RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8843
         (76 letters)



>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or
          KIF3_like proteins. Subgroup of kinesins, which form
          heterotrimers composed of 2 kinesins and one non-motor
          accessory subunit. Kinesins II play important roles in
          ciliary transport, and have been implicated in neuronal
          transport, melanosome transport, the secretory pathway,
          and mitosis. This catalytic (head) domain has ATPase
          activity and belongs to the larger group of P-loop
          NTPases. Kinesins are microtubule-dependent molecular
          motors that play important roles in intracellular
          transport and in cell division. In this group the motor
          domain is found at the N-terminus (N-type). N-type
          kinesins are (+) end-directed motors, i.e. they
          transport cargo towards the (+) end of the microtubule.
          Kinesin motor domains hydrolyze ATP at a rate of about
          80 per second, and move along the microtubule at a
          speed of about 6400 Angstroms per second. To achieve
          that, kinesin head groups work in pairs. Upon replacing
          ADP with ATP, a kinesin motor domain increases its
          affinity for microtubule binding and locks in place.
          Also, the neck linker binds to the motor domain, which
          repositions the other head domain through the
          coiled-coil domain close to a second tubulin dimer,
          about 80 Angstroms along the microtubule. Meanwhile,
          ATP hydrolysis takes place, and when the second head
          domain binds to the microtubule, the first domain again
          replaces ADP with ATP, triggering a conformational
          change that pulls the first domain forward.
          Length = 333

 Score = 60.5 bits (147), Expect = 1e-12
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 25 ESVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKEKK 69
          E+V+VVVRCRP+N  E S G  ++V +  NRG + + NPK   K+
Sbjct: 1  ENVKVVVRCRPLNKREKSEGAPEIVGVDENRGQVTVHNPKADAKE 45


>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle
          pole proteins, participate in spindle assembly and
          chromosome segregation during cell division. This
          catalytic (head) domain has ATPase activity and belongs
          to the larger group of P-loop NTPases. Kinesins are
          microtubule-dependent molecular motors that play
          important roles in intracellular transport and in cell
          division. In most kinesins, the motor domain is found
          at the N-terminus (N-type), N-type kinesins are (+)
          end-directed motors, i.e. they transport cargo towards
          the (+) end of the microtubule. Kinesin motor domains
          hydrolyze ATP at a rate of about 80 per second, and
          move along the microtubule at a speed of about 6400
          Angstroms per second. To achieve that, kinesin head
          groups work in pairs. Upon replacing ADP with ATP, a
          kinesin motor domain increases its affinity for
          microtubule binding and locks in place. Also, the neck
          linker binds to the motor domain, which repositions the
          other head domain through the coiled-coil domain close
          to a second tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 352

 Score = 38.0 bits (89), Expect = 1e-04
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 26 SVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISN 62
          ++QVVVRCRP NS E       VV++  +   I +S 
Sbjct: 3  NIQVVVRCRPRNSRERKEKSSVVVEVSGSSKEIIVST 39


>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like
          proteins. KIF1A (Unc104) transports synaptic vesicles
          to the nerve  terminal, KIF1B has been implicated in
          transport of mitochondria. Both proteins are expressed
          in neurons. This catalytic (head) domain has ATPase
          activity and belongs to the larger group of P-loop
          NTPases. Kinesins are microtubule-dependent molecular
          motors that play important roles in intracellular
          transport and in cell division. In most kinesins, the
          motor domain is found at the N-terminus (N-type).
          N-type kinesins are (+) end-directed motors, i.e. they
          transport cargo towards the (+) end of the microtubule.
          In contrast to the majority of dimeric kinesins, most
          KIF1A/Unc104 kinesins are monomeric motors. A
          lysine-rich loop in KIF1A binds to the negatively
          charged C-terminus of tubulin and compensates for the
          lack of a second motor domain, allowing KIF1A to move
          processively.
          Length = 356

 Score = 36.9 bits (86), Expect = 2e-04
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 25 ESVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPK 64
           +V+V VR RP NS E + G   +V M     V  + NPK
Sbjct: 1  ANVKVAVRVRPFNSREKNRGSKCIVQMPGK--VTTLKNPK 38


>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily.
          Members of this group seem to perform a variety of
          functions, and have been implicated in neuronal
          organelle transport and chromosome segregation during
          mitosis. This catalytic (head) domain has ATPase
          activity and belongs to the larger group of P-loop
          NTPases. Kinesins are microtubule-dependent molecular
          motors that play important roles in intracellular
          transport and in cell division. In most kinesins, the
          motor domain is found at the N-terminus (N-type).
          N-type kinesins are (+) end-directed motors, i.e. they
          transport cargo towards the (+) end of the microtubule.
          Kinesin motor domains hydrolyze ATP at a rate of about
          80 per second, and move along the microtubule at a
          speed of about 6400 Angstroms per second. To achieve
          that, kinesin head groups work in pairs. Upon replacing
          ADP with ATP, a kinesin motor domain increases its
          affinity for microtubule binding and locks in place.
          Also, the neck linker binds to the motor domain, which
          repositions the other head domain through the
          coiled-coil domain close to a second tubulin dimer,
          about 80 Angstroms along the microtubule. Meanwhile,
          ATP hydrolysis takes place, and when the second head
          domain binds to the microtubule, the first domain again
          replaces ADP with ATP, triggering a conformational
          change that pulls the first domain forward.
          Length = 341

 Score = 35.7 bits (83), Expect = 6e-04
 Identities = 12/40 (30%), Positives = 18/40 (45%)

Query: 25 ESVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPK 64
           SV+V VR RP+   E+  G    V + P    + +   K
Sbjct: 1  SSVRVAVRVRPLLPKELLEGCQVCVSVVPGEPQVTVGTDK 40


>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain. ATPase.
          Microtubule-dependent molecular motors that play
          important roles in intracellular transport of
          organelles and in cell division.
          Length = 335

 Score = 34.1 bits (79), Expect = 0.002
 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 2/46 (4%)

Query: 26 SVQVVVRCRPMNSSEISGGYDKVVDMWPNRG--VIEISNPKVKEKK 69
          +++VVVR RP+N  E S     VV      G  +   S    + +K
Sbjct: 1  NIRVVVRVRPLNKREKSRKSPSVVPFPDKVGKTLTVRSPKNRQGEK 46


>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like
          subgroup. The yeast kinesin KIP3 plays a role in
          positioning the mitotic spindle. This catalytic (head)
          domain has ATPase activity and belongs to the larger
          group of P-loop NTPases. Kinesins are
          microtubule-dependent molecular motors that play
          important roles in intracellular transport and in cell
          division. In most kinesins, the motor domain is found
          at the N-terminus (N-type). N-type kinesins are (+)
          end-directed motors, i.e. they transport cargo towards
          the (+) end of the microtubule. Kinesin motor domains
          hydrolyze ATP at a rate of about 80 per second, and
          move along the microtubule at a speed of about 6400
          Angstroms per second. To achieve that, kinesin head
          groups work in pairs. Upon replacing ADP with ATP, a
          kinesin motor domain increases its affinity for
          microtubule binding and locks in place. Also, the neck
          linker binds to the motor domain, which repositions the
          other head domain through the coiled-coil domain close
          to a second tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 338

 Score = 32.6 bits (75), Expect = 0.007
 Identities = 11/25 (44%), Positives = 13/25 (52%)

Query: 26 SVQVVVRCRPMNSSEISGGYDKVVD 50
          S+ V VR RP N  E   G  +VV 
Sbjct: 1  SLTVAVRVRPFNEKEKQEGTRRVVK 25


>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group.
          KIF2 is a protein expressed in neurons, which has been
          associated with axonal transport and neuron
          development; alternative splice forms have been
          implicated in lysosomal translocation. This catalytic
          (head) domain has ATPase activity and belongs to the
          larger group of P-loop NTPases. Kinesins are
          microtubule-dependent molecular motors that play
          important roles in intracellular transport and in cell
          division. In this subgroup the motor domain is found in
          the middle (M-type) of the protein chain. M-type
          kinesins are (+) end-directed motors, i.e. they
          transport cargo towards the (+) end of the microtubule.
          Kinesin motor domains hydrolyze ATP at a rate of about
          80 per second, and move along the microtubule at a
          speed of about 6400 Angstroms per second (KIF2 may be
          slower). To achieve that, kinesin head groups work in
          pairs. Upon replacing ADP with ATP, a kinesin motor
          domain increases its affinity for microtubule binding
          and locks in place. Also, the neck linker binds to the
          motor domain, which repositions the other head domain
          through the coiled-coil domain close to a second
          tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 322

 Score = 31.8 bits (73), Expect = 0.015
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 29 VVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKE 67
          V VR RP+N  E+S G   VV    +   + +  PK K 
Sbjct: 5  VAVRKRPLNDKELSKGETDVVSC-ESNPTVTVHEPKTKV 42


>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain. This catalytic (head) domain
          has ATPase activity and belongs to the larger group of
          P-loop NTPases. Kinesins are microtubule-dependent
          molecular motors that play important roles in
          intracellular transport and in cell division. In most
          kinesins, the motor domain is found at the N-terminus
          (N-type), in some its is found in the middle (M-type),
          or C-terminal (C-type). N-type and M-type kinesins are
          (+) end-directed motors, while C-type kinesins are (-)
          end-directed motors, i.e. they transport cargo towards
          the (-) end of the microtubule. Kinesin motor domains
          hydrolyze ATP at a rate of about 80 per second, and
          move along the microtubule at a speed of about 6400
          Angstroms per second. To achieve that, kinesin head
          groups work in pairs. Upon replacing ADP with ATP, a
          kinesin motor domain increases its affinity for
          microtubule binding and locks in place. Also, the neck
          linker binds to the motor domain, which repositions the
          other head domain through the coiled-coil domain close
          to a second tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 328

 Score = 28.7 bits (65), Expect = 0.18
 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 26 SVQVVVRCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKEKKIKD 72
          +++VVVR RP+N  E S   +  + +  N+ V        ++   K 
Sbjct: 1  NIRVVVRIRPLNGRE-SKSEESCITVDDNKTVTLTPPKDGRKAGPKS 46


>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain
          (KHC) or KIF5-like subgroup. Members of this group have
          been associated with organelle transport. This
          catalytic (head) domain has ATPase activity and belongs
          to the larger group of P-loop NTPases. Kinesins are
          microtubule-dependent molecular motors that play
          important roles in intracellular transport and in cell
          division. In most kinesins, the motor domain is found
          at the N-terminus (N-type). N-type kinesins are (+)
          end-directed motors, i.e. they transport cargo towards
          the (+) end of the microtubule. Kinesin motor domains
          hydrolyze ATP at a rate of about 80 per second, and
          move along the microtubule at a speed of about 6400
          Angstroms per second. To achieve that, kinesin head
          groups work in pairs. Upon replacing ADP with ATP, a
          kinesin motor domain increases its affinity for
          microtubule binding and locks in place. Also, the neck
          linker binds to the motor domain, which repositions the
          other head domain through the coiled-coil domain close
          to a second tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 325

 Score = 28.4 bits (64), Expect = 0.25
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 25 ESVQVVVRCRPMNSSEISGGYDKVVD 50
           +++VV R RP+N  E   G   +V 
Sbjct: 2  CNIKVVCRFRPLNEKEELRGSKSIVK 27


>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain. 
          Length = 326

 Score = 27.2 bits (61), Expect = 0.60
 Identities = 10/41 (24%), Positives = 17/41 (41%)

Query: 32 RCRPMNSSEISGGYDKVVDMWPNRGVIEISNPKVKEKKIKD 72
          R RP+N  E S G   +V++       + S     + + K 
Sbjct: 1  RVRPLNEREKSRGSSDIVNVDETDSEDKESVVITNKGREKT 41


>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like
          subgroup. Members of this subgroup seem to play a role
          in mitosis and meiosis. This catalytic (head) domain
          has ATPase activity and belongs to the larger group of
          P-loop NTPases. Kinesins are microtubule-dependent
          molecular motors that play important roles in
          intracellular transport and in cell division. In most
          kinesins, the motor domain is found at the N-terminus
          (N-type). N-type kinesins are (+) end-directed motors,
          i.e. they transport cargo towards the (+) end of the
          microtubule. Kinesin motor domains hydrolyze ATP at a
          rate of about 80 per second, and move along the
          microtubule at a speed of about 6400 Angstroms per
          second. To achieve that, kinesin head groups work in
          pairs. Upon replacing ADP with ATP, a kinesin motor
          domain increases its affinity for microtubule binding
          and locks in place. Also, the neck linker binds to the
          motor domain, which repositions the other head domain
          through the coiled-coil domain close to a second
          tubulin dimer, about 80 Angstroms along the
          microtubule. Meanwhile, ATP hydrolysis takes place, and
          when the second head domain binds to the microtubule,
          the first domain again replaces ADP with ATP,
          triggering a conformational change that pulls the first
          domain forward.
          Length = 337

 Score = 27.1 bits (60), Expect = 0.83
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 27 VQVVVRCRPMNSSEISGGYDKVV 49
          V+VVVR RP N  E  GG  + +
Sbjct: 3  VKVVVRIRPPNEIEADGGQGQCL 25


>gnl|CDD|179654 PRK03818, PRK03818, putative transporter; Validated.
          Length = 552

 Score = 26.8 bits (60), Expect = 1.1
 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 7/36 (19%)

Query: 47  KVVDM-WPNRG------VIEISNPKVKEKKIKDLNI 75
           + VD     RG       + ++N KV  KK++DL++
Sbjct: 276 EEVDTSLSTRGTDLRSERVVVTNEKVLGKKLRDLHL 311


>gnl|CDD|116892 pfam08309, LVIVD, LVIVD repeat.  This repeat is found in
          bacterial and archaeal cell surface proteins, many of
          which are hypothetical. The secondary structure
          corresponding to this repeat is predicted to comprise 4
          beta-strands which may associate to form a
          beta-propeller [Adindla et al. Comparative and
          Functional Genomics 2004; 5:2-16]. The repeat copy
          number varies from 2-14. This repeat is sometimes found
          with the PKD domain pfam00801.
          Length = 42

 Score = 24.9 bits (55), Expect = 1.6
 Identities = 9/23 (39%), Positives = 13/23 (56%)

Query: 41 ISGGYDKVVDMWPNRGVIEISNP 63
          +SG Y  V D      +++ISNP
Sbjct: 9  VSGNYAYVADGDNGLVIVDISNP 31


>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA
           synthetases.  Leucyl tRNA synthetase (LeuRS) catalytic
           core domain. This class I enzyme is a monomer which
           aminoacylates the 2'-OH of the nucleotide at the 3' of
           the appropriate tRNA. The core domain is based on the
           Rossman fold and is responsible for the ATP-dependent
           formation of the enzyme bound aminoacyl-adenylate. It
           contains the characteristic class I HIGH and KMSKS
           motifs, which are involved in ATP binding. In Aquifex
           aeolicus, the gene encoding LeuRS is split in two, just
           before the KMSKS motif. Consequently, LeuRS is a
           heterodimer, which likely superimposes with the LeuRS
           monomer found in most other organisms. LeuRS has an
           insertion in the core domain, which is subject to both
           deletions and rearrangements and thus differs between
           prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This
           editing region hydrolyzes mischarged cognate tRNAs and
           thus prevents the incorporation of chemically similar
           amino acids.
          Length = 314

 Score = 24.5 bits (54), Expect = 7.0
 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 4/31 (12%)

Query: 44  GYDKVVDMWPNRGVIEISNPKVKEKKIKDLN 74
            + K++D W     ++ S  + KEK +KDL 
Sbjct: 124 NWCKLLDQW----FLKYSETEWKEKLLKDLE 150


>gnl|CDD|221154 pfam11640, TAN, Telomere-length maintenance and DNA damage repair. 
           ATM is a large protein kinase, in humans, critical for
           responding to DNA double-strand breaks (DSBs). Tel1, the
           orthologue from budding yeast, also regulates responses
           to DSBs. Tel1 is important for maintaining viability and
           for phosphorylation of the DNA damage signal transducer
           kinase Rad53 (an orthologue of mammalian CHK2). In
           addition to functioning in the response to DSBs,
           numerous findings indicate that Tel1/ATM regulates
           telomeres. The overall domain structure of Tel1/ATM is
           shared by proteins of the phosphatidylinositol 3-kinase
           (PI3K)-related kinase (PIKK) family, but this family
           carries a unique and functionally important TAN sequence
           motif, near its N-terminal, LxxxKxxE/DRxxxL. which is
           conserved specifically in the Tel1/ATM subclass of the
           PIKKs. The TAN motif is essential for both telomere
           length maintenance and Tel1 action in response to DNA
           damage. It is classified as an EC:2.7.11.1.
          Length = 154

 Score = 23.9 bits (52), Expect = 8.2
 Identities = 6/19 (31%), Positives = 9/19 (47%)

Query: 55  RGVIEISNPKVKEKKIKDL 73
           R  +E +  K K K +  L
Sbjct: 89  RLFVEKAISKFKRKTLTAL 107


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.310    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0794    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,745,515
Number of extensions: 275532
Number of successful extensions: 201
Number of sequences better than 10.0: 1
Number of HSP's gapped: 201
Number of HSP's successfully gapped: 20
Length of query: 76
Length of database: 10,937,602
Length adjustment: 46
Effective length of query: 30
Effective length of database: 8,897,318
Effective search space: 266919540
Effective search space used: 266919540
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (24.1 bits)