Diaphorina citri psyllid: psy8956

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---

MKSKGKILEASWDEGISDDEGARSNKENNKVYKENELHVNNLEPSVDNQALINEFKKFGTLRDVRVARNKNDESRGFAIIVFNTPAEAKKARVEMNGHLIGSKPVIITFVELKPGQRSKPVGPEEKQYKKDKVFVKNLVETVDEEELKSHFIKFGNIIEVKIVRDENGKSKGFGFIQFFSYKAAEKAIIEMNGRMIQHNSTFVSLAEIVPGKKVFPKVKPPLLQPARKNKIFVANLPSNINNSEFEELFARFGTITSSSLVSDKHIGFIEFIMPKHATHAVSTMNGHVFKSKPLKVTLSGTKPGVSITNPTKAPKKPAYIDEVKNVIGIKVQY

cccccCEEEEEccccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccccccCEEEEEECcccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEccccccccCEEEEEccHHHHHHHHHHHcccEEccEEEEEEcccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccCEEEEcccHHHHHHHHHHHccCECccCEEEEEEccccccccccccccccccccccccccccccccccc

***KGKILEAS*************************LHVNNLEPSVDNQALINEFKKFGTLRDVRVARNKNDESRGFAIIVFNTPAEAKKARVEMNGHLIGSKPVIITFVEL******************DKVFVKNLVETVDEEELKSHFIKFGNIIEVKIVRDENGKSKGFGFIQFFSYKAAEKAIIEMNGRMIQHNSTFVSLAEIVPGKKVFPKVKPPLLQPARKNKIFVANLPSNINNSEFEELFARFGTITSSSLVSDKHIGFIEFIMPKHATHAVSTMNGHVFKSKPLKV**********************YIDEVKNVIGI****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0061013 [BP]	regulation of mRNA catabolic process	probable	GO:0009894, GO:0080090, GO:0031329, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0019222, GO:0050789
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0008143 [MF]	poly(A) RNA binding	probable	GO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0010494 [CC]	cytoplasmic stress granule	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0008266 [MF]	poly(U) RNA binding	probable	GO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0017091 [MF]	AU-rich element binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0031330 [BP]	negative regulation of cellular catabolic process	probable	GO:0009894, GO:0009895, GO:0009892, GO:0019222, GO:0031329, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0051253 [BP]	negative regulation of RNA metabolic process	probable	GO:0051252, GO:0010605, GO:0045934, GO:0019222, GO:0060255, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0019219, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0009892, GO:0050789, GO:0048523, GO:0080090
GO:0050684 [BP]	regulation of mRNA processing	probable	GO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 34-209
View the alignment between query and template
View the model in PyMOL

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 130-212,224-304
View the alignment between query and template
View the model in PyMOL

Template: 4F25, chain A
Confidence level:very confident
Coverage over the Query: 228-304
View the alignment between query and template
View the model in PyMOL

Template: 2ADC, chain A
Confidence level:very confident
Coverage over the Query: 31-131,151-169,213-302
View the alignment between query and template
View the model in PyMOL

Template: 1QM9, chain A
Confidence level:very confident
Coverage over the Query: 2-111
View the alignment between query and template
View the model in PyMOL