Diaphorina citri psyllid: psy8880


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MSIWCTVRRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMVTPDVIGDNVTITTLTLSGE
ccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHcccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEcccc
MSIWCTVRRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMVTPDVIGDNVTITTLTLSGE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIWCTVRRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMVTPDVIGDNVTITTLTLSGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005927 [CC]muscle tendon junctionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0051179 [BP]localizationprobableGO:0008150
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0002224 [BP]toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0048518, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0045202 [CC]synapseprobableGO:0005575
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 6-141
View the alignment between query and template
View the model in PyMOL