Query         psy8839
Match_columns 74
No_of_seqs    51 out of 53
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 20:27:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8839.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8839hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0797|consensus               99.8 1.3E-20 2.9E-25  155.0   2.6   61   13-73    368-428 (618)
  2 PF10767 DUF2593:  Protein of u  73.6    0.83 1.8E-05   33.1  -0.6   22   29-50     91-112 (144)
  3 KOG2943|consensus               64.9     2.3 5.1E-05   33.7   0.2   51   15-68     16-66  (299)
  4 KOG0677|consensus               63.1     3.9 8.5E-05   33.3   1.2   27   21-47    248-274 (389)
  5 PTZ00280 Actin-related protein  58.6     4.9 0.00011   30.7   1.0   25   19-43    263-287 (414)
  6 PTZ00466 actin-like protein; P  56.0     6.7 0.00015   30.1   1.4   27   20-46    251-277 (380)
  7 PF10844 DUF2577:  Protein of u  48.9     5.2 0.00011   25.9  -0.2   17   17-33     72-88  (100)
  8 PF05020 zf-NPL4:  NPL4 family,  45.2      12 0.00026   27.0   1.2   18   56-73     37-54  (147)
  9 PTZ00004 actin-2; Provisional   45.0      11 0.00024   28.5   1.0   24   21-44    249-272 (378)
 10 PRK13183 psbN photosystem II r  37.0      15 0.00032   22.2   0.5   27   40-66     18-44  (46)
 11 PTZ00281 actin; Provisional     37.0      18 0.00038   27.5   1.0   24   21-44    248-271 (376)
 12 PTZ00452 actin; Provisional     36.2      19 0.00042   27.5   1.2   26   21-46    247-272 (375)
 13 CHL00020 psbN photosystem II p  35.8      16 0.00034   21.7   0.5   27   40-66     15-41  (43)
 14 KOG2792|consensus               32.2     6.2 0.00013   31.2  -2.1   40   33-73    198-243 (280)
 15 KOG2428|consensus               32.0      34 0.00074   28.6   2.0   23   19-41    220-245 (443)
 16 COG2947 Uncharacterized conser  26.5      31 0.00067   25.3   0.8   36   22-63     42-83  (156)
 17 PRK06222 ferredoxin-NADP(+) re  25.5      21 0.00046   25.9  -0.2   18   21-38     75-94  (281)
 18 cd03698 eRF3_II_like eRF3_II_l  24.8      34 0.00073   20.6   0.6   19   16-34     21-39  (83)
 19 PF09482 OrgA_MxiK:  Bacterial   24.5      33 0.00071   24.7   0.6   22   26-47      2-23  (182)
 20 PF02468 PsbN:  Photosystem II   23.4      26 0.00057   20.7  -0.1    9   58-66     33-41  (43)
 21 cd04089 eRF3_II eRF3_II: domai  22.9      38 0.00082   20.4   0.6   19   16-34     20-38  (82)
 22 PF01606 Arteri_env:  Arterivir  22.6      41 0.00089   25.7   0.8   18   35-52    123-140 (214)
 23 KOG0676|consensus               21.9      42  0.0009   27.0   0.8   27   22-48    245-271 (372)

No 1  
>KOG0797|consensus
Probab=99.80  E-value=1.3e-20  Score=155.04  Aligned_cols=61  Identities=34%  Similarity=0.455  Sum_probs=58.5

Q ss_pred             ccceeeeeEEEccchhhcccccccccccccccCCceeeeccCCCCCCCCCCChhhhhhccC
Q psy8839          13 FTVYLLGFDILVADECLIAPLGIFHPELLGLTGTKIVVTQSRAVSDPEDPHDGDYLRETSV   73 (74)
Q Consensus        13 f~~~~~kY~~kVgDE~m~APL~LFyP~lf~I~~~~~~~~q~r~~~DpED~~D~~YL~eT~~   73 (74)
                      =+.+++||+||+|||+|+||||||||++|+|++.+++..|++.|+|||||||.+||++|+.
T Consensus       368 pn~~~~kytfk~~DE~mlAPlaLF~P~lf~~~~tk~~~~q~~~q~d~~d~fd~e~~~~~~~  428 (618)
T KOG0797|consen  368 PNPPTLKYTFKLGDEVMLAPLALFYPNLFVIEGTKSHKNQSFPQPDREDLFDYEYLLEDTW  428 (618)
T ss_pred             CCCcceeeeeeccchhhccchhhhhhhhhhccccccccccccCCCCcccccchhhhhhhcc
Confidence            3789999999999999999999999999999999999999999999999999999999874


No 2  
>PF10767 DUF2593:  Protein of unknown function (DUF2593);  InterPro: IPR019703  This entry represents proteins that appear to be restricted to Enterobacteriaceae. Some members are annotated as YbjO, however there is currently no known function. 
Probab=73.57  E-value=0.83  Score=33.06  Aligned_cols=22  Identities=36%  Similarity=0.610  Sum_probs=18.7

Q ss_pred             hcccccccccccccccCCceee
Q psy8839          29 LIAPLGIFHPELLGLTGTKIVV   50 (74)
Q Consensus        29 m~APL~LFyP~lf~I~~~~~~~   50 (74)
                      +.|-||-||||+|.|.|++...
T Consensus        91 l~ASlg~~~PeiFsi~Ge~~~e  112 (144)
T PF10767_consen   91 LMASLGWFYPEIFSIEGESGRE  112 (144)
T ss_pred             HHHHhccCCcceEEEcCCChHH
Confidence            4688999999999999988543


No 3  
>KOG2943|consensus
Probab=64.89  E-value=2.3  Score=33.74  Aligned_cols=51  Identities=22%  Similarity=0.204  Sum_probs=38.5

Q ss_pred             ceeeeeEEEccchhhcccccccccccccccCCceeeeccCCCCCCCCCCChhhh
Q psy8839          15 VYLLGFDILVADECLIAPLGIFHPELLGLTGTKIVVTQSRAVSDPEDPHDGDYL   68 (74)
Q Consensus        15 ~~~~kY~~kVgDE~m~APL~LFyP~lf~I~~~~~~~~q~r~~~DpED~~D~~YL   68 (74)
                      ...++|-|||||-   |-.+-||.++||+.=-.+--+.+--.--|.-|+|+.|=
T Consensus        16 ~r~LH~VfkVgdr---~kti~Fyt~vlgMkvLRheef~egc~aacngpyd~kwS   66 (299)
T KOG2943|consen   16 RRALHYVFKVGDR---AKTIDFYTEVLGMKVLRHEEFEEGCEAACNGPYDGKWS   66 (299)
T ss_pred             hheeeEeEeecch---HHHHHHHHHhhcceeeehhhhhhhhhhhcCCCcccchh
Confidence            3578999999996   46788999999987655555555555667788887764


No 4  
>KOG0677|consensus
Probab=63.12  E-value=3.9  Score=33.31  Aligned_cols=27  Identities=33%  Similarity=0.555  Sum_probs=24.0

Q ss_pred             EEEccchhhcccccccccccccccCCc
Q psy8839          21 DILVADECLIAPLGIFHPELLGLTGTK   47 (74)
Q Consensus        21 ~~kVgDE~m~APL~LFyP~lf~I~~~~   47 (74)
                      .||||-|-..||=+||.|.|..+.|.-
T Consensus       248 vIkvG~ERFeAPE~LFqP~Li~VE~~G  274 (389)
T KOG0677|consen  248 VIKVGGERFEAPEALFQPHLINVEGPG  274 (389)
T ss_pred             EEEecceeccCchhhcCcceeccCCCc
Confidence            479999999999999999998877654


No 5  
>PTZ00280 Actin-related protein 3; Provisional
Probab=58.56  E-value=4.9  Score=30.73  Aligned_cols=25  Identities=28%  Similarity=0.534  Sum_probs=22.1

Q ss_pred             eeEEEccchhhcccccccccccccc
Q psy8839          19 GFDILVADECLIAPLGIFHPELLGL   43 (74)
Q Consensus        19 kY~~kVgDE~m~APL~LFyP~lf~I   43 (74)
                      .+++.+|.|..++|-.||.|.+++.
T Consensus       263 ~~~i~l~~erf~~~E~LF~P~~~~~  287 (414)
T PTZ00280        263 PYTVDVGYERFLGPEMFFHPEIFSS  287 (414)
T ss_pred             ccEEEechHHhcCcccccChhhcCC
Confidence            4689999999999999999998754


No 6  
>PTZ00466 actin-like protein; Provisional
Probab=55.98  E-value=6.7  Score=30.11  Aligned_cols=27  Identities=37%  Similarity=0.543  Sum_probs=22.8

Q ss_pred             eEEEccchhhcccccccccccccccCC
Q psy8839          20 FDILVADECLIAPLGIFHPELLGLTGT   46 (74)
Q Consensus        20 Y~~kVgDE~m~APL~LFyP~lf~I~~~   46 (74)
                      .++.+|.|..++|-.||.|.++++...
T Consensus       251 ~~i~l~~er~~~~E~LF~P~~~g~~~~  277 (380)
T PTZ00466        251 SQILIGSERYRAPEVLFNPSILGLEYL  277 (380)
T ss_pred             cEEEEchHHhcCcccccCccccCCCCC
Confidence            357889999999999999999876543


No 7  
>PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=48.87  E-value=5.2  Score=25.85  Aligned_cols=17  Identities=18%  Similarity=0.241  Sum_probs=13.5

Q ss_pred             eeeeEEEccchhhcccc
Q psy8839          17 LLGFDILVADECLIAPL   33 (74)
Q Consensus        17 ~~kY~~kVgDE~m~APL   33 (74)
                      +..-.+|+||+||+.|+
T Consensus        72 ~~~~~Lk~GD~V~ll~~   88 (100)
T PF10844_consen   72 TFTDGLKVGDKVLLLRV   88 (100)
T ss_pred             EEecCCcCCCEEEEEEe
Confidence            34557899999999883


No 8  
>PF05020 zf-NPL4:  NPL4 family, putative zinc binding region;  InterPro: IPR007716 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterised step in ER-associated degradation after ubiquitination of target proteins but before their recognition by the 26S proteasome []. This region of the protein contains possibly two zinc binding motifs. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing.
Probab=45.23  E-value=12  Score=26.97  Aligned_cols=18  Identities=33%  Similarity=0.756  Sum_probs=14.8

Q ss_pred             CCCCCCCCChhhhhhccC
Q psy8839          56 VSDPEDPHDGDYLRETSV   73 (74)
Q Consensus        56 ~~DpED~~D~~YL~eT~~   73 (74)
                      ..-|-+|||+.||.|.++
T Consensus        37 ~C~pLeP~D~~Y~~e~~I   54 (147)
T PF05020_consen   37 YCSPLEPWDEKYLKENNI   54 (147)
T ss_pred             CCCCCCccCHHHHhhccc
Confidence            366889999999988654


No 9  
>PTZ00004 actin-2; Provisional
Probab=44.96  E-value=11  Score=28.52  Aligned_cols=24  Identities=33%  Similarity=0.558  Sum_probs=20.8

Q ss_pred             EEEccchhhccccccccccccccc
Q psy8839          21 DILVADECLIAPLGIFHPELLGLT   44 (74)
Q Consensus        21 ~~kVgDE~m~APL~LFyP~lf~I~   44 (74)
                      .+.+|+|..++|-.||.|++.++.
T Consensus       249 ~i~l~~er~~~~E~LF~P~~~~~~  272 (378)
T PTZ00004        249 IITVGSERFRCPEALFQPSLIGKE  272 (378)
T ss_pred             EEEEcHHHeeCcccccChhhcCcc
Confidence            467899999999999999987754


No 10 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=37.01  E-value=15  Score=22.16  Aligned_cols=27  Identities=33%  Similarity=0.478  Sum_probs=14.6

Q ss_pred             cccccCCceeeeccCCCCCCCCCCChh
Q psy8839          40 LLGLTGTKIVVTQSRAVSDPEDPHDGD   66 (74)
Q Consensus        40 lf~I~~~~~~~~q~r~~~DpED~~D~~   66 (74)
                      |++|+|=....-=-+-...-.||||+|
T Consensus        18 L~~~TgyaiYtaFGppSk~LrDPFeeH   44 (46)
T PRK13183         18 LLALTGFGIYTAFGPPSKELDDPFDDH   44 (46)
T ss_pred             HHHHhhheeeeccCCcccccCCchhhc
Confidence            346666554333333344567888876


No 11 
>PTZ00281 actin; Provisional
Probab=36.98  E-value=18  Score=27.52  Aligned_cols=24  Identities=29%  Similarity=0.646  Sum_probs=20.9

Q ss_pred             EEEccchhhccccccccccccccc
Q psy8839          21 DILVADECLIAPLGIFHPELLGLT   44 (74)
Q Consensus        21 ~~kVgDE~m~APL~LFyP~lf~I~   44 (74)
                      .+.+|.|...+|-.||.|.+.++.
T Consensus       248 ~i~i~~er~~~~E~LF~P~~~~~~  271 (376)
T PTZ00281        248 VITIGNERFRCPEALFQPSFLGME  271 (376)
T ss_pred             EEEeeHHHeeCcccccChhhcCCC
Confidence            578899999999999999987654


No 12 
>PTZ00452 actin; Provisional
Probab=36.22  E-value=19  Score=27.49  Aligned_cols=26  Identities=19%  Similarity=0.353  Sum_probs=21.9

Q ss_pred             EEEccchhhcccccccccccccccCC
Q psy8839          21 DILVADECLIAPLGIFHPELLGLTGT   46 (74)
Q Consensus        21 ~~kVgDE~m~APL~LFyP~lf~I~~~   46 (74)
                      .+.+|.|...+|=.||.|.++++...
T Consensus       247 ~i~l~~er~~~~E~LF~P~~~g~~~~  272 (375)
T PTZ00452        247 ILTIKSQKFRCSEILFQPKLIGLEVA  272 (375)
T ss_pred             EEEeehHHhcCcccccChhhcCCCCC
Confidence            56789999999999999999876543


No 13 
>CHL00020 psbN photosystem II protein N
Probab=35.80  E-value=16  Score=21.75  Aligned_cols=27  Identities=19%  Similarity=0.366  Sum_probs=14.6

Q ss_pred             cccccCCceeeeccCCCCCCCCCCChh
Q psy8839          40 LLGLTGTKIVVTQSRAVSDPEDPHDGD   66 (74)
Q Consensus        40 lf~I~~~~~~~~q~r~~~DpED~~D~~   66 (74)
                      |++|+|=.....=-+....-.||||+|
T Consensus        15 l~~~Tgy~iYtaFGppSk~LrDPfeeH   41 (43)
T CHL00020         15 LVSFTGYALYTAFGQPSKQLRDPFEEH   41 (43)
T ss_pred             HHHhhheeeeeccCCchhccCCchhhc
Confidence            345666554333333344566888865


No 14 
>KOG2792|consensus
Probab=32.16  E-value=6.2  Score=31.19  Aligned_cols=40  Identities=48%  Similarity=0.790  Sum_probs=26.7

Q ss_pred             ccccccccccccCCceeee----ccCC--CCCCCCCCChhhhhhccC
Q psy8839          33 LGIFHPELLGLTGTKIVVT----QSRA--VSDPEDPHDGDYLRETSV   73 (74)
Q Consensus        33 L~LFyP~lf~I~~~~~~~~----q~r~--~~DpED~~D~~YL~eT~~   73 (74)
                      ++=|+|.|+|+||+..-.-    .-|.  .--|+|- |+.||-.+||
T Consensus       198 ~~eF~pkllGLTGT~eqvk~vak~yRVYfs~gp~d~-~~DYlVDHSi  243 (280)
T KOG2792|consen  198 VSEFHPKLLGLTGTTEQVKQVAKKYRVYFSTGPKDE-DQDYLVDHSI  243 (280)
T ss_pred             HHhcChhhhcccCCHHHHHHHHHHhEEeeccCCCCC-CCCeeeeeeE
Confidence            5569999999999873211    1222  1226777 9999977765


No 15 
>KOG2428|consensus
Probab=31.97  E-value=34  Score=28.62  Aligned_cols=23  Identities=17%  Similarity=0.296  Sum_probs=20.3

Q ss_pred             eeEEEccchh---hcccccccccccc
Q psy8839          19 GFDILVADEC---LIAPLGIFHPELL   41 (74)
Q Consensus        19 kY~~kVgDE~---m~APL~LFyP~lf   41 (74)
                      .|+|.||.||   +.+|+.-+++-||
T Consensus       220 S~SL~lGNEvfDv~~~pl~~~~nhl~  245 (443)
T KOG2428|consen  220 SMSLHLGNEVFDVYKQPLSGNQNHLF  245 (443)
T ss_pred             ceeEeechhHHHhhhcccccCcceeE
Confidence            5899999997   4899999999887


No 16 
>COG2947 Uncharacterized conserved protein [Function unknown]
Probab=26.54  E-value=31  Score=25.35  Aligned_cols=36  Identities=25%  Similarity=0.482  Sum_probs=23.9

Q ss_pred             EEccchhhcccccccc------cccccccCCceeeeccCCCCCCCCCC
Q psy8839          22 ILVADECLIAPLGIFH------PELLGLTGTKIVVTQSRAVSDPEDPH   63 (74)
Q Consensus        22 ~kVgDE~m~APL~LFy------P~lf~I~~~~~~~~q~r~~~DpED~~   63 (74)
                      +|+||-      ++||      |.|-||..--...-+...|.||-+|+
T Consensus        42 M~iGD~------~fFYHSNc~~pgIvGl~~V~~~a~pD~tq~d~~spY   83 (156)
T COG2947          42 MKIGDL------GFFYHSNCKPPGIVGLAEVCALAHPDPTQFDPASPY   83 (156)
T ss_pred             cccCce------EEEEecCCCCCCceehhhhhhccCCCccccCCCCcc
Confidence            678885      4887      45666655555566667777777665


No 17 
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed
Probab=25.51  E-value=21  Score=25.93  Aligned_cols=18  Identities=22%  Similarity=0.423  Sum_probs=15.5

Q ss_pred             EEEccchh--hccccccccc
Q psy8839          21 DILVADEC--LIAPLGIFHP   38 (74)
Q Consensus        21 ~~kVgDE~--m~APL~LFyP   38 (74)
                      ++++||++  +..|+|-|++
T Consensus        75 ~l~~Gd~v~~i~GP~G~~~~   94 (281)
T PRK06222         75 ELKEGDSILDVVGPLGKPSE   94 (281)
T ss_pred             cCCCCCEEeeEEcCCCCCcc
Confidence            67899997  8999998765


No 18 
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  
Probab=24.84  E-value=34  Score=20.57  Aligned_cols=19  Identities=21%  Similarity=0.137  Sum_probs=15.0

Q ss_pred             eeeeeEEEccchhhccccc
Q psy8839          16 YLLGFDILVADECLIAPLG   34 (74)
Q Consensus        16 ~~~kY~~kVgDE~m~APL~   34 (74)
                      ..+.=++++||++.+.|.+
T Consensus        21 ~v~~G~i~~Gd~v~i~P~~   39 (83)
T cd03698          21 KVESGSIQKGDTLLVMPSK   39 (83)
T ss_pred             EEeeeEEeCCCEEEEeCCC
Confidence            3445569999999999977


No 19 
>PF09482 OrgA_MxiK:  Bacterial type III secretion apparatus protein (OrgA_MxiK);  InterPro: IPR013388  This protein is encoded by genes which are found in type III secretion operons, and has been shown to be essential for the invasion phenotype in Salmonella and a component of the secretion apparatus []. The protein is known as OrgA in Salmonella due to its oxygen-dependent expression pattern in which low-oxygen levels up-regulate the gene []. In Shigella is called MxiK and has been shown to be essential for the proper assembly of the needle complex, which is the core component of type III secretion systems [].; GO: 0009405 pathogenesis
Probab=24.45  E-value=33  Score=24.65  Aligned_cols=22  Identities=32%  Similarity=0.401  Sum_probs=18.9

Q ss_pred             chhhcccccccccccccccCCc
Q psy8839          26 DECLIAPLGIFHPELLGLTGTK   47 (74)
Q Consensus        26 DE~m~APL~LFyP~lf~I~~~~   47 (74)
                      +.+|-+|.+.|+|+=+.|.+..
T Consensus         2 ~~Ily~P~sY~Hp~~~~l~~~~   23 (182)
T PF09482_consen    2 MRILYDPLSYIHPSHLPLPSYL   23 (182)
T ss_pred             cchhcCchhhcCccccCCCchh
Confidence            4689999999999999987755


No 20 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=23.39  E-value=26  Score=20.72  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=5.9

Q ss_pred             CCCCCCChh
Q psy8839          58 DPEDPHDGD   66 (74)
Q Consensus        58 DpED~~D~~   66 (74)
                      .-.||||||
T Consensus        33 ~LrDPfeeH   41 (43)
T PF02468_consen   33 ELRDPFEEH   41 (43)
T ss_pred             ccCCccccc
Confidence            456777765


No 21 
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=22.92  E-value=38  Score=20.37  Aligned_cols=19  Identities=21%  Similarity=0.127  Sum_probs=14.8

Q ss_pred             eeeeeEEEccchhhccccc
Q psy8839          16 YLLGFDILVADECLIAPLG   34 (74)
Q Consensus        16 ~~~kY~~kVgDE~m~APL~   34 (74)
                      ..+.=.+|+||++.+.|-+
T Consensus        20 ~v~~G~i~~G~~v~i~P~~   38 (82)
T cd04089          20 KVESGTIKKGDKLLVMPNK   38 (82)
T ss_pred             EEeeeEEecCCEEEEeCCC
Confidence            3444568999999999976


No 22 
>PF01606 Arteri_env:  Arterivirus envelope protein;  InterPro: IPR002556 This family consists of viral envelope proteins from the Arteriviridae; this includes Porcine reproductive and respiratory syndrome virus (PRRSV) envelope protein GP3 and Lactate dehydrogenase-elevating virus (LDV) structural glycoprotein. Arteriviruses consists of positive ssRNA and do not have a DNA stage.
Probab=22.63  E-value=41  Score=25.74  Aligned_cols=18  Identities=33%  Similarity=0.680  Sum_probs=13.3

Q ss_pred             ccccccccccCCceeeec
Q psy8839          35 IFHPELLGLTGTKIVVTQ   52 (74)
Q Consensus        35 LFyP~lf~I~~~~~~~~q   52 (74)
                      -|+||+|||-....+...
T Consensus       123 qfhPEiFgiGNVs~V~vd  140 (214)
T PF01606_consen  123 QFHPEIFGIGNVSRVYVD  140 (214)
T ss_pred             hhChhhhccCceeEEEEe
Confidence            499999999776654443


No 23 
>KOG0676|consensus
Probab=21.92  E-value=42  Score=27.01  Aligned_cols=27  Identities=33%  Similarity=0.630  Sum_probs=23.5

Q ss_pred             EEccchhhcccccccccccccccCCce
Q psy8839          22 ILVADECLIAPLGIFHPELLGLTGTKI   48 (74)
Q Consensus        22 ~kVgDE~m~APL~LFyP~lf~I~~~~~   48 (74)
                      |.+|+|..+||-++|-|.++|......
T Consensus       245 i~i~~erf~~pE~lFqP~~~g~e~~gi  271 (372)
T KOG0676|consen  245 ITIGNERFRCPEVLFQPSLLGMESPGI  271 (372)
T ss_pred             EecCCcccccchhcCChhhcCCCCCch
Confidence            889999999999999999998765553


Done!