Diaphorina citri psyllid: psy8890


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MTTYYGNVNSRRQGTKTLKAIYDLSYEEVEKGLPLIDTSKTLIREICPAYLSNVECKPGKYRRYDGLCTNLKHPTWGAVNTPFQRLIGPLFSDGLTSPRISNKGGNLPLARVVSSTMHPDENKHEHAATVMLVAWGQFMDHDFTLTATPL
cccHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHcccccccccc
**T******S*****KTLKAIYDLSYEEVEKGLPLIDTSKTLIREICPAYLSNVECKPGKYRRYDGLCTNLKHPTWGAVNTPFQRLIGPLFSDGLTSPRISNKGGNLPLARVVSST******KHEHAATVMLVAWGQFMDHDFTLTA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTYYGNVNSRRQGTKTLKAIYDLSYEEVEKGLPLIDTSKTLIREICPAYLSNVECKPGKYRRYDGLCTNLKHPTWGAVNTPFQRLIGPLFSDGLTSPRISNKGGNLPLARVVSSTMHPDENKHEHAATVMLVAWGQFMDHDFTLTATPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0005488 [MF]bindingprobableGO:0003674
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004601 [MF]peroxidase activityprobableGO:0003824, GO:0016209, GO:0016684, GO:0003674, GO:0016491
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0042743 [BP]hydrogen peroxide metabolic processprobableGO:0008152, GO:0009987, GO:0008150, GO:0044237, GO:0072593
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q9K, chain A
Confidence level:very confident
Coverage over the Query: 46-149
View the alignment between query and template
View the model in PyMOL