Query         psy8882
Match_columns 204
No_of_seqs    72 out of 74
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:47:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8882.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8882hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14324 PINIT:  PINIT domain;   99.9 1.3E-28 2.9E-33  197.6   5.2  110   65-204     1-113 (144)
  2 KOG2169|consensus               99.9 6.7E-22 1.4E-26  190.4   8.3  119   65-204   107-226 (636)
  3 PF01479 S4:  S4 domain;  Inter  32.6      38 0.00082   21.7   2.0   16  170-185    27-42  (48)
  4 PRK10856 cytoskeletal protein   22.2      82  0.0018   29.1   2.9   25  163-187   297-321 (331)
  5 PF13464 DUF4115:  Domain of un  20.2      92   0.002   22.2   2.2   19  165-183    46-64  (77)
  6 PRK06944 sulfur carrier protei  12.8 1.6E+02  0.0036   19.8   1.9   14  169-182     1-14  (65)
  7 PRK05659 sulfur carrier protei  11.9 1.8E+02  0.0039   19.8   1.9   13  170-182     2-14  (66)
  8 TIGR02988 YaaA_near_RecF S4 do  11.4 1.8E+02   0.004   19.6   1.8   14  170-183    35-48  (59)
  9 COG0522 RpsD Ribosomal protein  10.9 1.5E+02  0.0031   26.1   1.4   26  161-186   111-136 (205)
 10 KOG2305|consensus               10.5      89  0.0019   29.2  -0.0   20   77-96    102-121 (313)

No 1  
>PF14324 PINIT:  PINIT domain; PDB: 3I2D_A.
Probab=99.95  E-value=1.3e-28  Score=197.56  Aligned_cols=110  Identities=32%  Similarity=0.451  Sum_probs=74.5

Q ss_pred             CCCCCceeeecCCccccccccccceeccCCCCCCcceeeeEEEeCHHHHHHHhhcCccCCCccccceeeccccceecccc
Q psy8882          65 DRHPAVKFKVLPFFDMKHELIPISSLQPTNTSSRNQEVSFQFKLTNQQAAELGENREIIPGVRNDWHYQRTHCAIFSLIL  144 (204)
Q Consensus        65 ~~~P~VrfK~LPFYdvldeLLkPT~L~~s~~~~r~qe~~f~F~LTpqQv~~I~~srd~~pg~k~e~~v~rt~~~~~~~~~  144 (204)
                      |+||+++||++||||++ ++|.++.+.+.. .+..++..|.|.||++|+++|+++         ++.+            
T Consensus         1 ~~~~~~~Fk~sPFY~~~-~~i~~~~~~~~~-~~~r~~~~~~F~L~~~~~~~l~~~---------~~~~------------   57 (144)
T PF14324_consen    1 PVHPDLRFKPSPFYKVL-RLIHPTPLLPAS-SSGRQTCSFSFKLSPDQVELLKSS---------NPSY------------   57 (144)
T ss_dssp             -------B--BTTEEEE-EEEEEEEEEE---EEEEEEEEEEE---HHHHHHHHST---------T--E------------
T ss_pred             CCCCccEeccCCCccee-EEcCCccccccc-cCCCCeEEEEEEECHHHHHHHhcC---------CCCe------------
Confidence            57999999999999999 889999999988 678889999999999999999996         3456            


Q ss_pred             CCeEEEE---eeecCCCCCCccCCCCccEEEECCeeecCCCCCCCCCCCCCCCCCCCCccCCC
Q psy8882         145 YPQVQLR---IASLNTTTEQDDHYPPNLAIKVNQRAVQLPNPIPSRVQNKEPIRPSRLIEETN  204 (204)
Q Consensus       145 ~~QVQLR---fc~~etsceQ~D~fPpnl~VKVN~k~c~LP~~iP~~k~g~EpkRP~RPINIT~  204 (204)
                        ||+||   ||.++++|+|+|+||++|+|||||+.|.+|+..+.||+|.     .||||||+
T Consensus        58 --~v~L~c~~~~~~~~~~~q~i~FP~~~evkvN~~~v~~~~~glknKpGt-----~rPvdIT~  113 (144)
T PF14324_consen   58 --QVYLFCGKFCLSESSGNQPIEFPPPCEVKVNGKQVKLNNRGLKNKPGT-----ARPVDITP  113 (144)
T ss_dssp             --EEEEEEEESS-SS-GGGB-----SSEEEEETTEE--S--SS-TTS-GG-----GS-EE-GG
T ss_pred             --EEEEEEeccccCCCCCccccccCCCeEEEEeCEEcccCccCCCCCCCC-----CCCcccch
Confidence              99999   8999999999999999999999999999999999999999     89999995


No 2  
>KOG2169|consensus
Probab=99.86  E-value=6.7e-22  Score=190.45  Aligned_cols=119  Identities=38%  Similarity=0.632  Sum_probs=113.7

Q ss_pred             CCCCCceeeecCCccccccccccceeccCCCCCCcceeeeEEEeCHHHHHHHhhcCccCCCccccceeeccccceecccc
Q psy8882          65 DRHPAVKFKVLPFFDMKHELIPISSLQPTNTSSRNQEVSFQFKLTNQQAAELGENREIIPGVRNDWHYQRTHCAIFSLIL  144 (204)
Q Consensus        65 ~~~P~VrfK~LPFYdvldeLLkPT~L~~s~~~~r~qe~~f~F~LTpqQv~~I~~srd~~pg~k~e~~v~rt~~~~~~~~~  144 (204)
                      +.|++|+|++++|||++.++++|+.+..++ +.+++|+.|.|+||++++..|..++|+.+|.|.++.             
T Consensus       107 ~~~~~~~~~~~~~y~~l~~~~~p~~~~~~~-~~~~~~~~~~f~lt~~~~~~i~~~~~~~~~~k~~~~-------------  172 (636)
T KOG2169|consen  107 PFHPDVKLKKLPFYDVLSELIKPHVLHSSN-SPSLSESPFLFALTPEQVSGISSRPDVLPGSKSEGS-------------  172 (636)
T ss_pred             cCCCcccccCCchheecccccCceeecCcC-CCCcccccchhhcchhhhhhcccccccccccccccc-------------
Confidence            699999999999999999999999999998 689999999999999999999999999999886644             


Q ss_pred             CCeEEEEeeecCCCCCCccCCCCccEEEECCeeecCC-CCCCCCCCCCCCCCCCCCccCCC
Q psy8882         145 YPQVQLRIASLNTTTEQDDHYPPNLAIKVNQRAVQLP-NPIPSRVQNKEPIRPSRLIEETN  204 (204)
Q Consensus       145 ~~QVQLRfc~~etsceQ~D~fPpnl~VKVN~k~c~LP-~~iP~~k~g~EpkRP~RPINIT~  204 (204)
                         +    |+.+++|+++|+||.++.|+||++.|+|| |++|+++.++|+||++||+|||.
T Consensus       173 ---~----~~~~~s~p~e~~~p~~~~~~vn~~~~~l~~~~~~~n~~~~~~~~~~~P~n~t~  226 (636)
T KOG2169|consen  173 ---V----CLMETSCPQEDHFPPNVQVKVNNSPCQLPFGYMPNNKHGLEPKRPSRPGNITS  226 (636)
T ss_pred             ---e----eeccccCccccccCceeEEEecCCcceeeccccCCCCcccccCCCCCCCcCcc
Confidence               3    99999999999999999999999999999 99999999999999999999995


No 3  
>PF01479 S4:  S4 domain;  InterPro: IPR002942 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial ribosomal protein S4, eukaryotic ribosomal S9, two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number of uncharacterised, small proteins that may be involved in translation regulation []. The S4 domain probably mediates binding to RNA.; GO: 0003723 RNA binding; PDB: 3BBU_A 1DM9_B 2K6P_A 3U5G_E 3U5C_E 3IZB_D 2XZM_D 2XZN_D 3O30_E 3O2Z_E ....
Probab=32.58  E-value=38  Score=21.73  Aligned_cols=16  Identities=38%  Similarity=0.484  Sum_probs=13.3

Q ss_pred             EEEECCeeecCCCCCC
Q psy8882         170 AIKVNQRAVQLPNPIP  185 (204)
Q Consensus       170 ~VKVN~k~c~LP~~iP  185 (204)
                      .|+|||+.|.-|++.-
T Consensus        27 ~V~VNg~~v~~~~~~v   42 (48)
T PF01479_consen   27 RVKVNGKVVKDPSYIV   42 (48)
T ss_dssp             TEEETTEEESSTTSBE
T ss_pred             EEEECCEEEcCCCCCC
Confidence            4899999999888743


No 4  
>PRK10856 cytoskeletal protein RodZ; Provisional
Probab=22.20  E-value=82  Score=29.11  Aligned_cols=25  Identities=20%  Similarity=0.255  Sum_probs=21.3

Q ss_pred             cCCCCccEEEECCeeecCCCCCCCC
Q psy8882         163 DHYPPNLAIKVNQRAVQLPNPIPSR  187 (204)
Q Consensus       163 D~fPpnl~VKVN~k~c~LP~~iP~~  187 (204)
                      -.+|.+..|++||+.+.|.+++..+
T Consensus       297 iG~~~~v~i~~nG~~vdl~~~~~~g  321 (331)
T PRK10856        297 IGAPAAVQIQYQGKPVDLSRFIRTN  321 (331)
T ss_pred             EcCCCceEEEECCEEccCCccCcCC
Confidence            4579999999999999999996544


No 5  
>PF13464 DUF4115:  Domain of unknown function (DUF4115)
Probab=20.19  E-value=92  Score=22.15  Aligned_cols=19  Identities=26%  Similarity=0.443  Sum_probs=16.5

Q ss_pred             CCCccEEEECCeeecCCCC
Q psy8882         165 YPPNLAIKVNQRAVQLPNP  183 (204)
Q Consensus       165 fPpnl~VKVN~k~c~LP~~  183 (204)
                      .+.++.|++||+.+.+++.
T Consensus        46 na~~v~v~~nG~~~~~~~~   64 (77)
T PF13464_consen   46 NAGAVEVTVNGKPVDLLGP   64 (77)
T ss_pred             CCCcEEEEECCEECCCCCC
Confidence            5788999999999999754


No 6  
>PRK06944 sulfur carrier protein ThiS; Provisional
Probab=12.80  E-value=1.6e+02  Score=19.85  Aligned_cols=14  Identities=36%  Similarity=0.814  Sum_probs=11.6

Q ss_pred             cEEEECCeeecCCC
Q psy8882         169 LAIKVNQRAVQLPN  182 (204)
Q Consensus       169 l~VKVN~k~c~LP~  182 (204)
                      +.|+|||+.+.+|.
T Consensus         1 m~i~vNg~~~~~~~   14 (65)
T PRK06944          1 MDIQLNQQTLSLPD   14 (65)
T ss_pred             CEEEECCEEEECCC
Confidence            36899999999874


No 7  
>PRK05659 sulfur carrier protein ThiS; Validated
Probab=11.89  E-value=1.8e+02  Score=19.78  Aligned_cols=13  Identities=31%  Similarity=0.616  Sum_probs=11.2

Q ss_pred             EEEECCeeecCCC
Q psy8882         170 AIKVNQRAVQLPN  182 (204)
Q Consensus       170 ~VKVN~k~c~LP~  182 (204)
                      .|+|||+.+.++.
T Consensus         2 ~i~vNG~~~~~~~   14 (66)
T PRK05659          2 NIQLNGEPRELPD   14 (66)
T ss_pred             EEEECCeEEEcCC
Confidence            6899999998874


No 8  
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=11.36  E-value=1.8e+02  Score=19.58  Aligned_cols=14  Identities=14%  Similarity=0.048  Sum_probs=10.5

Q ss_pred             EEEECCeeecCCCC
Q psy8882         170 AIKVNQRAVQLPNP  183 (204)
Q Consensus       170 ~VKVN~k~c~LP~~  183 (204)
                      .|+|||+.|.-|++
T Consensus        35 ~V~VNg~~~~~~~~   48 (59)
T TIGR02988        35 EVLVNGELENRRGK   48 (59)
T ss_pred             CEEECCEEccCCCC
Confidence            48899998876554


No 9  
>COG0522 RpsD Ribosomal protein S4 and related proteins [Translation, ribosomal structure and biogenesis]
Probab=10.93  E-value=1.5e+02  Score=26.05  Aligned_cols=26  Identities=27%  Similarity=0.304  Sum_probs=19.1

Q ss_pred             CccCCCCccEEEECCeeecCCCCCCC
Q psy8882         161 QDDHYPPNLAIKVNQRAVQLPNPIPS  186 (204)
Q Consensus       161 Q~D~fPpnl~VKVN~k~c~LP~~iP~  186 (204)
                      |.-.|=.+=+|.|||+.+..|+|+=+
T Consensus       111 qARQlV~HGHI~VnGk~V~iPSy~V~  136 (205)
T COG0522         111 QARQLVSHGHILVNGKRVNIPSYLVS  136 (205)
T ss_pred             HHHHHhhcceEEECCEEeccCcEEec
Confidence            33444455579999999999998644


No 10 
>KOG2305|consensus
Probab=10.54  E-value=89  Score=29.19  Aligned_cols=20  Identities=15%  Similarity=0.315  Sum_probs=0.0

Q ss_pred             CccccccccccceeccCCCC
Q psy8882          77 FFDMKHELIPISSLQPTNTS   96 (204)
Q Consensus        77 FYdvldeLLkPT~L~~s~~~   96 (204)
                      ||++||+++.|+.+.+++|+
T Consensus       102 ly~qlD~i~d~~tIlaSSTS  121 (313)
T KOG2305|consen  102 LYKQLDEIADPTTILASSTS  121 (313)
T ss_pred             HHHHHHHhcCCceEEecccc


Done!