Query         psy8899
Match_columns 73
No_of_seqs    45 out of 47
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:18:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8899.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8899hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01438 tankyrase_like Tankyra  99.9 1.3E-26 2.9E-31  170.2   7.1   66    1-66    158-223 (223)
  2 PF00644 PARP:  Poly(ADP-ribose  99.8 1.2E-18 2.6E-23  120.8   5.2   62    2-63    122-206 (206)
  3 cd01439 TCCD_inducible_PARP_li  99.6 5.5E-16 1.2E-20  103.0   5.8   54    2-61     60-121 (121)
  4 cd01437 parp_like Poly(ADP-rib  99.6 4.1E-15   9E-20  114.0   5.1   61    2-62    257-347 (347)
  5 PLN03124 poly [ADP-ribose] pol  99.1 1.3E-10 2.7E-15   96.0   5.7   63    1-63    547-638 (643)
  6 PLN03123 poly [ADP-ribose] pol  99.0 2.5E-10 5.3E-15   97.6   5.4   61    2-62    888-976 (981)
  7 cd01341 ADP_ribosyl ADP_ribosy  98.7 2.3E-08 4.9E-13   67.2   4.1   54    4-57     79-137 (137)
  8 PLN03122 Poly [ADP-ribose] pol  98.3 2.8E-07 6.2E-12   78.0   2.6   62    2-63    713-804 (815)
  9 KOG4177|consensus               95.6  0.0033 7.3E-08   55.6   0.1   42    2-49   1102-1143(1143)
 10 KOG1037|consensus               94.8  0.0045 9.8E-08   50.5  -1.3   60    1-60    428-518 (531)
 11 PF04962 KduI:  KduI/IolB famil  32.8      16 0.00035   27.4   0.2   14   23-36    221-234 (261)
 12 PF15179 Myc_target_1:  Myc tar  31.3      11 0.00024   28.2  -0.8   11   23-33    180-190 (197)
 13 PRK03459 rnpA ribonuclease P;   27.8      26 0.00056   23.4   0.5   22   24-45     82-104 (122)
 14 cd07985 LPLAT_GPAT Lysophospho  27.0      43 0.00093   25.2   1.6   17   53-69    161-177 (235)
 15 PF01221 Dynein_light:  Dynein   21.8      41 0.00089   20.7   0.6   11   25-35     51-61  (89)
 16 COG1159 Era GTPase [General fu  21.5      39 0.00086   26.5   0.6   14   26-39      6-19  (298)
 17 PF00850 Hist_deacetyl:  Histon  21.5      47   0.001   24.9   1.0   16   24-41    119-134 (311)
 18 PTZ00059 dynein light chain; P  21.4      33 0.00071   21.7   0.1   11   25-35     52-62  (90)
 19 KOG3430|consensus               20.3      42 0.00091   22.3   0.4   18   26-43     53-70  (90)

No 1  
>cd01438 tankyrase_like Tankyrases interact with the telomere reverse transcriptase complex (TERT). Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1  (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis).
Probab=99.93  E-value=1.3e-26  Score=170.18  Aligned_cols=66  Identities=53%  Similarity=0.893  Sum_probs=63.6

Q ss_pred             CeEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEeeCcccceeEEEEeeecCC
Q psy8899           1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRL   66 (73)
Q Consensus         1 ~~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y~~~~~   66 (73)
                      .||||||++|+++.+.+++.+++||+|||||+|.|+.++++|+|||||+++||||+|||+|+++||
T Consensus       158 ~MfLcrVlLGk~~~~~~~~~~~~~P~G~dSv~g~Ps~~~~~~~EfVVyd~~Q~YPeYLI~y~~~~~  223 (223)
T cd01438         158 QMLFCRVTLGKSFLQFSAMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIVKP  223 (223)
T ss_pred             eEEEEEEEecceeeccCCcccCCCCCCCcceEcCCCCCCcccCEEEEECCCcEeeEEEEEEEeeCC
Confidence            389999999999988899999999999999999999999999999999999999999999999998


No 2  
>PF00644 PARP:  Poly(ADP-ribose) polymerase catalytic domain;  InterPro: IPR012317 Poly(ADP-ribose) polymerases (PARP) are a family of enzymes present in eukaryotes, which catalyze the poly(ADP-ribosyl)ation of a limited number of proteins involved in chromatin architecture, DNA repair, or in DNA metabolism, including PARP itself. PARP, also known as poly(ADP-ribose) synthetase and poly(ADP-ribose) transferase, transfers the ADP-ribose moiety from its substrate, nicotinamide adenine dinucleotide (NAD), to carboxylate groups of aspartic and glutamic residues. Whereas some PARPs might function in genome protection, others appear to play different roles in the cell, including telomere replication and cellular transport. PARP-1 is a multifunctional enzyme. The polypeptide has a highly conserved modular organisation consisting of an N-terminal DNA-binding domain, a central regulating segment, and a C-terminal or F region accommodating the catalytic centre. The F region is composed of two parts: a purely alpha-helical N- terminal domain (alpha-hd), and the mixed alpha/beta C-terminal catalytic domain bearing the putative NAD binding site. Although proteins of the PARP family are related through their PARP catalytic domain, they do not resemble each other outside of that region, but rather, they contain unique domains that distinguish them from each other and hint at their discrete functions. Domains with which the PARP catalytic domain is found associated include zinc fingers, SAP, ankyrin, BRCT, Macro, SAM, WWE and UIM domains [, , ]. The alpha-hd domain is about 130 amino acids in length and consists of an up-up-down-up-down-down motif of helices. It is thought to relay the activation signal issued on binding to damaged DNA [, ]. The PARP catalytic domain is about 230 residues in length. Its core consists of a five-stranded antiparallel beta-sheet and four-stranded mixed beta-sheet. The two sheets are consecutive and are connected via a single pair of hydrogen bonds between two strands that run at an angle of 90 degrees. These central beta-sheets are surrounded by five alpha-helices, three 3(10)-helices, and by a three- and a two-stranded beta-sheet in a 37-residue excursion between two central beta-strands [, ]. The active site, known as the 'PARP signature' is formed by a block of 50 amino acids that is strictly conserved among the vertebrates and highly conserved among all species. The 'PARP signature' is characteristic of all PARP protein family members. It is formed by a segment of conserved amino acid residues formed by a beta-sheet, an alpha-helix, a 3(10)-helix, a beta-sheet, and an alpha-helix [].; GO: 0003950 NAD+ ADP-ribosyltransferase activity; PDB: 2PQF_F 4F0D_A 1PAX_A 1EFY_A 1A26_A 2PAW_A 4PAX_A 3PAX_A 2PAX_A 3P0N_A ....
Probab=99.75  E-value=1.2e-18  Score=120.81  Aligned_cols=62  Identities=32%  Similarity=0.423  Sum_probs=52.5

Q ss_pred             eEEeeeecCCeeeEeecccccCCCCCCceeeecc--------------CC---------CCCCcceEEEeeCcccceeEE
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRP--------------SS---------GGLYFPEYVVYRGEQMCISYL   58 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p--------------~~---------ggLnY~E~VVY~~eqi~P~yL   58 (73)
                      ||||||++|+++..+.+..+..||+|+|||.|..              ++         +.++++|||||+++|+||+||
T Consensus       122 ~llc~V~lG~~~~~~~~~~~~~~~~g~~sv~~~~~~~~~~~~~~~g~p~~~~~~~~~~~~~~~~~eyVVy~~~q~~p~YL  201 (206)
T PF00644_consen  122 MLLCRVALGKPYELKNDNPMTSPPPGYDSVKGVGSKTPEDTIDEDGVPSGKGYVSEYDGSSLNPNEYVVYDNSQVYPEYL  201 (206)
T ss_dssp             EEEEEEEECSEEEESSCCTGSSGCTTESEEEECESEEEGGEEEETTETTSSEEESCEESSSSSCSEEEESSGGGEEEEEE
T ss_pred             eeEEEEEeccceeeccCcccccccCCcceecCCCccCCccccccCCCCCCCCccCccCCCccCCCEEEEEcccceeeEEE
Confidence            8999999999987765544888999999998753              22         229999999999999999999


Q ss_pred             EEeee
Q psy8899          59 AKNLY   63 (73)
Q Consensus        59 I~Y~~   63 (73)
                      |+|+.
T Consensus       202 i~y~~  206 (206)
T PF00644_consen  202 ITYKF  206 (206)
T ss_dssp             EEEEE
T ss_pred             EEEEC
Confidence            99973


No 3  
>cd01439 TCCD_inducible_PARP_like Poly(ADP-ribose) polymerases catalyse the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA. Poly(ADP-ribose) polymerase is a regulatory component induced by DNA damage. The carboxyl-terminal region is the most highly conserved region of the protein. 2,3,7,8-Tetrachlorodibenzo-p-dioxin (TCDD) causes  pleotropic effects in mammalian species through modulating gene expression.  TCCD indicible PARP (TiPARP) is a  target of TCDD that may contribute to multiple responses to TCDD by modulating protein function through poly ADP-ribosylation
Probab=99.63  E-value=5.5e-16  Score=103.04  Aligned_cols=54  Identities=15%  Similarity=0.095  Sum_probs=42.5

Q ss_pred             eEEeeeecCCeeeEeecccccCCC--------CCCceeeeccCCCCCCcceEEEeeCcccceeEEEEe
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAHAP--------PGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKN   61 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~pP--------pGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y   61 (73)
                      ||||||++|+.. +-+ ..+..||        .+||||++..    .|..|+|||++.||||||||+|
T Consensus        60 mfL~rVl~G~~~-~~~-~~~~~pP~~~~~~~~~~yDS~vd~~----~~p~~~Vvf~~~q~yPeYlI~y  121 (121)
T cd01439          60 MFLARVLTGDYT-QGH-PGYRRPPLKPSGVELDRYDSCVDNV----SNPSIFVIFSDVQAYPEYLITY  121 (121)
T ss_pred             EEEEEEEeccee-cCC-CcccCCCCccCCCCCCCccceeCCC----CCCCEEEEEeCCccceeEEEEC
Confidence            899999999953 221 2333454        6799999875    3458999999999999999997


No 4  
>cd01437 parp_like Poly(ADP-ribose) polymerase (parp) catalytic domain catalyses the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins,  which decreases their affinity for DNA. Poly(ADP-ribose) polymerase is a regulatory component induced by DNA damage. The carboxyl-terminal region is the most highly conserved region of the protein. Experiments have shown that a carboxyl 40 kDa fragment is still catalytically active. Poly(ADP-ribose)-like polymerases (PARPS 1-3, VPARP, tankyrase) catalyze the addition of up to 100 ADP_ribose units from NAD+. PARPs 1 and 2 are localized in the nucleaus, bind DNA, and are activated  by DNA damage. VPARP is part of the vault ribonucleoprotein complex. Tankyrases regulates telomere length through interactions with telomere repeat binding factor 1.
Probab=99.55  E-value=4.1e-15  Score=114.00  Aligned_cols=61  Identities=34%  Similarity=0.436  Sum_probs=51.3

Q ss_pred             eEEeeeecCCeeeEeecccccC-CCCCCceeeec------cC-----------------------CCCCCcceEEEeeCc
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAH-APPGHHSVMGR------PS-----------------------SGGLYFPEYVVYRGE   51 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~-pPpGyhSViG~------p~-----------------------~ggLnY~E~VVY~~e   51 (73)
                      ||||||++|+++..+++...+. ||.|||||.|.      |+                       ++.|.|+|||||+.+
T Consensus       257 mlLc~V~lG~~~~~~~~~~~~~~~p~g~~Sv~g~G~~~p~~~~~~~~~~gv~vP~G~~~~~~~~~~~~l~~nEyiVYd~~  336 (347)
T cd01437         257 LLLCEVALGKMNELKKADYMAKELPKGKHSVKGLGKTAPDPSEFEIDLDGVVVPLGKPVPSGHKTDTSLLYNEYIVYDVA  336 (347)
T ss_pred             EEEEEEecCceehhccCChhhccCCCCceeeEeccCCCCCchhheeccCCeEeeCCccccCCcCCCcccccCCeEeechh
Confidence            7999999999998776665554 99999999876      11                       346999999999999


Q ss_pred             ccceeEEEEee
Q psy8899          52 QMCISYLAKNL   62 (73)
Q Consensus        52 qi~P~yLI~Y~   62 (73)
                      ||++.|||..+
T Consensus       337 Qir~rYLv~vk  347 (347)
T cd01437         337 QVRLKYLLEVK  347 (347)
T ss_pred             HEEEEEEEEeC
Confidence            99999999753


No 5  
>PLN03124 poly [ADP-ribose] polymerase; Provisional
Probab=99.10  E-value=1.3e-10  Score=96.03  Aligned_cols=63  Identities=27%  Similarity=0.440  Sum_probs=50.0

Q ss_pred             CeEEeeeecCCeeeEeecccc-cCCCCCCceeeec----c------------------------CCCCCCcceEEEeeCc
Q psy8899           1 MFVLGTANHSKSFLQFNAIKM-AHAPPGHHSVMGR----P------------------------SSGGLYFPEYVVYRGE   51 (73)
Q Consensus         1 ~~llcrV~vGr~~~~~~~~~~-~~pPpGyhSViG~----p------------------------~~ggLnY~E~VVY~~e   51 (73)
                      .||||.|++|++...+++.-+ ..+|+|+|||.|.    |                        ..+.|.|+|||||+..
T Consensus       547 ~llLceVaLG~~~el~~~~y~a~~~p~G~~S~kG~G~~~Pdp~~~~~~~dGV~VP~Gk~~~~~~~~~~L~yNEYIVYd~~  626 (643)
T PLN03124        547 VLLLCEVALGDMNELLQADYNANKLPPGKLSTKGVGRTVPDPSEAKTLEDGVVVPLGKPVESPYSKGSLEYNEYIVYNVD  626 (643)
T ss_pred             EEEEEEEecCCcchhccCccccccCCCCceeEEeccCCCCCcccceecCCCeEeeCCccccCCCCCCccccCceEEechh
Confidence            389999999998876666554 5689999999542    1                        1246899999999999


Q ss_pred             ccceeEEEEeee
Q psy8899          52 QMCISYLAKNLY   63 (73)
Q Consensus        52 qi~P~yLI~Y~~   63 (73)
                      ||+..||+.-+.
T Consensus       627 Qvr~rYLv~vkf  638 (643)
T PLN03124        627 QIRMRYVLQVKF  638 (643)
T ss_pred             HeEEEEEEEEEE
Confidence            999999986543


No 6  
>PLN03123 poly [ADP-ribose] polymerase; Provisional
Probab=99.04  E-value=2.5e-10  Score=97.58  Aligned_cols=61  Identities=28%  Similarity=0.462  Sum_probs=51.8

Q ss_pred             eEEeeeecCCeeeEeecccccCCCCCCceeeec----cC------------------------CCCCCcceEEEeeCccc
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGR----PS------------------------SGGLYFPEYVVYRGEQM   53 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~----p~------------------------~ggLnY~E~VVY~~eqi   53 (73)
                      ||||.|+||+++..+++..++.||.|||||.|.    |.                        .+.|.|.|||||+..|+
T Consensus       888 llLceVaLG~~~e~~~~~~~~~~p~g~~S~~g~G~~~Pd~~~~~~~~dgv~vP~Gk~~~~~~~~~~L~yNEYIVYd~~Qv  967 (981)
T PLN03123        888 MLLSEVALGEIYELKKAKYMDKPPRGKHSTKGLGKTVPQESEFVKWRDDVVVPCGKPVPSKVKASELMYNEYIVYNTAQV  967 (981)
T ss_pred             EEEEEEecCChhhhccccccccCCCCceeeeecCCCCCCcccceecCCceEeeCCCCccCcccCCccccCceEEechhHE
Confidence            899999999998777777788999999999554    21                        23589999999999999


Q ss_pred             ceeEEEEee
Q psy8899          54 CISYLAKNL   62 (73)
Q Consensus        54 ~P~yLI~Y~   62 (73)
                      +-.||+.-+
T Consensus       968 r~rYLv~vk  976 (981)
T PLN03123        968 KLQFLLKVR  976 (981)
T ss_pred             EEEEEEEEE
Confidence            999999654


No 7  
>cd01341 ADP_ribosyl ADP_ribosylating enzymes catalyze the transfer of ADP_ribose from NAD+ to substrates. Bacterial toxins are cytoplasmic and catalyze the transfer of a single ADP_ribose unit to eukaryotic elongation factor 2, halting protein synthesis and killing the cell. Poly(ADP-ribose) polymerases (PARPS 1-3, VPARP, tankyrase) catalyze the addition of up to 100 ADP_ribose units from NAD+. PARPs 1 and 2 are localized in the nucleaus, bind DNA, and are activated  by DNA damage. VPARP is part of the vault ribonucleoprotein complex. Tankyrases regulates telomere length in part through poy(ADP_ribosylation) of telomere repeat binding factor 1 (TRF1). Poly(ADP-ribose) polymerase catalyses the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA. Poly(ADP-ribose) polymerase is a regulatory component induced by DNA damage. The carboxyl-terminal region is the most highly conserved region o
Probab=98.69  E-value=2.3e-08  Score=67.22  Aligned_cols=54  Identities=19%  Similarity=0.171  Sum_probs=39.0

Q ss_pred             EeeeecCCeeeEeec-ccccCCCCCCceeeeccC---CCCCCcceEEEeeC-cccceeE
Q psy8899           4 LGTANHSKSFLQFNA-IKMAHAPPGHHSVMGRPS---SGGLYFPEYVVYRG-EQMCISY   57 (73)
Q Consensus         4 lcrV~vGr~~~~~~~-~~~~~pPpGyhSViG~p~---~ggLnY~E~VVY~~-eqi~P~y   57 (73)
                      +|.|..|+....+.. ..+..+|+|+|||.|..+   ...+++.|+|||+. +|++|+|
T Consensus        79 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~e~VV~~~~~Qv~~~Y  137 (137)
T cd01341          79 LGVMSGATEESSRVLFPRNFRGATGAEVVDLLVAMCRDALLLPREYIIFEPYSQVSIRY  137 (137)
T ss_pred             EEEeccccccccccccccccCCCCCCeEEEcccccccchhhCCCeEEEecchhhceecC
Confidence            344444444322222 345567999999999975   46799999999999 9999997


No 8  
>PLN03122 Poly [ADP-ribose] polymerase; Provisional
Probab=98.33  E-value=2.8e-07  Score=77.99  Aligned_cols=62  Identities=24%  Similarity=0.363  Sum_probs=47.0

Q ss_pred             eEEeeeecCCe-eeEeecc-cccCCCCCCcee--eec--cC------------------------CCCCCcceEEEeeCc
Q psy8899           2 FVLGTANHSKS-FLQFNAI-KMAHAPPGHHSV--MGR--PS------------------------SGGLYFPEYVVYRGE   51 (73)
Q Consensus         2 ~llcrV~vGr~-~~~~~~~-~~~~pPpGyhSV--iG~--p~------------------------~ggLnY~E~VVY~~e   51 (73)
                      ||||-|+||++ ...+++. .....|.|.||+  +|+  |.                        .+.|.|.||||||-.
T Consensus       713 LlLcEVALG~~~~el~~~~~~~~~~~~g~~Stkg~G~~~Pdp~~~~~~~dgV~VP~Gk~~~~~~~~~~L~yNEYIVYDva  792 (815)
T PLN03122        713 LVLAVASLGDEVLELTKPPEDVKSYEEKKVGVKGLGRKKTDESEHFKWRDDITVPCGRLIPSEHKDSPLEYNEYAVYDPK  792 (815)
T ss_pred             EEEEHhhcCchHHHhhcCchhhhccCCCCceeeecCCCcCCCccceecCCCeEEeCCCCccCCCCCcccccCceEEEchh
Confidence            79999999998 4444443 455678899998  333  31                        235999999999999


Q ss_pred             ccceeEEEEeee
Q psy8899          52 QMCISYLAKNLY   63 (73)
Q Consensus        52 qi~P~yLI~Y~~   63 (73)
                      ||+-.||+.=+.
T Consensus       793 QvrirYL~~vkf  804 (815)
T PLN03122        793 QVSIRFLVGVKY  804 (815)
T ss_pred             HEEEEEEEEEEe
Confidence            999999986443


No 9  
>KOG4177|consensus
Probab=95.61  E-value=0.0033  Score=55.63  Aligned_cols=42  Identities=29%  Similarity=0.400  Sum_probs=37.0

Q ss_pred             eEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEee
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYR   49 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~   49 (73)
                      +++|+|.+++++.+++.+++ ++  |+||++++|+.+   ++|.++|+
T Consensus      1102 l~~~~~~~~~~~l~~~~~~~-~~--g~~~~~~~~~~~---~~~~~~~~ 1143 (1143)
T KOG4177|consen 1102 LSFCFVPFLENRLAFSVKKR-HA--GRISFMAEPKSK---IPQHVICH 1143 (1143)
T ss_pred             eEEeeehhhhhhhHHHHHhh-cC--Ccceeecccccc---CCccccCC
Confidence            57899999999999999988 44  999999999886   88888874


No 10 
>KOG1037|consensus
Probab=94.84  E-value=0.0045  Score=50.49  Aligned_cols=60  Identities=32%  Similarity=0.479  Sum_probs=46.3

Q ss_pred             CeEEeeeecCCeeeEeec-ccccCCCCCCceee-----------------------ec------c-CCCCCCcceEEEee
Q psy8899           1 MFVLGTANHSKSFLQFNA-IKMAHAPPGHHSVM-----------------------GR------P-SSGGLYFPEYVVYR   49 (73)
Q Consensus         1 ~~llcrV~vGr~~~~~~~-~~~~~pPpGyhSVi-----------------------G~------p-~~ggLnY~E~VVY~   49 (73)
                      ++|+|-|++|+.....++ ..++..|+|+|||.                       |.      + +.+.+.|+|++||+
T Consensus       428 ~ll~~~~alg~~~~~~~~~~~~~~~~~~~~sv~~~g~~~p~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~l~y~e~~v~~  507 (531)
T KOG1037|consen  428 HLLLCDVALGKEQDLVESIPSLTELPAGKDSVKGVGKTAPDSTLSEDLEDDVDVPLGKIKLTEEPHKDSLLEYNEYIVYN  507 (531)
T ss_pred             hhhhhhhhccchhhhhcCCcccccCCCCCcchhhhcccCCCchhhcccccccccccccccccccccchhhhhhhhhhhcc
Confidence            478999999999876544 45666899999974                       21      1 22357899999999


Q ss_pred             CcccceeEEEE
Q psy8899          50 GEQMCISYLAK   60 (73)
Q Consensus        50 ~eqi~P~yLI~   60 (73)
                      .+|+-=.|++.
T Consensus       508 ~~q~~~~~~~k  518 (531)
T KOG1037|consen  508 VEQVQIRYLVK  518 (531)
T ss_pred             HhhhceeeeeE
Confidence            99998888764


No 11 
>PF04962 KduI:  KduI/IolB family;  InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB).  KduI is involved in pectin degradation by free-living soil bacteria that use pectin as a carbon source, breaking it down to 2-keto-3-deoxygluconate, which can ultimately be converted to pyruvate. KduI catalyses the fourth step in pectin degradation, namely the interconversion of 5-keto-4-deoxyuronate and 2,5-diketo-3-dexoygluconate []. KduI has a TIM-barrel fold [].  IolB is one of several bacterial proteins encoded by the inositol operon (iolABCDEFGHIJ) in Bacillus subtilis that are involved in myo-inositol catabolism. The enzyme is responsible for isomerization of 5-deoxy-D-glucuronic acid by IolB to produce 2-deoxy-5-keto-D-gluconic acid []. IolBs possess a cupin-like structure.; GO: 0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses, 0008152 metabolic process; PDB: 1YWK_B 2QJV_B 1X8M_A 1XRU_A.
Probab=32.85  E-value=16  Score=27.36  Aligned_cols=14  Identities=36%  Similarity=0.691  Sum_probs=10.7

Q ss_pred             CCCCCCceeeeccC
Q psy8899          23 HAPPGHHSVMGRPS   36 (73)
Q Consensus        23 ~pPpGyhSViG~p~   36 (73)
                      --|+||||++.-|+
T Consensus       221 ~iP~gyHp~~aapG  234 (261)
T PF04962_consen  221 LIPSGYHPVVAAPG  234 (261)
T ss_dssp             EESTTB-SEEEEEE
T ss_pred             EeCCCCCCcCcCCC
Confidence            36999999988874


No 12 
>PF15179 Myc_target_1:  Myc target protein 1
Probab=31.32  E-value=11  Score=28.18  Aligned_cols=11  Identities=27%  Similarity=0.625  Sum_probs=9.3

Q ss_pred             CCCCCCceeee
Q psy8899          23 HAPPGHHSVMG   33 (73)
Q Consensus        23 ~pPpGyhSViG   33 (73)
                      .|||.|+|||-
T Consensus       180 tPPPAYeSIIk  190 (197)
T PF15179_consen  180 TPPPAYESIIK  190 (197)
T ss_pred             CCCchHHHHHH
Confidence            48999999973


No 13 
>PRK03459 rnpA ribonuclease P; Reviewed
Probab=27.77  E-value=26  Score=23.39  Aligned_cols=22  Identities=27%  Similarity=0.359  Sum_probs=17.5

Q ss_pred             CCCCCcee-eeccCCCCCCcceE
Q psy8899          24 APPGHHSV-MGRPSSGGLYFPEY   45 (73)
Q Consensus        24 pPpGyhSV-iG~p~~ggLnY~E~   45 (73)
                      -|+|+|=| +++|+....+|.|+
T Consensus        82 l~~g~D~Viiar~~~~~~~~~~l  104 (122)
T PRK03459         82 VPETHHVVIRALPGAATASSAEL  104 (122)
T ss_pred             cCCCcEEEEEECcccccCCHHHH
Confidence            57899999 68888777888764


No 14 
>cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT. Lysophospholipid acyltransferase (LPLAT) superfamily member: glycerol-3-phosphate 1-acyltransferase (GPAT, PlsB). LPLATs are acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. This subgroup includes glycerol-3-phosphate 1-acyltransferase (GPAT, PlsB).
Probab=27.00  E-value=43  Score=25.20  Aligned_cols=17  Identities=12%  Similarity=-0.099  Sum_probs=15.3

Q ss_pred             cceeEEEEeeecCCccc
Q psy8899          53 MCISYLAKNLYLRLDKA   69 (73)
Q Consensus        53 i~P~yLI~Y~~~~~~~~   69 (73)
                      +||-+|.+|++++|..+
T Consensus       161 i~Plai~~ydi~Ppp~~  177 (235)
T cd07985         161 LYPMALLTYDIMPPPKQ  177 (235)
T ss_pred             EEeeEEEeecccCCCcc
Confidence            89999999999999654


No 15 
>PF01221 Dynein_light:  Dynein light chain type 1 ;  InterPro: IPR001372 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits (see IPR004273 from INTERPRO), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [, ]. Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [, ].; GO: 0007017 microtubule-based process, 0005875 microtubule associated complex; PDB: 1F95_A 1F96_A 1F3C_A 3P8M_B 2XQQ_C 1RE6_A 1CMI_A 1PWK_A 1PWJ_A 4DS1_C ....
Probab=21.83  E-value=41  Score=20.75  Aligned_cols=11  Identities=27%  Similarity=0.746  Sum_probs=8.3

Q ss_pred             CCCCceeeecc
Q psy8899          25 PPGHHSVMGRP   35 (73)
Q Consensus        25 PpGyhSViG~p   35 (73)
                      .++||+|+|+-
T Consensus        51 G~~Wh~IVG~~   61 (89)
T PF01221_consen   51 GPTWHCIVGKS   61 (89)
T ss_dssp             SS-EEEEEESE
T ss_pred             CCceEEEECCc
Confidence            46899999984


No 16 
>COG1159 Era GTPase [General function prediction only]
Probab=21.54  E-value=39  Score=26.47  Aligned_cols=14  Identities=36%  Similarity=0.854  Sum_probs=11.6

Q ss_pred             CCCceeeeccCCCC
Q psy8899          26 PGHHSVMGRPSSGG   39 (73)
Q Consensus        26 pGyhSViG~p~~gg   39 (73)
                      .||=+++|+|++|-
T Consensus         6 sGfVaIiGrPNvGK   19 (298)
T COG1159           6 SGFVAIIGRPNVGK   19 (298)
T ss_pred             EEEEEEEcCCCCcH
Confidence            47888899999975


No 17 
>PF00850 Hist_deacetyl:  Histone deacetylase domain;  InterPro: IPR023801 Regulation of transcription is, in part, modulated by reversible histone acetylation on several lysine. Histone deacetylases (HDA) catalyse the removal of the acetyl group. Histone deacetylases, acetoin utilization proteins and acetylpolyamine amidohydrolases are all members of this ancient protein superfamily []. HDAs function in multi-subunit complexes, reversing the acetylation of histones by histone acetyltransferases [, ], and are also believed to deacetylate general transcription factors such as TFIIF and sequence-specific transcription factors such as p53 []. Thus, HDAs contribute to the regulation of transcription, in particular transcriptional repression []. At N-terminal tails of histones, removal of the acetyl group from the epsilon-amino group of a lysine side chain will restore its positivecharge, which may stabilise the histone-DNA interaction and prevent activating transcription factors binding to promoter elements []. HDAs play important roles in the cell cycle and differentiation, and their deregulation can contribute to the development of cancer [, ]. This entry represents the structural domain found in histone deacetylases. It consists of a 3-layer(alpha-beta-alpha) sandwich.; PDB: 4A69_A 2VQV_A 2VQO_A 2VQJ_A 2VQQ_B 2VQM_A 2VQW_G 3MAX_C 3MEN_D 1T64_B ....
Probab=21.54  E-value=47  Score=24.87  Aligned_cols=16  Identities=44%  Similarity=0.858  Sum_probs=7.5

Q ss_pred             CCCCCceeeeccCCCCCC
Q psy8899          24 APPGHHSVMGRPSSGGLY   41 (73)
Q Consensus        24 pPpGyhSViG~p~~ggLn   41 (73)
                      .|||||.--.+  ++|..
T Consensus       119 rppgHHA~~~~--a~GFC  134 (311)
T PF00850_consen  119 RPPGHHAERDR--AMGFC  134 (311)
T ss_dssp             SS--TT-BTTB--BBTTB
T ss_pred             CccccccCcCc--Cccee
Confidence            89999994333  34544


No 18 
>PTZ00059 dynein light chain; Provisional
Probab=21.39  E-value=33  Score=21.69  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=9.2

Q ss_pred             CCCCceeeecc
Q psy8899          25 PPGHHSVMGRP   35 (73)
Q Consensus        25 PpGyhSViG~p   35 (73)
                      -|.||+|+|+-
T Consensus        52 g~~WhciVG~~   62 (90)
T PTZ00059         52 NPTWHCIVGRN   62 (90)
T ss_pred             CCCCEEEEecC
Confidence            46899999994


No 19 
>KOG3430|consensus
Probab=20.32  E-value=42  Score=22.33  Aligned_cols=18  Identities=22%  Similarity=0.375  Sum_probs=12.0

Q ss_pred             CCCceeeeccCCCCCCcc
Q psy8899          26 PGHHSVMGRPSSGGLYFP   43 (73)
Q Consensus        26 pGyhSViG~p~~ggLnY~   43 (73)
                      +|||+|+|+-=++-++|.
T Consensus        53 ~~WhcivG~~FGs~vThe   70 (90)
T KOG3430|consen   53 PTWHCIVGRNFGSYVTHE   70 (90)
T ss_pred             CccEEEEcCCcceEEEee
Confidence            689999999433334443


Done!