Query         psy8890
Match_columns 150
No_of_seqs    162 out of 714
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 22:02:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8890.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8890hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03098 An_peroxidase:  Animal 100.0 4.9E-31 1.1E-35  235.1   3.5   89   61-149     1-92  (530)
  2 KOG2408|consensus              100.0   8E-29 1.7E-33  227.9   8.4   92   58-149   148-240 (719)
  3 PLN02283 alpha-dioxygenase      99.8 9.5E-22 2.1E-26  179.2   6.9   79   57-145    81-162 (633)
  4 PF13940 Ldr_toxin:  Toxin Ldr,  51.2      12 0.00025   22.2   1.5   14  132-145     3-16  (35)
  5 PTZ00304 NADH dehydrogenase [u  35.6      17 0.00036   33.0   0.9   16   72-87    444-459 (461)
  6 PF02425 GBP_PSP:  Paralytic/GB  28.4      21 0.00045   19.1   0.1   15   55-69      6-20  (23)
  7 PF08219 TOM13:  Outer membrane  18.7      65  0.0014   22.4   1.1   21  125-145    42-62  (77)
  8 PF12073 DUF3553:  Protein of u  17.3      69  0.0015   20.6   0.9    9   70-78      9-17  (52)
  9 PF06971 Put_DNA-bind_N:  Putat  17.0      87  0.0019   19.7   1.3   21   13-33     29-49  (50)
 10 PF01190 Pollen_Ole_e_I:  Polle  12.0 1.5E+02  0.0032   20.4   1.5   30   54-83     68-97  (97)

No 1  
>PF03098 An_peroxidase:  Animal haem peroxidase;  InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions. Peroxidases are found in bacteria, fungi, plants and animals. On the basis of sequence similarity, a number of animal haem peroxidases can be categorised as members of a superfamily: myeloperoxidase (MPO); eosinophil peroxidase (EPO); lactoperoxidase (LPO); thyroid peroxidase (TPO); prostaglandin H synthase (PGHS); and peroxidasin [, , ].  MPO plays a major role in the oxygen-dependent microbicidal system of neutrophils. EPO from eosinophilic granulocytes participates in immunological reactions, and potentiates tumor necrosis factor (TNF) production and hydrogen peroxide release by human monocyte-derived macrophages [, ]. In the main, MPO (and possibly EPO) utilises Cl-ions and H2O2 to form hypochlorous acid (HOCl), which can effectively kill bacteria or parasites. In secreted fluids, LPO catalyses the oxidation of thiocyanate ions (SCN-) by H2O2, producing the weak oxidising agent hypothiocyanite (OSCN-), which has bacteriostatic activity []. TPO uses I- ions and H2O2 to generate iodine, and plays a central role in the biosynthesis of thyroid hormones T(3) and T(4).  To date, the 3D structures of MPO and PGHS have been reported. MPO is a homodimer: each monomer consists of a light (A or B) and a heavy (C or D) chain resulting from post-translational excision of 6 residues from the common precursor. Monomers are linked by a single inter-chain disulphide. Each monomer includes a bound calcium ion []. PGHS exists as a symmetric dimer, each monomer of which consists of 3 domains: an N-terminal epidermal growth factor (EGF) like module; a membrane-binding domain; and a large C-terminal catalytic domain containing the cyclooxygenase and the peroxidase active sites. The catalytic domain shows striking structural similarity to MPO. The cyclooxygenase active site, which catalyses the formation of prostaglandin G2 (PGG2) from arachidonic acid, resides at the apex of a long hydrophobic channel, extending from the membrane-binding domain to the centre of the molecule. The peroxidase active site, which catalyses the reduction of PGG2 to PGH2, is located on the other side of the molecule, at the haem binding site []. Both MPO and the catalytic domain of PGHS are mainly alpha-helical, 19 helices being identified as topologically and spatially equivalent; PGHS contains 5 additional N-terminal helices that have no equivalent in MPO. In both proteins, three Asn residues in each monomer are glycosylated.; GO: 0004601 peroxidase activity, 0020037 heme binding, 0006979 response to oxidative stress, 0055114 oxidation-reduction process; PDB: 1FE2_A 1PGG_B 1PGF_A 3N8W_B 1IGZ_A 3KK6_B 3N8Z_A 1Q4G_A 1PTH_A 1EQH_A ....
Probab=99.96  E-value=4.9e-31  Score=235.10  Aligned_cols=89  Identities=44%  Similarity=0.922  Sum_probs=70.0

Q ss_pred             cccccccCcCCCCCCCCCCCCCcccccCCCCCCCCCCCcccCCCCCCCchhhhhhhhcCCCC---CCCCchHHHHHHHHH
Q psy8890          61 YRRYDGLCTNLKHPTWGAVNTPFQRLIGPLFSDGLTSPRISNKGGNLPLARVVSSTMHPDEN---KHEHAATVMLVAWGQ  137 (150)
Q Consensus        61 yRt~DGsCNNl~~P~wG~a~tpf~Rllp~~Y~DG~~~Pr~s~~g~~LP~~R~VS~~l~~~~~---~~~~~~t~~~~~wgQ  137 (150)
                      |||+||+|||+.||.||++++||.|++||.|+||+++||.+.+|.+||+||+||+.|+....   ..++.+|+|+|+|||
T Consensus         1 yRt~dG~cNN~~~p~~G~~~~~~~Rllp~~Y~dg~~~pr~~~~g~~lP~pR~is~~l~~~~~~~~~~~~~~t~l~~~~gQ   80 (530)
T PF03098_consen    1 YRTYDGSCNNLANPSWGAAGTPFRRLLPPAYADGVSEPRGSSNGSPLPNPREISNALFRRKDGFDPSHSGLTALFMQWGQ   80 (530)
T ss_dssp             S--SSSTTSSSSSTTTT-SSEE-BESS-B--TTSSSBTTTSBTTBS---HHHHHHHHTB-SSGTTBEEEEEEHHHHHHHH
T ss_pred             CCCCCCCccCCCcccccCCCCcccccCCccccccccccccccCCccCCCHHHHHHHHhhcccccCCCCCcchHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999997643   344678999999999


Q ss_pred             HHHhhccCCCCC
Q psy8890         138 FMDHDFTLTATP  149 (150)
Q Consensus       138 fi~HDi~~t~~~  149 (150)
                      ||+|||++++..
T Consensus        81 fi~HDi~~~~~~   92 (530)
T PF03098_consen   81 FIDHDITLTPDS   92 (530)
T ss_dssp             HHHHHH--BEBT
T ss_pred             HHhhhhcccccc
Confidence            999999998754


No 2  
>KOG2408|consensus
Probab=99.95  E-value=8e-29  Score=227.92  Aligned_cols=92  Identities=41%  Similarity=0.778  Sum_probs=87.6

Q ss_pred             CCccccccccCcCCCCCCCCCCCCCcccccCCCCCCCCCCCcccCCCCCCCchhhhhhhhcCCC-CCCCCchHHHHHHHH
Q psy8890          58 PGKYRRYDGLCTNLKHPTWGAVNTPFQRLIGPLFSDGLTSPRISNKGGNLPLARVVSSTMHPDE-NKHEHAATVMLVAWG  136 (150)
Q Consensus        58 ~~~yRt~DGsCNNl~~P~wG~a~tpf~Rllp~~Y~DG~~~Pr~s~~g~~LP~~R~VS~~l~~~~-~~~~~~~t~~~~~wg  136 (150)
                      ..+|||+||+|||+.+|.||+++++|.|++||.|+||++.||.+..+.+||+||+||+.|+.+. ..++.++|+|+||||
T Consensus       148 ~~~yRt~dG~CNN~~~P~~Gas~~~~~Rllpp~Yedg~~~p~~~~~~~~lP~~R~vS~~l~~~~~~~~~~~~~~~~mqwg  227 (719)
T KOG2408|consen  148 HSKYRTIDGTCNNLRNPTLGASNSPFRRLLPPKYEDGFSTPRGWSDGTPLPSARLVSNKLLSRSFSPPDSKFNHMAMQWG  227 (719)
T ss_pred             ccCccccccccCCCCCCCcccccChhhccCCccccccccCccccccCCCCCchHHhhHhhhccccCCCCcchhHHHHHHH
Confidence            4799999999999999999999999999999999999999999887899999999999999887 778899999999999


Q ss_pred             HHHHhhccCCCCC
Q psy8890         137 QFMDHDFTLTATP  149 (150)
Q Consensus       137 Qfi~HDi~~t~~~  149 (150)
                      |||+|||++++.+
T Consensus       228 QFi~HDl~~~~~~  240 (719)
T KOG2408|consen  228 QFIDHDLYFTPLS  240 (719)
T ss_pred             HHhcccccccCCc
Confidence            9999999999864


No 3  
>PLN02283 alpha-dioxygenase
Probab=99.85  E-value=9.5e-22  Score=179.23  Aligned_cols=79  Identities=27%  Similarity=0.356  Sum_probs=67.3

Q ss_pred             CCCccccccccCcCCCCCCCCCCCCCcccccCCC-CCCCCCCCcccCCCCCCCchhhhhhhhcCCCCCC--CCchHHHHH
Q psy8890          57 KPGKYRRYDGLCTNLKHPTWGAVNTPFQRLIGPL-FSDGLTSPRISNKGGNLPLARVVSSTMHPDENKH--EHAATVMLV  133 (150)
Q Consensus        57 ~~~~yRt~DGsCNNl~~P~wG~a~tpf~Rllp~~-Y~DG~~~Pr~s~~g~~LP~~R~VS~~l~~~~~~~--~~~~t~~~~  133 (150)
                      +..+|||+||+|||+.||.||++||+|.|++||. |.||+          .+|+||.||+.++.+....  ....|+|++
T Consensus        81 ~~~~yRt~DGscNNl~~P~~G~agt~f~R~v~p~~~~~~~----------~~P~pr~vs~~ll~r~~f~~~~~~~n~~~~  150 (633)
T PLN02283         81 AEYPYRTADGKCNDPFNEGAGSQGTFFGRNMPPVDQKDKL----------LDPHPSVVATKLLARKKFIDTGKQFNMIAA  150 (633)
T ss_pred             ccccccCCCCCCcCCCCcccccCCCccccCCCccccCCCC----------CCCCHHHHHHHHHhhccccCCCCcchHHHH
Confidence            3469999999999999999999999999999996 55554          4699999999999765443  346899999


Q ss_pred             HHHHHHHhhccC
Q psy8890         134 AWGQFMDHDFTL  145 (150)
Q Consensus       134 ~wgQfi~HDi~~  145 (150)
                      +|||||+|||..
T Consensus       151 ~w~Qf~~HD~~~  162 (633)
T PLN02283        151 SWIQFMIHDWID  162 (633)
T ss_pred             HHHHHHHhhhhh
Confidence            999999999843


No 4  
>PF13940 Ldr_toxin:  Toxin Ldr, type I toxin-antitoxin system
Probab=51.21  E-value=12  Score=22.16  Aligned_cols=14  Identities=29%  Similarity=0.337  Sum_probs=12.1

Q ss_pred             HHHHHHHHHhhccC
Q psy8890         132 LVAWGQFMDHDFTL  145 (150)
Q Consensus       132 ~~~wgQfi~HDi~~  145 (150)
                      +.|||-.++||+.-
T Consensus         3 Laqlg~~~WhDLAA   16 (35)
T PF13940_consen    3 LAQLGIAFWHDLAA   16 (35)
T ss_pred             HHHHHHHHHHHhHh
Confidence            68999999999863


No 5  
>PTZ00304 NADH dehydrogenase [ubiquinone] flavoprotein 1; Provisional
Probab=35.58  E-value=17  Score=32.97  Aligned_cols=16  Identities=31%  Similarity=0.916  Sum_probs=14.4

Q ss_pred             CCCCCCCCCCCccccc
Q psy8890          72 KHPTWGAVNTPFQRLI   87 (150)
Q Consensus        72 ~~P~wG~a~tpf~Rll   87 (150)
                      ++|.||.+++|.+|+-
T Consensus       444 ~~~~~~~~~~~~~~~~  459 (461)
T PTZ00304        444 ANPHWGKSGSPWRRWK  459 (461)
T ss_pred             cCchhcccCCCCcccc
Confidence            6899999999999973


No 6  
>PF02425 GBP_PSP:  Paralytic/GBP/PSP peptide;  InterPro: IPR003463 This family includes insect peptides that are short (23 amino acids) and contain 1 disulphide bridge. The family includes growth-blocking peptide (GBP) of Pseudaletia separata (Oriental armyworm) and the paralytic peptides from Manduca sexta (Tobacco hawkmoth), Heliothis virescens (Noctuid moth), and Spodoptera exigua (Beet armyworm) [] as well as plasmatocyte-spreading peptide (PSP1) []. These peptides function to halt metamorphosis from larvae to pupae.; PDB: 1V28_A 2DJC_A 2EQQ_A 2EQH_A 2EQT_A 1BQF_A 2DJ9_A 1HRL_A 1IRR_A 1B5N_A ....
Probab=28.40  E-value=21  Score=19.12  Aligned_cols=15  Identities=40%  Similarity=0.837  Sum_probs=11.5

Q ss_pred             CCCCCccccccccCc
Q psy8890          55 ECKPGKYRRYDGLCT   69 (150)
Q Consensus        55 ~C~~~~yRt~DGsCN   69 (150)
                      -|.+.--|+.||.|-
T Consensus         6 gc~~gy~rtadgrck   20 (23)
T PF02425_consen    6 GCATGYMRTADGRCK   20 (23)
T ss_dssp             SSSTTEEEETTTEEE
T ss_pred             cccccceEcCCcccc
Confidence            466666799999994


No 7  
>PF08219 TOM13:  Outer membrane protein TOM13;  InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=18.73  E-value=65  Score=22.36  Aligned_cols=21  Identities=14%  Similarity=0.431  Sum_probs=16.4

Q ss_pred             CCchHHHHHHHHHHHHhhccC
Q psy8890         125 EHAATVMLVAWGQFMDHDFTL  145 (150)
Q Consensus       125 ~~~~t~~~~~wgQfi~HDi~~  145 (150)
                      -+..+-|+.-||..++|++.+
T Consensus        42 LPFiNG~MLGFGEl~AhE~~f   62 (77)
T PF08219_consen   42 LPFINGMMLGFGELFAHEIAF   62 (77)
T ss_pred             hhhhhhhhHhHHHHHHHHHHH
Confidence            345577778899999999853


No 8  
>PF12073 DUF3553:  Protein of unknown function (DUF3553);  InterPro: IPR021938  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 60 amino acids in length. This protein has two conserved sequence motifs: GQVQS and TVNF. 
Probab=17.35  E-value=69  Score=20.62  Aligned_cols=9  Identities=44%  Similarity=1.221  Sum_probs=7.0

Q ss_pred             CCCCCCCCC
Q psy8890          70 NLKHPTWGA   78 (150)
Q Consensus        70 Nl~~P~wG~   78 (150)
                      +..+|.||.
T Consensus         9 HP~~pdWG~   17 (52)
T PF12073_consen    9 HPDHPDWGI   17 (52)
T ss_pred             CCCCCCCcc
Confidence            567899983


No 9  
>PF06971 Put_DNA-bind_N:  Putative DNA-binding protein N-terminus;  InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria []. They modulate transcription in response to changes in cellular NADH/NAD(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0045892 negative regulation of transcription, DNA-dependent, 0051775 response to redox state, 0005737 cytoplasm; PDB: 3IL2_B 3IKT_A 3IKV_B 1XCB_F 2DT5_A 2VT3_A 2VT2_A 3KEO_B 3KET_A 3KEQ_A ....
Probab=17.03  E-value=87  Score=19.70  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=16.1

Q ss_pred             hhhHHHHHHcCCCHHHHHhcC
Q psy8890          13 QGTKTLKAIYDLSYEEVEKGL   33 (150)
Q Consensus        13 ~~s~~~~~~~~l~~~~~~~gl   33 (150)
                      ..|..|++..|+++.|+...|
T Consensus        29 vSS~~La~~~gi~~~qVRKDl   49 (50)
T PF06971_consen   29 VSSQELAEALGITPAQVRKDL   49 (50)
T ss_dssp             E-HHHHHHHHTS-HHHHHHHH
T ss_pred             ECHHHHHHHHCCCHHHhcccC
Confidence            348999999999999997654


No 10 
>PF01190 Pollen_Ole_e_I:  Pollen proteins Ole e I like;  InterPro: IPR006041 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ole e 1. A number of plant pollen proteins, whose biological function is not yet known, are structurally related []. These proteins are most probably secreted and consist of about 145 residues. There are six cysteines which are conserved in the sequence of these proteins. They seem to be involved in disulphide bonds. 
Probab=11.98  E-value=1.5e+02  Score=20.35  Aligned_cols=30  Identities=13%  Similarity=0.212  Sum_probs=23.6

Q ss_pred             CCCCCCccccccccCcCCCCCCCCCCCCCc
Q psy8890          54 VECKPGKYRRYDGLCTNLKHPTWGAVNTPF   83 (150)
Q Consensus        54 ~~C~~~~yRt~DGsCNNl~~P~wG~a~tpf   83 (150)
                      ..|...--++.+..||......+|..|.++
T Consensus        68 ~~C~v~l~~sp~~~C~~~~~~~~G~~ga~l   97 (97)
T PF01190_consen   68 SSCRVKLVSSPDPSCNVPTNSNGGRTGAKL   97 (97)
T ss_pred             CCcEEEEeCCCcCcCCCCcCCCCCccCCcC
Confidence            456655567788899999999999988764


Done!