Diaphorina citri psyllid: psy8855

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNGIELDFEFDGLNKGFKFKNPNIKNKCGCGKSFQI
ccccHHHHHHcccccccccccccccccccccccccccccccEEEEEEcccccEEcccccccccccccccccccHHHHccccHHHHHccccHHHHHHHccHHHHHHHHHHHHHcccccEEEEEEECccccccccccccccccccccEEEEEccEEEEEccccccEEccEEEEEEEcccccccEEccccccccccccccccc
**YSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNGIELDFEFDGLNKGFKFKNPNIKNKCGCGKSFQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSEKVLDHYENPRNVGVFEKNDNTVGTGMVGAPACGDVMKLQIKVNKNGVITDAKFKTYGCGSAIASSSLVTEWVKGKTLDEAMSIKNTDIAEELVTKKAAKYINKYIQKRGKGIGLRLGVYNRGCSGLSYKLEYVDEKRKEDQVFKLNGVQIFINEKDLLYFNGIELDFEFDGLNKGFKFKNPNIKNKCGCGKSFQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NifU-like protein May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins.confidentQ89A18
Iron-sulfur cluster assembly enzyme ISCU, mitochondrial Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins. Binds iron.confidentQ9H1K1
Iron sulfur cluster assembly protein 1, mitochondrial Involved in iron homeostasis within the mitochondrion where it is involved in the assembly of iron-sulfur proteins. Essential for de novo biosynthesis of mitochondrial and cytoplasmic iron sulfur proteins. May also be involved in the repair of iron sulfur clusters.confidentQ9UTC6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionconfident
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016740 [MF]transferase activityprobableGO:0003824, GO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0097428 [BP]protein maturation by iron-sulfur cluster transferprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032947 [MF]protein complex scaffoldprobableGO:0003674, GO:0005488, GO:0005515, GO:0005198
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009399 [BP]nitrogen fixationprobableGO:0006807, GO:0008150, GO:0008152, GO:0071941
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0008198 [MF]ferrous iron bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0016226 [BP]iron-sulfur cluster assemblyprobableGO:0022607, GO:0009058, GO:0016043, GO:0031163, GO:0044085, GO:0008150, GO:0008152, GO:0071840
GO:0002098 [BP]tRNA wobble uridine modificationprobableGO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0006400, GO:0008033, GO:0009987, GO:0006725, GO:0002097, GO:0043412, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0006399, GO:0006396

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVL, chain A
Confidence level:very confident
Coverage over the Query: 2-103
View the alignment between query and template
View the model in PyMOL
Template: 1R94, chain A
Confidence level:very confident
Coverage over the Query: 97-190
View the alignment between query and template
View the model in PyMOL