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~   28 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLK   28 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHH
Confidence            3777876654443 344566 79999964


No 99 
>PHA02998 RNA polymerase subunit; Provisional
Probab=32.75  E-value=18  Score=27.03  Aligned_cols=34  Identities=24%  Similarity=0.505  Sum_probs=26.2

Q ss_pred             CCcccccCCCCCCCcc----ccCCCCC---CccchhHHHHh
Q psy8831          16 SGVSCANCSTTCTTLW----RRNNNGE---PVCNACGLIMN   49 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~W----Rrg~~G~---~lCNaCgl~~~   49 (88)
                      ....|..|+-.++-.|    |.++++.   +.|-.||-.|+
T Consensus       142 t~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wk  182 (195)
T PHA02998        142 YNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFK  182 (195)
T ss_pred             cCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccC
Confidence            5678999998887766    5666666   46999998664


No 100
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=32.59  E-value=11  Score=24.14  Aligned_cols=30  Identities=23%  Similarity=0.629  Sum_probs=20.1

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      .|.-|+...+-.    --|...|+||..|+++.-
T Consensus         2 ~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~~   31 (86)
T cd07157           2 TCQVCGEPAAGF----HHGAYVCEACKKFFMRSS   31 (86)
T ss_pred             CCcccCCcCccc----EECcceeeEeeeEEecce
Confidence            477787544332    235567999999988754


No 101
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=32.24  E-value=17  Score=21.17  Aligned_cols=28  Identities=18%  Similarity=0.452  Sum_probs=19.6

Q ss_pred             CCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      ....|..|+..  -++...  +...|..||+-
T Consensus        19 ~~~fCP~Cg~~--~m~~~~--~r~~C~~Cgyt   46 (50)
T PRK00432         19 KNKFCPRCGSG--FMAEHL--DRWHCGKCGYT   46 (50)
T ss_pred             ccCcCcCCCcc--hheccC--CcEECCCcCCE
Confidence            45689999974  554332  45789999973


No 102
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=32.21  E-value=28  Score=21.41  Aligned_cols=15  Identities=20%  Similarity=0.583  Sum_probs=12.2

Q ss_pred             cccccCCCCC-CCccc
Q psy8831          18 VSCANCSTTC-TTLWR   32 (88)
Q Consensus        18 ~~C~nC~tt~-Tp~WR   32 (88)
                      ..|.+|+.++ |.-|.
T Consensus        16 ~~CP~Cgs~~~T~~W~   31 (61)
T PRK08351         16 DRCPVCGSRDLSDEWF   31 (61)
T ss_pred             CcCCCCcCCccccccc
Confidence            3699999988 77885


No 103
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=31.96  E-value=12  Score=21.66  Aligned_cols=30  Identities=23%  Similarity=0.583  Sum_probs=21.5

Q ss_pred             CCcccccCCCCCCCcc----ccCCCCCCccchhHH
Q psy8831          16 SGVSCANCSTTCTTLW----RRNNNGEPVCNACGL   46 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~W----Rrg~~G~~lCNaCgl   46 (88)
                      ....|..|+..-+|..    +++ +.-..|..||=
T Consensus        21 ~~~~C~gC~~~l~~~~~~~i~~~-~~i~~Cp~CgR   54 (56)
T PF02591_consen   21 EGGTCSGCHMELPPQELNEIRKG-DEIVFCPNCGR   54 (56)
T ss_pred             eCCccCCCCEEcCHHHHHHHHcC-CCeEECcCCCc
Confidence            3568999999999863    333 33467999973


No 104
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=31.62  E-value=22  Score=21.76  Aligned_cols=16  Identities=19%  Similarity=0.522  Sum_probs=12.8

Q ss_pred             CCCccchhHHHHhhhC
Q psy8831          37 GEPVCNACGLIMNTVD   52 (88)
Q Consensus        37 G~~lCNaCgl~~~~~~   52 (88)
                      |...|+||..++++.-
T Consensus        14 gv~sC~aC~~FFRR~v   29 (73)
T cd06958          14 GQFTCEGCKSFFKRSV   29 (73)
T ss_pred             Chhhhhhhhhhhhhhh
Confidence            4567999999998764


No 105
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=31.52  E-value=13  Score=23.71  Aligned_cols=32  Identities=16%  Similarity=0.332  Sum_probs=22.1

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ...|.-|+...+-.+    -|...|+||..|+++.-
T Consensus         3 ~~~C~VCg~~~~g~h----yGv~sC~aC~~FFRR~v   34 (87)
T cd06967           3 VELCVVCGDKASGRH----YGAVSCEGCKGFFKRSI   34 (87)
T ss_pred             CCCCeecCCcCCcCE----eCcceEeeeeeEeeeee
Confidence            346888986544432    35567999999987753


No 106
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=31.30  E-value=16  Score=22.63  Aligned_cols=8  Identities=38%  Similarity=1.049  Sum_probs=4.2

Q ss_pred             CccchhHH
Q psy8831          39 PVCNACGL   46 (88)
Q Consensus        39 ~lCNaCgl   46 (88)
                      |.|..||+
T Consensus        51 Y~Cp~CGF   58 (61)
T COG2888          51 YRCPKCGF   58 (61)
T ss_pred             eECCCcCc
Confidence            45555553


No 107
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=31.08  E-value=30  Score=21.54  Aligned_cols=16  Identities=25%  Similarity=0.376  Sum_probs=12.4

Q ss_pred             CcccccCCCCC-CCccc
Q psy8831          17 GVSCANCSTTC-TTLWR   32 (88)
Q Consensus        17 ~~~C~nC~tt~-Tp~WR   32 (88)
                      ...|.+|+.++ |+-|.
T Consensus        17 ~~~Cp~Cgs~~~S~~w~   33 (64)
T PRK06393         17 EKTCPVHGDEKTTTEWF   33 (64)
T ss_pred             CCcCCCCCCCcCCcCcc
Confidence            45899999988 66774


No 108
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.04  E-value=18  Score=19.10  Aligned_cols=27  Identities=22%  Similarity=0.676  Sum_probs=16.0

Q ss_pred             ccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      .|..|+..-+. |....++. ..|-.||-
T Consensus         7 ~C~~Cg~~fe~-~~~~~~~~~~~CP~Cg~   34 (41)
T smart00834        7 RCEDCGHTFEV-LQKISDDPLATCPECGG   34 (41)
T ss_pred             EcCCCCCEEEE-EEecCCCCCCCCCCCCC
Confidence            58888875443 33322233 56888886


No 109
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=29.83  E-value=24  Score=19.57  Aligned_cols=28  Identities=21%  Similarity=0.521  Sum_probs=17.2

Q ss_pred             ccccCCCCCCCccccCCCC-CCccchhHHHH
Q psy8831          19 SCANCSTTCTTLWRRNNNG-EPVCNACGLIM   48 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G-~~lCNaCgl~~   48 (88)
                      .|..||..-.+.  .+... ..+|..||..+
T Consensus         2 FCp~Cg~~l~~~--~~~~~~~~vC~~Cg~~~   30 (52)
T smart00661        2 FCPKCGNMLIPK--EGKEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCCccccc--cCCCCCEEECCcCCCeE
Confidence            588898755443  11122 47899999643


No 110
>PF09698 GSu_C4xC__C2xCH:  Geobacter CxxxxCH...CXXCH motif (GSu_C4xC__C2xCH);  InterPro: IPR010176 This motif occurs from three to eight times in eight different proteins of Geobacter sulfurreducens. The final CXXCH motif matches the cytochrome c family haem-binding site signature, suggesting that the sequence may be involved in haem-binding. 
Probab=29.61  E-value=32  Score=18.57  Aligned_cols=18  Identities=22%  Similarity=0.693  Sum_probs=12.3

Q ss_pred             CCCCCccccCCCCCCccchh
Q psy8831          25 TTCTTLWRRNNNGEPVCNAC   44 (88)
Q Consensus        25 tt~Tp~WRrg~~G~~lCNaC   44 (88)
                      ...+|.|-.+..+.  |+.|
T Consensus        18 ~~~~p~W~~~~~~~--C~~C   35 (36)
T PF09698_consen   18 SYTTPTWGSGATTA--CGSC   35 (36)
T ss_pred             cccCceeCCCCCCc--cccc
Confidence            34678897665544  9888


No 111
>PHA02942 putative transposase; Provisional
Probab=29.50  E-value=30  Score=27.63  Aligned_cols=33  Identities=24%  Similarity=0.512  Sum_probs=22.7

Q ss_pred             cCCCCCCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          11 TGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        11 ~~~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      +...+....|+.||.....+    ......|..||..
T Consensus       319 V~p~yTSq~Cs~CG~~~~~l----~~r~f~C~~CG~~  351 (383)
T PHA02942        319 VNPSYSSVSCPKCGHKMVEI----AHRYFHCPSCGYE  351 (383)
T ss_pred             ECCCCCCccCCCCCCccCcC----CCCEEECCCCCCE
Confidence            44666789999999866432    1123689999873


No 112
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.23  E-value=25  Score=24.65  Aligned_cols=36  Identities=31%  Similarity=0.532  Sum_probs=21.1

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      .....|-+|+--.  +.|.--.-.+.|.|||+-|-.+.
T Consensus        19 Gl~grCP~CGeGr--LF~gFLK~~p~C~aCG~dyg~~~   54 (126)
T COG5349          19 GLRGRCPRCGEGR--LFRGFLKVVPACEACGLDYGFAD   54 (126)
T ss_pred             HhcCCCCCCCCch--hhhhhcccCchhhhccccccCCc
Confidence            3456788887432  33322122256999999776553


No 113
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=29.18  E-value=15  Score=23.41  Aligned_cols=31  Identities=13%  Similarity=0.370  Sum_probs=20.7

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      .|.-|+...+-.    --|.+.|+||..|+++.-.
T Consensus         3 ~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v~   33 (84)
T cd06962           3 LCVVCGDKASGY----HYNALTCEGCKGFFRRSIT   33 (84)
T ss_pred             CCeecCCcCcce----EECcceeecceeeeeeeec
Confidence            477887544432    2355679999999887543


No 114
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=29.12  E-value=22  Score=28.03  Aligned_cols=35  Identities=23%  Similarity=0.678  Sum_probs=22.3

Q ss_pred             CcccccCCCCCCCc-cccCC--CCC--CccchhHHHHhhh
Q psy8831          17 GVSCANCSTTCTTL-WRRNN--NGE--PVCNACGLIMNTV   51 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~-WRrg~--~G~--~lCNaCgl~~~~~   51 (88)
                      -..|.+|+.++.-. |--..  .+.  .+|..|+-|.+..
T Consensus       226 R~~C~~Cg~~~~l~y~~~~~~~~~~r~e~C~~C~~YlK~~  265 (309)
T PRK03564        226 RVKCSNCEQSGKLHYWSLDSEQAAVKAESCGDCGTYLKIL  265 (309)
T ss_pred             CccCCCCCCCCceeeeeecCCCcceEeeecccccccceec
Confidence            46789999765432 53222  222  5799999998764


No 115
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=29.06  E-value=26  Score=21.42  Aligned_cols=17  Identities=12%  Similarity=0.266  Sum_probs=13.1

Q ss_pred             CCCccchhHHHHhhhCC
Q psy8831          37 GEPVCNACGLIMNTVDI   53 (88)
Q Consensus        37 G~~lCNaCgl~~~~~~~   53 (88)
                      |...|+||..++++.-.
T Consensus        14 gv~sC~aC~~FFRR~v~   30 (72)
T cd07156          14 NAMTCEGCKGFFRRSMK   30 (72)
T ss_pred             Ccceehhhhhhhchhcc
Confidence            45679999999987543


No 116
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=29.01  E-value=33  Score=20.87  Aligned_cols=28  Identities=18%  Similarity=0.407  Sum_probs=19.7

Q ss_pred             CcccccCCCCCCCccccCCCCCCcc-chhHHHHhhh
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVC-NACGLIMNTV   51 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lC-NaCgl~~~~~   51 (88)
                      -+.|.+||...-       ..+.+| ..|.--|.++
T Consensus         3 HkHC~~CG~~Ip-------~~~~fCS~~C~~~~~k~   31 (59)
T PF09889_consen    3 HKHCPVCGKPIP-------PDESFCSPKCREEYRKR   31 (59)
T ss_pred             CCcCCcCCCcCC-------cchhhhCHHHHHHHHHH
Confidence            467999996653       346789 5998766544


No 117
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=28.96  E-value=27  Score=19.13  Aligned_cols=30  Identities=27%  Similarity=0.686  Sum_probs=16.3

Q ss_pred             CcccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      ...|..|++---|.=.=...|. ..||-|+.
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~w~C~~C~~   32 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKTWICNFCGT   32 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTEEEETTT--
T ss_pred             ccccCCCCCEECCcceEcCCCCEEECcCCCC
Confidence            4578999988888644445555 68999986


No 118
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=28.86  E-value=28  Score=25.21  Aligned_cols=26  Identities=19%  Similarity=0.512  Sum_probs=19.2

Q ss_pred             CCCCCcccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          13 NKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .......|+.||.     +   ..+...|..||.
T Consensus       305 ~~~tS~~C~~cg~-----~---~~r~~~C~~cg~  330 (364)
T COG0675         305 PYYTSKTCPCCGH-----L---SGRLFKCPRCGF  330 (364)
T ss_pred             CCCCcccccccCC-----c---cceeEECCCCCC
Confidence            4677899999998     1   123368999986


No 119
>KOG0317|consensus
Probab=28.62  E-value=58  Score=25.80  Aligned_cols=45  Identities=16%  Similarity=0.222  Sum_probs=31.1

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCCCCCCccC
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIM   60 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~Rp~~~~   60 (88)
                      .....|.=|--+..-- --.|=|+.+|+.|.+-|-.-....|+.-.
T Consensus       237 ~a~~kC~LCLe~~~~p-SaTpCGHiFCWsCI~~w~~ek~eCPlCR~  281 (293)
T KOG0317|consen  237 EATRKCSLCLENRSNP-SATPCGHIFCWSCILEWCSEKAECPLCRE  281 (293)
T ss_pred             CCCCceEEEecCCCCC-CcCcCcchHHHHHHHHHHccccCCCcccc
Confidence            4458899997654100 00234899999999999888888887653


No 120
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=28.00  E-value=30  Score=24.89  Aligned_cols=30  Identities=23%  Similarity=0.544  Sum_probs=20.3

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ...|..|+..+...+=.-..|..+|..|+-
T Consensus       147 l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~  176 (241)
T TIGR00613       147 LDKCAVCGSKEDLIYFSMTYGGALCRQCGE  176 (241)
T ss_pred             cCccCCCCCcCCCceEchhcCeEEChhhCc
Confidence            357999998443344444567789999964


No 121
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=27.99  E-value=34  Score=22.25  Aligned_cols=16  Identities=19%  Similarity=0.445  Sum_probs=13.0

Q ss_pred             CCCccchhHHHHhhhC
Q psy8831          37 GEPVCNACGLIMNTVD   52 (88)
Q Consensus        37 G~~lCNaCgl~~~~~~   52 (88)
                      |.+.|+||..|+++.-
T Consensus        14 Gv~sC~aCk~FFRRsv   29 (93)
T cd07167          14 GLLTCESCKGFFKRTV   29 (93)
T ss_pred             CchhhhhHHHHHHHHe
Confidence            5567999999998764


No 122
>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an 
Probab=27.76  E-value=56  Score=25.39  Aligned_cols=32  Identities=25%  Similarity=0.473  Sum_probs=21.3

Q ss_pred             CcccccCCCCCCCc-cccCCCCCCccchhHHHHhh
Q psy8831          17 GVSCANCSTTCTTL-WRRNNNGEPVCNACGLIMNT   50 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~-WRrg~~G~~lCNaCgl~~~~   50 (88)
                      +..|..|.-.+|-- =.=+.+|  +||+|-.+..+
T Consensus         1 ~~~C~~C~~~~t~p~i~fd~~G--vC~~C~~~~~~   33 (343)
T TIGR03573         1 MKFCKRCVMPTTRPGITFDEDG--VCSACRNFEEK   33 (343)
T ss_pred             CCcCCCCCCCCCCCCeeECCCC--CchhhhhHHhh
Confidence            35799999887542 1113344  79999987754


No 123
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=27.76  E-value=20  Score=22.01  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=4.1

Q ss_pred             CccchhHH
Q psy8831          39 PVCNACGL   46 (88)
Q Consensus        39 ~lCNaCgl   46 (88)
                      |.|-.||+
T Consensus        49 Y~CP~CGF   56 (59)
T PRK14890         49 YTCPKCGF   56 (59)
T ss_pred             eECCCCCC
Confidence            45555553


No 124
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=27.67  E-value=34  Score=24.43  Aligned_cols=36  Identities=22%  Similarity=0.465  Sum_probs=25.0

Q ss_pred             cccccCCCCCCCcc--ccCCCCC-----CccchhHHHHhhhCC
Q psy8831          18 VSCANCSTTCTTLW--RRNNNGE-----PVCNACGLIMNTVDI   53 (88)
Q Consensus        18 ~~C~nC~tt~Tp~W--Rrg~~G~-----~lCNaCgl~~~~~~~   53 (88)
                      +.|-.|+..+|-+-  |-..+|.     -.|.+||-+|-.+-+
T Consensus         1 M~CP~C~~~dtkViDSR~~~dg~~IRRRReC~~C~~RFTTyEr   43 (147)
T TIGR00244         1 MHCPFCQHHNTRVLDSRLVEDGQSIRRRRECLECHERFTTFER   43 (147)
T ss_pred             CCCCCCCCCCCEeeeccccCCCCeeeecccCCccCCccceeee
Confidence            36899999888874  3345554     349999976665544


No 125
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=27.54  E-value=16  Score=19.42  Aligned_cols=24  Identities=38%  Similarity=0.857  Sum_probs=10.7

Q ss_pred             cccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      +.|..|+...|=     .+|. ++|..|+-
T Consensus         3 p~Cp~C~se~~y-----~D~~~~vCp~C~~   27 (30)
T PF08274_consen    3 PKCPLCGSEYTY-----EDGELLVCPECGH   27 (30)
T ss_dssp             ---TTT-----E-----E-SSSEEETTTTE
T ss_pred             CCCCCCCCccee-----ccCCEEeCCcccc
Confidence            568888877765     3344 78999974


No 126
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=27.37  E-value=22  Score=19.78  Aligned_cols=27  Identities=22%  Similarity=0.466  Sum_probs=17.1

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      -.|.+||+..+-.   ...+...|..||-.
T Consensus         4 y~C~~CG~~~~~~---~~~~~~~Cp~CG~~   30 (46)
T PRK00398          4 YKCARCGREVELD---EYGTGVRCPYCGYR   30 (46)
T ss_pred             EECCCCCCEEEEC---CCCCceECCCCCCe
Confidence            4699999865442   11114679999863


No 127
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=27.21  E-value=23  Score=19.85  Aligned_cols=27  Identities=19%  Similarity=0.599  Sum_probs=17.4

Q ss_pred             ccccCCCCCCCccccCCC-CCCccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNN-GEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~-G~~lCNaCgl   46 (88)
                      .|.+|+..-+ +|+...+ ....|-.||-
T Consensus         7 ~C~~Cg~~fe-~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFE-VLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeE-EEEecCCCCCCCCCCCCC
Confidence            6888986444 5664333 3366999986


No 128
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=27.17  E-value=26  Score=19.70  Aligned_cols=26  Identities=19%  Similarity=0.591  Sum_probs=14.7

Q ss_pred             ccccCCCCCCCc-ccc-CCCCCCccchh
Q psy8831          19 SCANCSTTCTTL-WRR-NNNGEPVCNAC   44 (88)
Q Consensus        19 ~C~nC~tt~Tp~-WRr-g~~G~~lCNaC   44 (88)
                      -|-.|+.+.-=. |.. ...|..+|+.|
T Consensus         5 pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    5 PCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             --TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCcCccccccCcCcccCCCEECCCC
Confidence            478888877665 753 33466899999


No 129
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=27.13  E-value=44  Score=18.55  Aligned_cols=28  Identities=21%  Similarity=0.604  Sum_probs=19.3

Q ss_pred             ccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      .|..|....++.|+=..=.. .||.+|..
T Consensus         2 ~C~~C~~~~~~r~~C~~C~dfDLC~~C~~   30 (41)
T cd02337           2 TCNECKHHVETRWHCTVCEDYDLCITCYN   30 (41)
T ss_pred             cCCCCCCcCCCceECCCCcchhhHHHHhC
Confidence            47778776678887554333 68999865


No 130
>PRK06556 vitamin B12-dependent ribonucleotide reductase; Validated
Probab=26.72  E-value=24  Score=31.82  Aligned_cols=27  Identities=33%  Similarity=0.739  Sum_probs=18.9

Q ss_pred             CCCCcccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          14 KRSGVSCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        14 ~~~~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      .-..+.|.+|++.-      -++|. ++|..||.
T Consensus       921 ~~~~~~c~~c~~~~------~~~g~c~~c~~cg~  948 (953)
T PRK06556        921 AADAPLCPTCGTKM------VRNGSCYVCEGCGS  948 (953)
T ss_pred             cccCCcCCCccCee------eECCceEeccCCCC
Confidence            34467799998543      23466 89999985


No 131
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=26.66  E-value=41  Score=18.40  Aligned_cols=28  Identities=25%  Similarity=0.623  Sum_probs=18.0

Q ss_pred             CCcccccCCCCCCCccccC--CCCC--Cccchh
Q psy8831          16 SGVSCANCSTTCTTLWRRN--NNGE--PVCNAC   44 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg--~~G~--~lCNaC   44 (88)
                      +...|-.|+.++ ++-|.|  ++|.  ++|-.|
T Consensus         4 i~v~CP~C~s~~-~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    4 IDVHCPRCQSTE-GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             EeeeCCCCCCCC-cceeCCCCCCCCEeEecCcC
Confidence            456788888655 244544  4565  778777


No 132
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=26.45  E-value=31  Score=17.51  Aligned_cols=23  Identities=22%  Similarity=0.616  Sum_probs=12.4

Q ss_pred             cccCCCCCCCccccCCCCCCccchhH
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACG   45 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCg   45 (88)
                      |..|+....|.   ...-.+.|-.||
T Consensus         1 C~sC~~~i~~r---~~~v~f~CPnCG   23 (24)
T PF07754_consen    1 CTSCGRPIAPR---EQAVPFPCPNCG   23 (24)
T ss_pred             CccCCCcccCc---ccCceEeCCCCC
Confidence            55666665554   112225677776


No 133
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=25.61  E-value=14  Score=22.53  Aligned_cols=29  Identities=21%  Similarity=0.512  Sum_probs=17.8

Q ss_pred             cccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          20 CANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        20 C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      |.-|+...+-.    --|...|+||..++++.-
T Consensus         1 C~vC~~~~~~~----hygv~sC~aC~~FFRR~~   29 (72)
T cd06916           1 CAVCGDKASGY----HYGVLTCEGCKGFFRRSV   29 (72)
T ss_pred             CCccCccCccc----EECcceeeeeeeeEeEee
Confidence            44565433322    235567999999887654


No 134
>PRK13715 conjugal transfer protein TraR; Provisional
Probab=25.40  E-value=51  Score=20.56  Aligned_cols=37  Identities=16%  Similarity=0.310  Sum_probs=27.7

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHhhhCC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDI   53 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~   53 (88)
                      ...|..||-..-..-+..-.|..+|-.|--++-+.++
T Consensus        34 ~~~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~E~~~~   70 (73)
T PRK13715         34 VYLCEACGNPIPEARRKIFPGVTLCVECQAYQERQRK   70 (73)
T ss_pred             cccHhhcCCcCCHHHHhcCCCcCCCHHHHHHHHHHhc
Confidence            4589999988777766666788899999776554443


No 135
>KOG2767|consensus
Probab=25.33  E-value=41  Score=27.61  Aligned_cols=32  Identities=28%  Similarity=0.553  Sum_probs=23.2

Q ss_pred             cccccCCCCCCCccccCCCCC-CccchhHHHHh
Q psy8831          18 VSCANCSTTCTTLWRRNNNGE-PVCNACGLIMN   49 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~   49 (88)
                      ..|..|+-.+|-+-=....+- .-|-|||.+.-
T Consensus        97 VlC~~C~NPETel~itk~q~i~~~CkACG~r~~  129 (400)
T KOG2767|consen   97 VLCPSCENPETELIITKKQTISLKCKACGFRSD  129 (400)
T ss_pred             eeCcCCCCCceeEEecccchhhhHHHHcCCccc
Confidence            469999999999865544333 45999997543


No 136
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=25.30  E-value=28  Score=19.16  Aligned_cols=19  Identities=42%  Similarity=1.176  Sum_probs=12.9

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      .|.+|++... +|        +|-.|+.
T Consensus         1 ~C~~C~~~~~-l~--------~CL~C~~   19 (50)
T smart00290        1 RCSVCGTIEN-LW--------LCLTCGQ   19 (50)
T ss_pred             CcccCCCcCC-eE--------EecCCCC
Confidence            4889997663 66        6666654


No 137
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=24.95  E-value=27  Score=23.14  Aligned_cols=33  Identities=27%  Similarity=0.533  Sum_probs=25.4

Q ss_pred             CCCCCcccccCCCCCCCccccCCCCCCccchhHHHH
Q psy8831          13 NKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~   48 (88)
                      ..+....|..|+.+   .-+|...|-..|.-||--|
T Consensus        31 ~~~~~~~Cp~C~~~---~VkR~a~GIW~C~kCg~~f   63 (89)
T COG1997          31 QQRAKHVCPFCGRT---TVKRIATGIWKCRKCGAKF   63 (89)
T ss_pred             HHhcCCcCCCCCCc---ceeeeccCeEEcCCCCCee
Confidence            45667899999977   4567778888899998643


No 138
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms]
Probab=24.91  E-value=31  Score=23.63  Aligned_cols=34  Identities=12%  Similarity=0.241  Sum_probs=27.0

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHHHHhhh
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTV   51 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~   51 (88)
                      ..|..||-..-+.-...-.+..+|..|.-.+-+.
T Consensus        81 G~Ce~cG~~Ip~~RL~A~P~A~~Ci~cQ~~~E~~  114 (120)
T COG1734          81 GICEECGEPIPEARLEARPTARLCIECQERAERR  114 (120)
T ss_pred             cchhccCCcCCHHHHhhCcchHHHHHHHHHHHHH
Confidence            4799999988887777777888999997755443


No 139
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=24.88  E-value=15  Score=20.46  Aligned_cols=13  Identities=31%  Similarity=1.083  Sum_probs=9.4

Q ss_pred             CCCccchhHHHHh
Q psy8831          37 GEPVCNACGLIMN   49 (88)
Q Consensus        37 G~~lCNaCgl~~~   49 (88)
                      |...|..|||.|.
T Consensus        12 ~~~~C~~CgM~Y~   24 (41)
T PF13878_consen   12 GATTCPTCGMLYS   24 (41)
T ss_pred             CCcCCCCCCCEEC
Confidence            4567999998654


No 140
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=24.70  E-value=35  Score=27.78  Aligned_cols=26  Identities=27%  Similarity=0.727  Sum_probs=17.8

Q ss_pred             CCCcccccCCCCCCCccccCCCCCCccchhHHH
Q psy8831          15 RSGVSCANCSTTCTTLWRRNNNGEPVCNACGLI   47 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~   47 (88)
                      +..-.|.+||. +++.|-      --|.+|+-+
T Consensus         5 ~~~y~C~~Cg~-~~~~~~------g~Cp~C~~w   30 (454)
T TIGR00416         5 KSKFVCQHCGA-DSPKWQ------GKCPACHAW   30 (454)
T ss_pred             CCeEECCcCCC-CCcccc------EECcCCCCc
Confidence            34578999995 456662      248888764


No 141
>KOG2691|consensus
Probab=24.25  E-value=32  Score=23.66  Aligned_cols=34  Identities=26%  Similarity=0.504  Sum_probs=23.5

Q ss_pred             CCCcccccCCCCCCC----ccccCCCCC---CccchhHHHH
Q psy8831          15 RSGVSCANCSTTCTT----LWRRNNNGE---PVCNACGLIM   48 (88)
Q Consensus        15 ~~~~~C~nC~tt~Tp----~WRrg~~G~---~lCNaCgl~~   48 (88)
                      .....|.+|+-.+--    .=||++.+-   +||-.||-.|
T Consensus        71 ts~~~C~~C~~~eavffQ~~~~r~d~~m~l~yvC~~C~h~w  111 (113)
T KOG2691|consen   71 TSDKHCPKCGHREAVFFQAQTRRADEAMRLFYVCCSCGHRW  111 (113)
T ss_pred             cccccCCccCCcceEEEecccccccceEEEEEEeccccccc
Confidence            367789999988743    335555544   5788898765


No 142
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=24.08  E-value=22  Score=23.04  Aligned_cols=32  Identities=25%  Similarity=0.533  Sum_probs=22.1

Q ss_pred             CcccccCCCCCCCccccCCCCCCccchhHHHHhhhC
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVD   52 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~   52 (88)
                      ...|.-|+...+-.    --|...|+||..|+++.-
T Consensus         6 ~~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   37 (92)
T cd06970           6 GLLCRVCGDTSSGK----HYGIYACNGCSGFFKRSV   37 (92)
T ss_pred             CCCCeecCCcCccc----EECccEEeeeeeEeeeee
Confidence            44688998654433    235567999999988754


No 143
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid    transport and metabolism]
Probab=24.01  E-value=42  Score=27.01  Aligned_cols=27  Identities=33%  Similarity=0.711  Sum_probs=20.0

Q ss_pred             CcccccCCCCCCCccccCCCCC-CccchhHH
Q psy8831          17 GVSCANCSTTCTTLWRRNNNGE-PVCNACGL   46 (88)
Q Consensus        17 ~~~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl   46 (88)
                      ...|.|||...|+-.   ++|. -+|-+||-
T Consensus       315 ~nfc~ncG~~~t~~~---~ng~a~fcp~cgq  342 (345)
T COG4260         315 LNFCLNCGCGTTADF---DNGKAKFCPECGQ  342 (345)
T ss_pred             cccccccCcccccCC---ccchhhhChhhcC
Confidence            348999998888754   4455 58999974


No 144
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=23.95  E-value=42  Score=28.95  Aligned_cols=36  Identities=25%  Similarity=0.403  Sum_probs=21.7

Q ss_pred             CCCCCcccccCCCCCCCc-----cccCCCCCCccchhHHHH
Q psy8831          13 NKRSGVSCANCSTTCTTL-----WRRNNNGEPVCNACGLIM   48 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~-----WRrg~~G~~lCNaCgl~~   48 (88)
                      .....+.|.+||+.-+..     =...+.|..+|..||...
T Consensus        11 n~~~akFC~~CG~~l~~~~Cp~CG~~~~~~~~fC~~CG~~~   51 (645)
T PRK14559         11 NPNNNRFCQKCGTSLTHKPCPQCGTEVPVDEAHCPNCGAET   51 (645)
T ss_pred             CCCCCccccccCCCCCCCcCCCCCCCCCcccccccccCCcc
Confidence            345567888888775321     011245667888888743


No 145
>PF14122 YokU:  YokU-like protein
Probab=22.85  E-value=25  Score=23.19  Aligned_cols=13  Identities=23%  Similarity=0.876  Sum_probs=9.6

Q ss_pred             CccchhHHHHhhh
Q psy8831          39 PVCNACGLIMNTV   51 (88)
Q Consensus        39 ~lCNaCgl~~~~~   51 (88)
                      ..|+.||+-|.-.
T Consensus        36 i~C~~CgmvYq~d   48 (87)
T PF14122_consen   36 IICSNCGMVYQDD   48 (87)
T ss_pred             eeecCCCcEEehh
Confidence            5799999965433


No 146
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=22.44  E-value=38  Score=20.04  Aligned_cols=36  Identities=17%  Similarity=0.344  Sum_probs=22.8

Q ss_pred             cCCCCCCcccccCCCCCCCccccCCC-CCCccchhHH
Q psy8831          11 TGNKRSGVSCANCSTTCTTLWRRNNN-GEPVCNACGL   46 (88)
Q Consensus        11 ~~~~~~~~~C~nC~tt~Tp~WRrg~~-G~~lCNaCgl   46 (88)
                      ....+...+|.+|....--.=+...+ -.+.|-.||.
T Consensus        16 ~~~~r~aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   16 SPSNRYALICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             cccCceeEECcccchhhcccccccCCceEEEcCCCCC
Confidence            34566788999999876544222222 2367888875


No 147
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=21.88  E-value=14  Score=19.61  Aligned_cols=29  Identities=17%  Similarity=0.379  Sum_probs=17.3

Q ss_pred             cccccCCCCCCCccccCCCCCCccchhHH
Q psy8831          18 VSCANCSTTCTTLWRRNNNGEPVCNACGL   46 (88)
Q Consensus        18 ~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl   46 (88)
                      ..|..||-..-..-...-.+..+|-.|.-
T Consensus         4 g~C~~CGe~I~~~Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    4 GICEDCGEPIPEERLVAVPGATLCVECQE   32 (36)
T ss_dssp             SB-TTTSSBEEHHHHHHCTTECS-HHHHH
T ss_pred             CCccccCChHHHHHHHhCCCcEECHHHhC
Confidence            34888886665544444556788888854


No 148
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=21.76  E-value=56  Score=26.01  Aligned_cols=32  Identities=25%  Similarity=0.728  Sum_probs=20.9

Q ss_pred             cccccCCCCCCC-ccccCCCCC------CccchhHHHHhh
Q psy8831          18 VSCANCSTTCTT-LWRRNNNGE------PVCNACGLIMNT   50 (88)
Q Consensus        18 ~~C~nC~tt~Tp-~WRrg~~G~------~lCNaCgl~~~~   50 (88)
                      ..|+||+.+.-- .|-= .+++      -.|..|+-|.+.
T Consensus       226 ~KC~nC~~t~~l~y~sl-~s~E~A~vkAEtC~~C~sYlKi  264 (308)
T COG3058         226 VKCSNCEQSKKLHYWSL-ESSELAAVKAETCGDCNSYLKI  264 (308)
T ss_pred             HHhccccccCCccceec-cchhhhHhhhhcCCcHHHHHHH
Confidence            479999988755 4542 2222      249999877663


No 149
>PRK04023 DNA polymerase II large subunit; Validated
Probab=21.71  E-value=50  Score=30.50  Aligned_cols=31  Identities=26%  Similarity=0.513  Sum_probs=19.2

Q ss_pred             CCcccccCCCCCCCccccC----CCCCCccchhHH
Q psy8831          16 SGVSCANCSTTCTTLWRRN----NNGEPVCNACGL   46 (88)
Q Consensus        16 ~~~~C~nC~tt~Tp~WRrg----~~G~~lCNaCgl   46 (88)
                      ....|.+||+.+.+.|+-.    ..+.+.|..||.
T Consensus       637 ~~frCP~CG~~Te~i~fCP~CG~~~~~y~CPKCG~  671 (1121)
T PRK04023        637 FYRRCPFCGTHTEPVYRCPRCGIEVEEDECEKCGR  671 (1121)
T ss_pred             CcccCCCCCCCCCcceeCccccCcCCCCcCCCCCC
Confidence            4567778887777777532    223356777864


No 150
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=20.49  E-value=46  Score=18.16  Aligned_cols=26  Identities=31%  Similarity=0.701  Sum_probs=10.9

Q ss_pred             CcccccCCCCC--CCccccCCCCCCccchh
Q psy8831          17 GVSCANCSTTC--TTLWRRNNNGEPVCNAC   44 (88)
Q Consensus        17 ~~~C~nC~tt~--Tp~WRrg~~G~~lCNaC   44 (88)
                      ...|..|+-.-  +=||.  .=+..+|+.|
T Consensus         3 ~~~C~eC~~~f~dSyL~~--~F~~~VCD~C   30 (34)
T PF01286_consen    3 YPKCDECGKPFMDSYLLN--NFDLPVCDKC   30 (34)
T ss_dssp             -EE-TTT--EES-SSCCC--CTS-S--TTT
T ss_pred             CchHhHhCCHHHHHHHHH--hCCccccccc
Confidence            35688888664  33553  2234678887


No 151
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=20.25  E-value=17  Score=24.21  Aligned_cols=14  Identities=36%  Similarity=0.824  Sum_probs=11.0

Q ss_pred             CCccchhHHHHhhh
Q psy8831          38 EPVCNACGLIMNTV   51 (88)
Q Consensus        38 ~~lCNaCgl~~~~~   51 (88)
                      +++|++|+..|..-
T Consensus        52 ~lvC~~C~~~~~~~   65 (102)
T PF10080_consen   52 QLVCKNCGVRFNLP   65 (102)
T ss_pred             EEEEecCCCEEehh
Confidence            48899999977644


Done!