Diaphorina citri psyllid: psy8882

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MSHQPYYSQRLQQQQKQAQMAQQAAVLSLQQQNHGNMYQAGGASIPHYYMRPMANPAPLGPKLPDRHPAVKFKVLPFFDMKHELIPISSLQPTNTSSRNQEVSFQFKLTNQQAAELGENREIIPGVRNDWHYQRTHCAIFSLILYPQVQLRIASLNTTTEQDDHYPPNLAIKVNQRAVQLPNPIPSRVQNKEPIRPSRLIEETN
cccccccccHHHHHHHHHHHcHHcccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHcccccccccccccccccccEEEEEEEcHHHHHHHHHccccccccccccccccCEEEEEcccccccEEEEEEEEccccccccccccccEEEEccEEccccccccccccccccccccccccccc
********************************************IPHYYM*****************PAVKFKVLPFFDMKHELIPI***************SFQFKLTNQQAAELGENREIIPGVRNDWHYQRTHCAIFSLILYPQVQLRIASLNTTTEQDDHYPPNLAIKVNQRAVQLPNP**************RLIE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHQPYYSQRLQQQQKQAQMAQQAAVLSLQQQNHGNMYQAGGASIPHYYMRPMANPAPLGPKLPDRHPAVKFKVLPFFDMKHELIPISSLQPTNTSSRNQEVSFQFKLTNQQAAELGENREIIPGVRNDWHYQRTHCAIFSLILYPQVQLRIASLNTTTEQDDHYPPNLAIKVNQRAVQLPNPIPSRVQNKEPIRPSRLIEETN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0019789 [MF]SUMO ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FO9, chain A
Confidence level:very confident
Coverage over the Query: 69-132,147-204
View the alignment between query and template
View the model in PyMOL