Query         psy8966
Match_columns 175
No_of_seqs    119 out of 1119
Neff          10.8
Searched_HMMs 46136
Date          Sat Aug 17 00:15:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8966.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8966hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.4E-28 5.3E-33  167.2   5.8  123   10-168   129-254 (279)
  2 KOG2462|consensus               99.9   9E-23   2E-27  140.0   6.6  107    9-151   159-265 (279)
  3 KOG3608|consensus               99.8 4.2E-20 9.1E-25  130.7   6.2  160    7-171   172-366 (467)
  4 KOG1074|consensus               99.8 1.1E-19 2.4E-24  140.5   3.3   71   96-170   604-681 (958)
  5 KOG3608|consensus               99.8 9.6E-19 2.1E-23  123.9   5.3  123   41-168   177-332 (467)
  6 KOG3576|consensus               99.7 2.5E-17 5.4E-22  108.6   2.6   97   39-167   115-222 (267)
  7 KOG1074|consensus               99.6   9E-17   2E-21  124.7   2.6   61   99-163   881-941 (958)
  8 KOG3623|consensus               99.6 1.4E-15   3E-20  116.8   3.5   97   42-168   211-320 (1007)
  9 KOG3576|consensus               99.5 2.5E-15 5.4E-20   99.2   2.1  115    9-157   115-240 (267)
 10 KOG3623|consensus               99.5 5.1E-15 1.1E-19  113.7   2.6  119   12-151   211-331 (1007)
 11 PHA00733 hypothetical protein   99.0 3.2E-10 6.8E-15   71.9   4.5  101   25-154    24-124 (128)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.3E-10   5E-15   51.8   1.4   25  144-168     1-25  (26)
 13 PLN03086 PRLI-interacting fact  99.0 5.6E-10 1.2E-14   86.0   4.1  136   13-170   409-554 (567)
 14 PHA02768 hypothetical protein;  98.9 6.7E-10 1.4E-14   58.6   1.5   42   98-145     6-47  (55)
 15 PHA02768 hypothetical protein;  98.9 7.7E-10 1.7E-14   58.4   1.7   38  127-168     5-42  (55)
 16 PLN03086 PRLI-interacting fact  98.8 2.5E-08 5.5E-13   77.1   7.6  101   42-153   454-564 (567)
 17 PHA00616 hypothetical protein   98.8 6.4E-09 1.4E-13   52.3   2.3   35  127-163     1-35  (44)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.7 2.9E-09 6.3E-14   48.2   0.7   26  114-141     1-26  (26)
 19 PHA00733 hypothetical protein   98.7 2.3E-08 5.1E-13   63.4   4.4   84    7-124    36-124 (128)
 20 KOG3993|consensus               98.6 2.5E-08 5.4E-13   73.2   2.8  106   12-123   268-380 (500)
 21 PHA00616 hypothetical protein   98.4 1.5E-07 3.2E-12   47.4   1.7   32   97-130     1-32  (44)
 22 PHA00732 hypothetical protein   98.1   1E-06 2.2E-11   50.9   1.4   47   97-153     1-48  (79)
 23 PHA00732 hypothetical protein   98.1 1.5E-06 3.3E-11   50.2   1.7   38  127-169     1-39  (79)
 24 KOG3993|consensus               98.1 1.1E-06 2.4E-11   64.8   1.0   81   42-154   268-381 (500)
 25 COG5189 SFP1 Putative transcri  98.0 1.6E-06 3.5E-11   61.7   0.9   54   95-150   347-419 (423)
 26 PF05605 zf-Di19:  Drought indu  98.0 2.1E-05 4.5E-10   42.2   4.6   51   97-154     2-54  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.0 2.4E-06 5.2E-11   37.3   0.5   22  128-151     1-22  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  97.6 5.7E-05 1.2E-09   32.8   2.3   22   42-65      1-22  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.6 2.6E-05 5.6E-10   34.1   1.0   23  128-152     1-23  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.6 1.8E-05 3.9E-10   35.9   0.1   23  128-152     2-24  (27)
 31 smart00355 ZnF_C2H2 zinc finge  97.2 0.00027 5.8E-09   31.3   2.0   24  128-153     1-24  (26)
 32 PF05605 zf-Di19:  Drought indu  97.2 0.00084 1.8E-08   35.9   4.2   50   11-67      2-53  (54)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.2 0.00046   1E-08   29.9   2.5   23   42-66      1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.2 0.00035 7.5E-09   31.5   1.9   24   42-67      2-25  (27)
 35 COG5189 SFP1 Putative transcri  97.2 0.00022 4.8E-09   51.2   1.8   72   39-120   347-419 (423)
 36 PF09237 GAGA:  GAGA factor;  I  97.1 0.00031 6.8E-09   36.3   1.6   31  125-157    22-52  (54)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.0  0.0008 1.7E-08   40.6   3.1   24   97-122    50-73  (100)
 38 PRK04860 hypothetical protein;  96.9  0.0005 1.1E-08   45.3   1.5   35  127-167   119-153 (160)
 39 PF12756 zf-C2H2_2:  C2H2 type   96.5  0.0011 2.4E-08   40.0   1.0   47  104-152     4-73  (100)
 40 PF13909 zf-H2C2_5:  C2H2-type   96.5  0.0011 2.4E-08   29.0   0.6   19  133-152     4-22  (24)
 41 PF12874 zf-met:  Zinc-finger o  96.5  0.0007 1.5E-08   29.9  -0.0   22  128-151     1-22  (25)
 42 PF09237 GAGA:  GAGA factor;  I  96.4  0.0059 1.3E-07   31.6   3.0   33   93-127    20-52  (54)
 43 PF12874 zf-met:  Zinc-finger o  96.2  0.0044 9.6E-08   27.2   1.9   23   42-66      1-23  (25)
 44 smart00355 ZnF_C2H2 zinc finge  96.1  0.0071 1.5E-07   26.4   2.5   17   49-65      6-22  (26)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.0   0.009 1.9E-07   25.9   2.4   23   42-67      1-23  (24)
 46 PRK04860 hypothetical protein;  95.9  0.0037   8E-08   41.3   1.2   40   96-143   118-157 (160)
 47 COG5048 FOG: Zn-finger [Genera  95.2  0.0041   9E-08   47.4  -0.5  151   11-165   289-454 (467)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  95.0  0.0019 4.2E-08   29.1  -1.7   18  133-150     5-22  (27)
 49 KOG4173|consensus               94.8   0.015 3.2E-07   39.5   1.4   91   11-122    79-170 (253)
 50 PF12171 zf-C2H2_jaz:  Zinc-fin  94.3   0.015 3.1E-07   26.1   0.3   22   42-65      2-23  (27)
 51 cd00350 rubredoxin_like Rubred  94.1   0.014   3E-07   27.7  -0.0   24  128-165     2-25  (33)
 52 KOG1146|consensus               92.9   0.034 7.5E-07   47.6   0.4  140   18-165   441-626 (1406)
 53 COG5236 Uncharacterized conser  92.2    0.07 1.5E-06   39.3   1.1  105   41-150   151-272 (493)
 54 PF13913 zf-C2HC_2:  zinc-finge  92.1   0.079 1.7E-06   23.3   0.9   17  133-150     6-22  (25)
 55 smart00451 ZnF_U1 U1-like zinc  91.6    0.21 4.7E-06   23.6   2.2   23   41-65      3-25  (35)
 56 smart00451 ZnF_U1 U1-like zinc  91.5   0.096 2.1E-06   24.8   0.9   22  127-150     3-24  (35)
 57 COG5236 Uncharacterized conser  90.6       1 2.2E-05   33.5   5.6   74   48-121   225-303 (493)
 58 cd00729 rubredoxin_SM Rubredox  90.2   0.095 2.1E-06   25.0   0.2   25  127-165     2-26  (34)
 59 COG1592 Rubrerythrin [Energy p  90.2    0.12 2.6E-06   34.3   0.7   24  126-164   133-156 (166)
 60 PF09538 FYDLN_acid:  Protein o  89.8    0.17 3.6E-06   31.2   1.1   14  154-167    23-36  (108)
 61 COG5048 FOG: Zn-finger [Genera  89.1   0.058 1.3E-06   41.1  -1.7   63   97-163   289-357 (467)
 62 COG2888 Predicted Zn-ribbon RN  88.6    0.23 5.1E-06   26.7   0.9   32  127-165    27-58  (61)
 63 KOG2893|consensus               88.1    0.16 3.5E-06   35.5   0.2   40  103-148    14-53  (341)
 64 KOG2893|consensus               87.6    0.19 4.1E-06   35.2   0.3   50    9-67      9-59  (341)
 65 PF10571 UPF0547:  Uncharacteri  86.7    0.22 4.8E-06   22.1   0.1    9  159-167    16-24  (26)
 66 smart00659 RPOLCX RNA polymera  85.6    0.23 4.9E-06   25.2  -0.1   11  156-166    18-28  (44)
 67 PRK14890 putative Zn-ribbon RN  84.7    0.28   6E-06   26.4  -0.1   10  156-165    47-56  (59)
 68 COG4049 Uncharacterized protei  84.1    0.82 1.8E-05   24.2   1.5   25    8-34     14-38  (65)
 69 TIGR02300 FYDLN_acid conserved  83.4    0.54 1.2E-05   29.6   0.8   13  126-140    25-37  (129)
 70 TIGR00373 conserved hypothetic  82.9    0.96 2.1E-05   30.0   1.9   30  125-165   107-136 (158)
 71 PHA00626 hypothetical protein   82.3    0.18 3.9E-06   26.7  -1.3   13  126-140    22-34  (59)
 72 KOG1146|consensus               81.7    0.95 2.1E-05   39.5   1.8   56   92-151   460-540 (1406)
 73 smart00834 CxxC_CXXC_SSSS Puta  80.9    0.44 9.6E-06   23.4  -0.2   10  156-165    25-34  (41)
 74 COG4049 Uncharacterized protei  80.8     1.5 3.2E-05   23.3   1.7   25  124-150    14-38  (65)
 75 PRK06266 transcription initiat  80.1     1.1 2.4E-05   30.3   1.4   29  126-165   116-144 (178)
 76 PF07754 DUF1610:  Domain of un  80.1    0.69 1.5E-05   20.1   0.3    9  156-164    15-23  (24)
 77 PF09723 Zn-ribbon_8:  Zinc rib  78.9    0.41 8.8E-06   24.0  -0.7   29  128-165     6-34  (42)
 78 smart00531 TFIIE Transcription  78.4     1.1 2.4E-05   29.3   1.0   36  125-166    97-132 (147)
 79 COG1996 RPC10 DNA-directed RNA  77.9    0.55 1.2E-05   24.4  -0.4   28  127-166     6-33  (49)
 80 PF03604 DNA_RNApol_7kD:  DNA d  77.8    0.67 1.5E-05   21.7  -0.1   12  156-167    16-27  (32)
 81 KOG4173|consensus               77.0     1.7 3.7E-05   29.9   1.6   80   42-152    80-170 (253)
 82 TIGR02605 CxxC_CxxC_SSSS putat  76.5     0.4 8.7E-06   25.1  -1.2   11  128-140     6-16  (52)
 83 PF07975 C1_4:  TFIIH C1-like d  75.3    0.42   9E-06   25.1  -1.3   32  125-164    19-50  (51)
 84 COG4530 Uncharacterized protei  75.1     1.1 2.4E-05   27.4   0.3   12  156-167    25-36  (129)
 85 KOG2231|consensus               74.7     8.5 0.00018   31.6   5.1   43   21-65    122-171 (669)
 86 PRK00398 rpoP DNA-directed RNA  74.6    0.82 1.8E-05   23.3  -0.3    9  157-165    21-29  (46)
 87 TIGR00622 ssl1 transcription f  71.1     7.8 0.00017   24.1   3.3   54   99-164    57-110 (112)
 88 PF15269 zf-C2H2_7:  Zinc-finge  69.2     4.5 9.7E-05   20.4   1.6   27   96-122    17-43  (54)
 89 TIGR02098 MJ0042_CXXC MJ0042 f  68.8     1.2 2.6E-05   21.5  -0.5    8  158-165    26-33  (38)
 90 PF08209 Sgf11:  Sgf11 (transcr  68.4     1.5 3.2E-05   20.7  -0.2   17  156-172     3-19  (33)
 91 KOG4124|consensus               66.1       1 2.2E-05   33.5  -1.4   53   95-149   347-418 (442)
 92 smart00614 ZnF_BED BED zinc fi  66.0     3.1 6.8E-05   21.5   0.8   17  104-120    23-44  (50)
 93 PF12013 DUF3505:  Protein of u  64.4       4 8.6E-05   25.1   1.2   19  104-122    89-107 (109)
 94 PF12013 DUF3505:  Protein of u  63.8     7.6 0.00016   23.8   2.3   25   42-68     81-109 (109)
 95 KOG2482|consensus               62.9      31 0.00066   26.1   5.5  103   42-151   196-356 (423)
 96 PF05443 ROS_MUCR:  ROS/MUCR tr  61.8     3.7 7.9E-05   26.3   0.7   24   98-126    73-96  (132)
 97 PRK09678 DNA-binding transcrip  60.2     1.5 3.2E-05   24.9  -1.2   18  125-142    25-42  (72)
 98 KOG4377|consensus               57.4      10 0.00023   29.1   2.4   29    9-37    269-297 (480)
 99 KOG3408|consensus               56.5     8.3 0.00018   24.2   1.5   27   93-121    53-79  (129)
100 PF02176 zf-TRAF:  TRAF-type zi  55.0     3.8 8.3E-05   21.9  -0.1   17  114-130    25-41  (60)
101 PF02892 zf-BED:  BED zinc fing  54.6     7.3 0.00016   19.4   1.0   17  133-149    20-40  (45)
102 smart00734 ZnF_Rad18 Rad18-lik  54.6     8.6 0.00019   16.9   1.1   19  129-150     3-21  (26)
103 COG2331 Uncharacterized protei  54.3     8.7 0.00019   21.9   1.2    6  159-164    35-40  (82)
104 COG4957 Predicted transcriptio  54.0     7.3 0.00016   24.9   1.0   20  104-126    81-100 (148)
105 PF14446 Prok-RING_1:  Prokaryo  52.7     5.9 0.00013   21.0   0.4    8  133-140     9-16  (54)
106 PF12907 zf-met2:  Zinc-binding  52.3      11 0.00023   18.7   1.2   26  128-155     2-30  (40)
107 KOG2593|consensus               51.8      14 0.00029   28.7   2.3   36  124-164   125-160 (436)
108 PF13719 zinc_ribbon_5:  zinc-r  51.2      14  0.0003   17.7   1.6   33   13-54      4-36  (37)
109 KOG4167|consensus               50.9     7.7 0.00017   32.1   1.0   25  128-154   793-817 (907)
110 PF13824 zf-Mss51:  Zinc-finger  50.5     8.3 0.00018   20.6   0.8   17  124-142    11-27  (55)
111 PF09986 DUF2225:  Uncharacteri  49.3     2.2 4.7E-05   29.9  -2.0   16   96-113     4-19  (214)
112 KOG2231|consensus               48.9      32  0.0007   28.5   4.1  102   51-164   122-245 (669)
113 PF05290 Baculo_IE-1:  Baculovi  47.5      20 0.00043   23.0   2.2   62   89-171    72-135 (140)
114 PHA03082 DNA-dependent RNA pol  47.3     2.8 6.1E-05   22.3  -1.3   20  156-175     3-22  (63)
115 PF05864 Chordopox_RPO7:  Chord  46.8     2.8 6.2E-05   22.3  -1.3   20  156-175     3-22  (63)
116 PF13717 zinc_ribbon_4:  zinc-r  46.3      19 0.00041   17.2   1.6   32   13-53      4-35  (36)
117 PF08274 PhnA_Zn_Ribbon:  PhnA   45.9     6.8 0.00015   18.0  -0.0    8  157-164    19-26  (30)
118 KOG2186|consensus               44.8      19 0.00041   25.9   2.0   46   12-64      4-49  (276)
119 PF05191 ADK_lid:  Adenylate ki  43.1     6.7 0.00015   18.9  -0.3   12  154-165    18-29  (36)
120 COG1997 RPL43A Ribosomal prote  41.8      11 0.00023   22.2   0.4   13  126-140    52-64  (89)
121 PF07295 DUF1451:  Protein of u  40.7       5 0.00011   26.2  -1.2   37  121-169   102-142 (146)
122 KOG4167|consensus               40.6      11 0.00024   31.3   0.4   24   11-36    792-815 (907)
123 TIGR03831 YgiT_finger YgiT-typ  40.5      12 0.00025   18.6   0.4   12  158-169    33-44  (46)
124 KOG3408|consensus               40.5      19 0.00042   22.6   1.4   23  127-151    57-79  (129)
125 COG3357 Predicted transcriptio  40.1      11 0.00024   22.3   0.2   14  156-169    57-70  (97)
126 PF14311 DUF4379:  Domain of un  38.5      13 0.00028   19.6   0.4   13  128-142    29-41  (55)
127 KOG2807|consensus               37.7      34 0.00075   25.6   2.5   59   96-164   289-374 (378)
128 COG1675 TFA1 Transcription ini  37.2      30 0.00066   23.4   2.0   29  125-164   111-139 (176)
129 KOG1280|consensus               36.7      24 0.00052   26.6   1.6   21   97-119    79-99  (381)
130 PRK12380 hydrogenase nickel in  36.3      12 0.00026   23.3   0.0   11  128-140    71-81  (113)
131 KOG2907|consensus               35.8      13 0.00028   23.0   0.1   13   42-56     26-38  (116)
132 PTZ00255 60S ribosomal protein  35.0      11 0.00025   22.3  -0.2   17  156-172    53-69  (90)
133 TIGR00100 hypA hydrogenase nic  34.8      13 0.00029   23.1   0.1   11  128-140    71-81  (115)
134 PF01780 Ribosomal_L37ae:  Ribo  32.7     6.6 0.00014   23.3  -1.4   16  157-172    53-68  (90)
135 PF13878 zf-C2H2_3:  zinc-finge  32.7      51  0.0011   16.2   2.0   23   12-36     14-38  (41)
136 PF10276 zf-CHCC:  Zinc-finger   32.2      11 0.00024   18.6  -0.5   11  157-167    29-39  (40)
137 PRK00564 hypA hydrogenase nick  32.0      18 0.00039   22.6   0.3   11  128-140    72-82  (117)
138 KOG2636|consensus               31.5      30 0.00066   27.0   1.5   29  120-150   394-423 (497)
139 KOG2785|consensus               31.3      57  0.0012   25.0   2.8   52   96-151   165-242 (390)
140 PF04959 ARS2:  Arsenite-resist  31.3      15 0.00032   25.8  -0.2   25  127-153    77-101 (214)
141 PF06524 NOA36:  NOA36 protein;  30.9      11 0.00025   27.0  -0.8   27  124-152   206-232 (314)
142 PF04423 Rad50_zn_hook:  Rad50   30.5      17 0.00036   19.1   0.0   11  159-169    22-32  (54)
143 KOG2186|consensus               30.5      33 0.00071   24.7   1.4   46   98-150     4-49  (276)
144 smart00154 ZnF_AN1 AN1-like Zi  30.4      20 0.00042   17.5   0.2   11  157-167    12-22  (39)
145 PF07649 C1_3:  C1-like domain;  29.3      22 0.00048   16.0   0.3   11  156-166    14-24  (30)
146 TIGR00280 L37a ribosomal prote  29.0      15 0.00033   21.9  -0.4   17  156-172    52-68  (91)
147 PRK03824 hypA hydrogenase nick  28.7      11 0.00025   24.2  -1.0    7  158-164   108-114 (135)
148 smart00661 RPOL9 RNA polymeras  27.8      23 0.00049   18.1   0.2   12  127-140    20-31  (52)
149 PF01428 zf-AN1:  AN1-like Zinc  27.8      16 0.00036   18.1  -0.3   12  156-167    12-23  (43)
150 PF01155 HypA:  Hydrogenase exp  27.7     8.4 0.00018   23.9  -1.7   25  128-166    71-95  (113)
151 COG1571 Predicted DNA-binding   26.8      34 0.00074   26.6   1.1   14  127-142   367-380 (421)
152 PF07282 OrfB_Zn_ribbon:  Putat  26.6      23  0.0005   19.5   0.1   12  125-138    44-55  (69)
153 PRK14892 putative transcriptio  26.5      13 0.00029   22.5  -0.9   11  128-140    43-53  (99)
154 PRK03681 hypA hydrogenase nick  26.4      22 0.00049   22.1   0.0    7  158-164    88-94  (114)
155 KOG2785|consensus               25.6   1E+02  0.0022   23.8   3.2   74   41-121   166-242 (390)
156 COG5112 UFD2 U1-like Zn-finger  25.3      37 0.00079   20.8   0.8   25   94-120    52-76  (126)
157 COG3677 Transposase and inacti  25.2      33 0.00071   21.9   0.6   14  155-168    51-64  (129)
158 KOG2482|consensus               24.9      37 0.00081   25.6   0.9   51   97-151   144-217 (423)
159 PF14353 CpXC:  CpXC protein     24.2      26 0.00057   22.1   0.1   12  156-167    37-48  (128)
160 TIGR01206 lysW lysine biosynth  24.1      29 0.00063   18.4   0.2    9  158-166     3-11  (54)
161 KOG3507|consensus               23.9      27 0.00058   18.9   0.0   15  126-142    36-50  (62)
162 COG4888 Uncharacterized Zn rib  23.9      10 0.00022   22.9  -1.7   16   95-112    20-35  (104)
163 PF13451 zf-trcl:  Probable zin  23.6      36 0.00079   17.7   0.5   14   96-111     3-16  (49)
164 PF14690 zf-ISL3:  zinc-finger   22.3      40 0.00087   16.8   0.5   11  156-166     1-11  (47)
165 PF14255 Cys_rich_CPXG:  Cystei  22.0      36 0.00077   17.9   0.3    9  159-167     2-10  (52)
166 PRK00432 30S ribosomal protein  22.0      35 0.00076   17.7   0.3   12  126-139    36-47  (50)
167 PF12760 Zn_Tnp_IS1595:  Transp  21.8      25 0.00055   17.7  -0.3   10  155-164    35-44  (46)
168 PF08273 Prim_Zn_Ribbon:  Zinc-  21.7      32 0.00069   17.0   0.1    7  158-164     4-10  (40)
169 CHL00174 accD acetyl-CoA carbo  21.7      21 0.00046   26.4  -0.8   33   97-142    38-70  (296)
170 KOG0717|consensus               21.4      44 0.00096   26.4   0.8   22  128-151   293-314 (508)
171 PF01286 XPA_N:  XPA protein N-  21.3      35 0.00076   16.2   0.2   14  159-172     5-18  (34)
172 PRK03976 rpl37ae 50S ribosomal  21.1      23  0.0005   21.1  -0.6   16  156-171    53-68  (90)
173 PRK06393 rpoE DNA-directed RNA  20.6      49  0.0011   18.3   0.7   14  159-172    19-32  (64)
174 COG2879 Uncharacterized small   20.1   1E+02  0.0022   17.0   1.8   14  144-157    27-40  (65)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=2.4e-28  Score=167.18  Aligned_cols=123  Identities=38%  Similarity=0.737  Sum_probs=108.8

Q ss_pred             CCccCCCccchhhccChHHHHHHHhhhcC---CCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccc
Q psy8966          10 RPYKCPVEYCEKAFSTQYSRKAHIRTHTG---EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDF   86 (175)
Q Consensus        10 ~~~~C~~~~C~~~f~~~~~L~~h~~~~~~---~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~   86 (175)
                      ..|.|.  .||+.|...++|.+|..+|..   .+.+.|..  |++.|.+..+|..|+++|.-                  
T Consensus       129 ~r~~c~--eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~--C~K~YvSmpALkMHirTH~l------------------  186 (279)
T KOG2462|consen  129 PRYKCP--ECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKY--CGKVYVSMPALKMHIRTHTL------------------  186 (279)
T ss_pred             Cceecc--ccccccccccccchhhcccccccccccccCCC--CCceeeehHHHhhHhhccCC------------------
Confidence            358897  899999999999999999854   45699965  99999999999999999862                  


Q ss_pred             hhhhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhh
Q psy8966          87 VHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus        87 ~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                                +.+|+  .||+.|....-|+.|+++|+|||||.|  +.|+++|..+++|+.||++|.+.++|.|+.|+++
T Consensus       187 ----------~c~C~--iCGKaFSRPWLLQGHiRTHTGEKPF~C--~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~Ks  252 (279)
T KOG2462|consen  187 ----------PCECG--ICGKAFSRPWLLQGHIRTHTGEKPFSC--PHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKS  252 (279)
T ss_pred             ----------Ccccc--cccccccchHHhhcccccccCCCCccC--CcccchhcchHHHHHHHHhhcCCccccCcchhhH
Confidence                      56776  899999999999999999999999999  7799999999999999999999999999999988


Q ss_pred             hc
Q psy8966         167 CL  168 (175)
Q Consensus       167 ~~  168 (175)
                      |.
T Consensus       253 Fs  254 (279)
T KOG2462|consen  253 FA  254 (279)
T ss_pred             HH
Confidence            85


No 2  
>KOG2462|consensus
Probab=99.88  E-value=9e-23  Score=140.00  Aligned_cols=107  Identities=41%  Similarity=0.796  Sum_probs=97.3

Q ss_pred             CCCccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchh
Q psy8966           9 IRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVH   88 (175)
Q Consensus         9 ~~~~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~   88 (175)
                      .+-+.|.  .||++|.+...|+.|+++|.  .+++|..  ||+.|...=-|+.|+++|+|                    
T Consensus       159 ~ka~~C~--~C~K~YvSmpALkMHirTH~--l~c~C~i--CGKaFSRPWLLQGHiRTHTG--------------------  212 (279)
T KOG2462|consen  159 KKAFSCK--YCGKVYVSMPALKMHIRTHT--LPCECGI--CGKAFSRPWLLQGHIRTHTG--------------------  212 (279)
T ss_pred             cccccCC--CCCceeeehHHHhhHhhccC--CCccccc--ccccccchHHhhcccccccC--------------------
Confidence            5568897  99999999999999999997  5799955  99999988888888777665                    


Q ss_pred             hhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHH
Q psy8966          89 LRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus        89 ~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                            ||||.|+  .|++.|.+.++|..|+.+|.+.|+|.|  ..|+|.|..++.|..|..+
T Consensus       213 ------EKPF~C~--hC~kAFADRSNLRAHmQTHS~~K~~qC--~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  213 ------EKPFSCP--HCGKAFADRSNLRAHMQTHSDVKKHQC--PRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ------CCCccCC--cccchhcchHHHHHHHHhhcCCccccC--cchhhHHHHHHHHHHhhhh
Confidence                  8899998  899999999999999999999999999  8899999999999999865


No 3  
>KOG3608|consensus
Probab=99.81  E-value=4.2e-20  Score=130.68  Aligned_cols=160  Identities=27%  Similarity=0.457  Sum_probs=113.5

Q ss_pred             CCCCC-ccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHH---------------------
Q psy8966           7 SGIRP-YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVR---------------------   64 (175)
Q Consensus         7 ~~~~~-~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~---------------------   64 (175)
                      .+++| +.|.|..|-..+.++..|++|+++|++++...|+.  ||..|.....|..|++                     
T Consensus       172 ~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~--Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaT  249 (467)
T KOG3608|consen  172 EDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPH--CGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFAT  249 (467)
T ss_pred             CCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecch--HHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhH
Confidence            34444 55666677777777777777777776666666654  6666666666655554                     


Q ss_pred             ---------HhcCCCCCCCCCCccchhcccchhhh-hccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCccc
Q psy8966          65 ---------THTGKYTPGPGIDSRLIVREDFVHLR-IHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEF  134 (175)
Q Consensus        65 ---------~h~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~  134 (175)
                               .|..-..|--+.......+++..|++ .|...+||+|.  .|++.+...++|+.|..+|. +..|.|.++.
T Consensus       250 eklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd--~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~  326 (467)
T KOG3608|consen  250 EKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCD--ECDTRCVRESDLAKHVQVHS-KTVYQCEHPD  326 (467)
T ss_pred             HHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCcccc--chhhhhccHHHHHHHHHhcc-ccceecCCCC
Confidence                     34333323222223333334445655 46779999995  89999999999999999996 7789996666


Q ss_pred             chHHHhchhhHHHHHHHhc-C--CccccCCcchhhhcccc
Q psy8966         135 CSKSFKTSGDLQKHVRTHT-G--KYTAEVPGSILDCLSGR  171 (175)
Q Consensus       135 C~~~f~~~~~l~~H~~~h~-~--~~~~~C~~c~~~~~~~~  171 (175)
                      |.+++++...|.+|++.++ |  +.+|.|..|.+.|.+|.
T Consensus       327 C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~  366 (467)
T KOG3608|consen  327 CHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGK  366 (467)
T ss_pred             CcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccch
Confidence            9999999999999999655 4  36699999999999885


No 4  
>KOG1074|consensus
Probab=99.77  E-value=1.1e-19  Score=140.52  Aligned_cols=71  Identities=31%  Similarity=0.675  Sum_probs=64.5

Q ss_pred             cceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCC----ccccCC---cchhhhc
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGK----YTAEVP---GSILDCL  168 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~----~~~~C~---~c~~~~~  168 (175)
                      .|..|+  .|.+.....+.|+.|+++|+|++||+|  .+||.+|.++.+|+.||.+|-..    .++.||   +|...|.
T Consensus       604 dPNqCi--iC~rVlSC~saLqmHyrtHtGERPFkC--KiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  604 DPNQCI--ICLRVLSCPSALQMHYRTHTGERPFKC--KICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             Ccccee--eeeecccchhhhhhhhhcccCcCcccc--ccccchhccccchhhcccccccCccccccccCCchhhhccccc
Confidence            466797  899999999999999999999999999  99999999999999999998765    568999   9988887


Q ss_pred             cc
Q psy8966         169 SG  170 (175)
Q Consensus       169 ~~  170 (175)
                      ++
T Consensus       680 n~  681 (958)
T KOG1074|consen  680 NA  681 (958)
T ss_pred             cc
Confidence            65


No 5  
>KOG3608|consensus
Probab=99.75  E-value=9.6e-19  Score=123.87  Aligned_cols=123  Identities=28%  Similarity=0.519  Sum_probs=81.3

Q ss_pred             CeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchh--cccchhhhhcc--C----------------------
Q psy8966          41 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIV--REDFVHLRIHS--G----------------------   94 (175)
Q Consensus        41 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~----------------------   94 (175)
                      .+.|.+..|-..+.++..|..|++.|.+++.-.......++.  ....+|.+..+  .                      
T Consensus       177 v~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~H  256 (467)
T KOG3608|consen  177 VTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSH  256 (467)
T ss_pred             eeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHH
Confidence            488988889999999999999999999987632222222211  22233333221  1                      


Q ss_pred             ----CcceeccCCCcccccCCHHHHHHHHh-hhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCc--chhhh
Q psy8966          95 ----IRPYKCPVEYCEKAFSTQYSRKAHIR-THTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPG--SILDC  167 (175)
Q Consensus        95 ----~~~~~C~~~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--c~~~~  167 (175)
                          ..-|+||  .|+.+....++|..|++ .|..++||+|  +.|++.+.+.++|..|..+|. +..|.|+.  |.+++
T Consensus       257 v~rHvn~ykCp--lCdmtc~~~ssL~~H~r~rHs~dkpfKC--d~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~  331 (467)
T KOG3608|consen  257 VVRHVNCYKCP--LCDMTCSSASSLTTHIRYRHSKDKPFKC--DECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSV  331 (467)
T ss_pred             HHHhhhccccc--ccccCCCChHHHHHHHHhhhccCCCccc--cchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHH
Confidence                2345565  66666666677777754 4666778888  778888888888888877776 66677776  76655


Q ss_pred             c
Q psy8966         168 L  168 (175)
Q Consensus       168 ~  168 (175)
                      .
T Consensus       332 r  332 (467)
T KOG3608|consen  332 R  332 (467)
T ss_pred             H
Confidence            4


No 6  
>KOG3576|consensus
Probab=99.67  E-value=2.5e-17  Score=108.56  Aligned_cols=97  Identities=28%  Similarity=0.673  Sum_probs=82.2

Q ss_pred             CCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccCCHHHHHHH
Q psy8966          39 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAH  118 (175)
Q Consensus        39 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H  118 (175)
                      ...|.|  ++|++.|.-..-|++|++.|..                          .+.+.|.  .||+.|.+--+|++|
T Consensus       115 ~d~ftC--rvCgK~F~lQRmlnrh~kch~~--------------------------vkr~lct--~cgkgfndtfdlkrh  164 (267)
T KOG3576|consen  115 QDSFTC--RVCGKKFGLQRMLNRHLKCHSD--------------------------VKRHLCT--FCGKGFNDTFDLKRH  164 (267)
T ss_pred             CCeeee--ehhhhhhhHHHHHHHHhhhccH--------------------------HHHHHHh--hccCcccchhhhhhh
Confidence            345899  5699999999999999887654                          5567887  799999999999999


Q ss_pred             HhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcC-----------CccccCCcchhhh
Q psy8966         119 IRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTG-----------KYTAEVPGSILDC  167 (175)
Q Consensus       119 ~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~-----------~~~~~C~~c~~~~  167 (175)
                      +++|+|.+||+|  +.|+++|.++..|..|.+.-+|           ++.|.|+.||++.
T Consensus       165 ~rthtgvrpykc--~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~  222 (267)
T KOG3576|consen  165 TRTHTGVRPYKC--SLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTS  222 (267)
T ss_pred             hccccCccccch--hhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCC
Confidence            999999999999  9999999999999999974333           2669999999764


No 7  
>KOG1074|consensus
Probab=99.63  E-value=9e-17  Score=124.69  Aligned_cols=61  Identities=39%  Similarity=0.761  Sum_probs=55.0

Q ss_pred             eccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcc
Q psy8966          99 KCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGS  163 (175)
Q Consensus        99 ~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c  163 (175)
                      .|.  .|++.|.+.++|..|+++|+++|||.|  ..|++.|..+.+|..||..|...+|..=.+|
T Consensus       881 ~C~--vCgk~FsSSsALqiH~rTHtg~KPF~C--~fC~~aFttrgnLKvHMgtH~w~q~~srrG~  941 (958)
T KOG1074|consen  881 VCN--VCGKQFSSSAALEIHMRTHTGPKPFFC--HFCEEAFTTRGNLKVHMGTHMWVQPPSRRGP  941 (958)
T ss_pred             hhc--cchhcccchHHHHHhhhcCCCCCCccc--hhhhhhhhhhhhhhhhhccccccCCCccCCC
Confidence            475  899999999999999999999999999  9999999999999999999988877654443


No 8  
>KOG3623|consensus
Probab=99.57  E-value=1.4e-15  Score=116.76  Aligned_cols=97  Identities=24%  Similarity=0.547  Sum_probs=82.0

Q ss_pred             eeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccCCHHHHHHHHhh
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRT  121 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~  121 (175)
                      ..|++  |.+.+....+|+.|++..+..                        .+..|.|.  .|.++|...+.|.+|+.+
T Consensus       211 ltcpy--cdrgykrltslkeHikyrhek------------------------ne~nfsC~--lCsytFAyRtQLErhm~~  262 (1007)
T KOG3623|consen  211 LTCPY--CDRGYKRLTSLKEHIKYRHEK------------------------NEPNFSCM--LCSYTFAYRTQLERHMQL  262 (1007)
T ss_pred             hcchh--HHHHHHHHHHHHHHHHHHHhh------------------------CCCCCcch--hhhhhhhhHHHHHHHHHh
Confidence            57876  999999999999998875431                        14457786  899999999999999998


Q ss_pred             hcC-------------CCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhhhc
Q psy8966         122 HTG-------------EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCL  168 (175)
Q Consensus       122 h~~-------------~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~~~  168 (175)
                      |.-             .+.|+|  .+|||+|+.+..|..|+|+|.||+||+|+.|++.|.
T Consensus       263 hkpg~dqa~sltqsa~lRKFKC--tECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFS  320 (1007)
T KOG3623|consen  263 HKPGGDQAISLTQSALLRKFKC--TECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFS  320 (1007)
T ss_pred             hcCCCcccccccchhhhccccc--cccchhhhhHHHHHhhheeecCCCCcCCcccccccc
Confidence            842             245999  779999999999999999999999999999998874


No 9  
>KOG3576|consensus
Probab=99.53  E-value=2.5e-15  Score=99.19  Aligned_cols=115  Identities=35%  Similarity=0.671  Sum_probs=100.2

Q ss_pred             CCCccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchh
Q psy8966           9 IRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVH   88 (175)
Q Consensus         9 ~~~~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~   88 (175)
                      ...|.|.  .||+.|.....|.+|++.|...+.+.|..  ||+.|...-.|.+|+++|+|                    
T Consensus       115 ~d~ftCr--vCgK~F~lQRmlnrh~kch~~vkr~lct~--cgkgfndtfdlkrh~rthtg--------------------  170 (267)
T KOG3576|consen  115 QDSFTCR--VCGKKFGLQRMLNRHLKCHSDVKRHLCTF--CGKGFNDTFDLKRHTRTHTG--------------------  170 (267)
T ss_pred             CCeeeee--hhhhhhhHHHHHHHHhhhccHHHHHHHhh--ccCcccchhhhhhhhccccC--------------------
Confidence            3458887  99999999999999999999999999966  99999999999999888766                    


Q ss_pred             hhhccCCcceeccCCCcccccCCHHHHHHHHh-hhc----------CCCcccCCcccchHHHhchhhHHHHHHHhcCCcc
Q psy8966          89 LRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIR-THT----------GEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYT  157 (175)
Q Consensus        89 ~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~-~h~----------~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~  157 (175)
                            .+||+|.  .|++.|...-+|..|.+ +|.          .++.|.|  +.||+.-.....+..|++.|++--|
T Consensus       171 ------vrpykc~--~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vc--edcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  171 ------VRPYKCS--LCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVC--EDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             ------ccccchh--hhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeee--cccCCCCCChhHHHHHHHhcCCCCH
Confidence                  7899996  89999999999999964 442          3467999  9999999999999999999877544


No 10 
>KOG3623|consensus
Probab=99.51  E-value=5.1e-15  Score=113.74  Aligned_cols=119  Identities=33%  Similarity=0.700  Sum_probs=97.4

Q ss_pred             ccCCCccchhhccChHHHHHHHhhhcC--CCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhh
Q psy8966          12 YKCPVEYCEKAFSTQYSRKAHIRTHTG--EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHL   89 (175)
Q Consensus        12 ~~C~~~~C~~~f~~~~~L~~h~~~~~~--~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~   89 (175)
                      ..|+  +|+..+.....|++|++..+.  +..|.|..  |...|.....|.+||..|..-....             .+.
T Consensus       211 ltcp--ycdrgykrltslkeHikyrhekne~nfsC~l--CsytFAyRtQLErhm~~hkpg~dqa-------------~sl  273 (1007)
T KOG3623|consen  211 LTCP--YCDRGYKRLTSLKEHIKYRHEKNEPNFSCML--CSYTFAYRTQLERHMQLHKPGGDQA-------------ISL  273 (1007)
T ss_pred             hcch--hHHHHHHHHHHHHHHHHHHHhhCCCCCcchh--hhhhhhhHHHHHHHHHhhcCCCccc-------------ccc
Confidence            5687  999999999999999986433  34599965  9999999999999999986522110             111


Q ss_pred             hhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHH
Q psy8966          90 RIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus        90 ~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      -.....+.|+|+  +|++.|+.+-.|+.|+++|.|+|||.|  +.|+|.|..+..+..||.+
T Consensus       274 tqsa~lRKFKCt--ECgKAFKfKHHLKEHlRIHSGEKPfeC--pnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  274 TQSALLRKFKCT--ECGKAFKFKHHLKEHLRIHSGEKPFEC--PNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             cchhhhcccccc--ccchhhhhHHHHHhhheeecCCCCcCC--cccccccccCCcccccccc
Confidence            122335689998  999999999999999999999999999  8899999999999999864


No 11 
>PHA00733 hypothetical protein
Probab=99.04  E-value=3.2e-10  Score=71.86  Aligned_cols=101  Identities=25%  Similarity=0.331  Sum_probs=74.1

Q ss_pred             ChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCC
Q psy8966          25 TQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEY  104 (175)
Q Consensus        25 ~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~  104 (175)
                      +.+.|.++-..-...+.+.|.  +|...|.....|..+....                    .++ ...+.+||.|+  .
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~l~~~~~l~--------------------~~~-~~~~~kPy~C~--~   78 (128)
T PHA00733         24 TLEELKRYHSLTPEQKRLIRA--VVKTLIYNPQLLDESSYLY--------------------KLL-TSKAVSPYVCP--L   78 (128)
T ss_pred             CHHHhhhhhcCChhhhhHHHH--HHhhhccChhhhcchHHHH--------------------hhc-ccCCCCCccCC--C
Confidence            444554443333345668895  4999998877777662211                    112 22347899997  8


Q ss_pred             cccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcC
Q psy8966         105 CEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTG  154 (175)
Q Consensus       105 C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~  154 (175)
                      |++.|.+..+|..|+..+  +.+|.|  ++|++.|.....|..|+...++
T Consensus        79 Cgk~Fss~s~L~~H~r~h--~~~~~C--~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         79 CLMPFSSSVSLKQHIRYT--EHSKVC--PVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCcCCCHHHHHHHHhcC--CcCccC--CCCCCccCCHHHHHHHHHHhcC
Confidence            999999999999999876  467999  8899999999999999987665


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.97  E-value=2.3e-10  Score=51.83  Aligned_cols=25  Identities=32%  Similarity=0.444  Sum_probs=17.7

Q ss_pred             hHHHHHHHhcCCccccCCcchhhhc
Q psy8966         144 DLQKHVRTHTGKYTAEVPGSILDCL  168 (175)
Q Consensus       144 ~l~~H~~~h~~~~~~~C~~c~~~~~  168 (175)
                      +|.+|+++|+|++||.|+.|+++|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3667777777777777777777664


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.97  E-value=5.6e-10  Score=85.99  Aligned_cols=136  Identities=17%  Similarity=0.317  Sum_probs=86.3

Q ss_pred             cCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhc
Q psy8966          13 KCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIH   92 (175)
Q Consensus        13 ~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (175)
                      .|+  .|...... .+|..|...- ....-.|+..+|+..|.. ..+..|.       .|..+... +....+..|++.+
T Consensus       409 ~C~--NC~~~i~l-~~l~lHe~~C-~r~~V~Cp~~~Cg~v~~r-~el~~H~-------~C~~Cgk~-f~~s~LekH~~~~  475 (567)
T PLN03086        409 ECR--NCKHYIPS-RSIALHEAYC-SRHNVVCPHDGCGIVLRV-EEAKNHV-------HCEKCGQA-FQQGEMEKHMKVF  475 (567)
T ss_pred             ECC--CCCCccch-hHHHHHHhhC-CCcceeCCcccccceeec-cccccCc-------cCCCCCCc-cchHHHHHHHHhc
Confidence            465  67775433 5566776432 112245643246666632 2233332       22222211 1223334566665


Q ss_pred             cCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhc----------hhhHHHHHHHhcCCccccCCc
Q psy8966          93 SGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKT----------SGDLQKHVRTHTGKYTAEVPG  162 (175)
Q Consensus        93 ~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~----------~~~l~~H~~~h~~~~~~~C~~  162 (175)
                      .  .++.|+   |++.+ ....|..|+.+|...+++.|  ..|++.+..          .+.|..|..+. |.+++.|..
T Consensus       476 H--kpv~Cp---Cg~~~-~R~~L~~H~~thCp~Kpi~C--~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~  546 (567)
T PLN03086        476 H--EPLQCP---CGVVL-EKEQMVQHQASTCPLRLITC--RFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDS  546 (567)
T ss_pred             C--CCccCC---CCCCc-chhHHHhhhhccCCCCceeC--CCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccc
Confidence            3  688995   98755 66899999999999999999  889998852          35799999885 889999999


Q ss_pred             chhhhccc
Q psy8966         163 SILDCLSG  170 (175)
Q Consensus       163 c~~~~~~~  170 (175)
                      ||..+.-.
T Consensus       547 Cgk~Vrlr  554 (567)
T PLN03086        547 CGRSVMLK  554 (567)
T ss_pred             cCCeeeeh
Confidence            99876544


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=6.7e-10  Score=58.65  Aligned_cols=42  Identities=24%  Similarity=0.604  Sum_probs=29.2

Q ss_pred             eeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhH
Q psy8966          98 YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDL  145 (175)
Q Consensus        98 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l  145 (175)
                      |.|+  .||+.|...++|..|+++|+  ++|+|  .+|++.|.+.+.|
T Consensus         6 y~C~--~CGK~Fs~~~~L~~H~r~H~--k~~kc--~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECP--ICGEIYIKRKSMITHLRKHN--TNLKL--SNCKRISLRTGEY   47 (55)
T ss_pred             cCcc--hhCCeeccHHHHHHHHHhcC--CcccC--Ccccceeccccee
Confidence            5665  67777777777777777775  57777  6677777766554


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.89  E-value=7.7e-10  Score=58.40  Aligned_cols=38  Identities=18%  Similarity=0.436  Sum_probs=35.0

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhhhc
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCL  168 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~~~  168 (175)
                      .|.|  ++||+.|....+|..|+++|+  .++.|..|++.|.
T Consensus         5 ~y~C--~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~   42 (55)
T PHA02768          5 GYEC--PICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISL   42 (55)
T ss_pred             ccCc--chhCCeeccHHHHHHHHHhcC--CcccCCcccceec
Confidence            4899  889999999999999999999  6999999998765


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.79  E-value=2.5e-08  Score=77.07  Aligned_cols=101  Identities=17%  Similarity=0.358  Sum_probs=68.3

Q ss_pred             eeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccC----------C
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFS----------T  111 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~----------~  111 (175)
                      +.|..  |+..|. ...|..|+..++....|. +. .......+..|+..+-..+++.|+  .|++.+.          .
T Consensus       454 ~~C~~--Cgk~f~-~s~LekH~~~~Hkpv~Cp-Cg-~~~~R~~L~~H~~thCp~Kpi~C~--fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        454 VHCEK--CGQAFQ-QGEMEKHMKVFHEPLQCP-CG-VVLEKEQMVQHQASTCPLRLITCR--FCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             ccCCC--CCCccc-hHHHHHHHHhcCCCccCC-CC-CCcchhHHHhhhhccCCCCceeCC--CCCCccccCccccchhhh
Confidence            46644  777664 456677776655333343 22 222222334466667778999997  8999985          2


Q ss_pred             HHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhc
Q psy8966         112 QYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHT  153 (175)
Q Consensus       112 ~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~  153 (175)
                      .++|..|..+. +.+++.|  ..||+.+..+ +|..|+..-+
T Consensus       527 ~s~Lt~HE~~C-G~rt~~C--~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        527 LRGMSEHESIC-GSRTAPC--DSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             hhhHHHHHHhc-CCcceEc--cccCCeeeeh-hHHHHHHHhh
Confidence            45899998886 8999999  8999988865 6778886543


No 17 
>PHA00616 hypothetical protein
Probab=98.75  E-value=6.4e-09  Score=52.30  Aligned_cols=35  Identities=14%  Similarity=0.298  Sum_probs=29.9

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcc
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGS  163 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c  163 (175)
                      ||+|  +.||+.|..+++|.+|++.|+|+.++.|+.-
T Consensus         1 pYqC--~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQC--LRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             CCcc--chhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            6888  7799999999999999999999988888753


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.74  E-value=2.9e-09  Score=48.16  Aligned_cols=26  Identities=58%  Similarity=1.248  Sum_probs=22.7

Q ss_pred             HHHHHHhhhcCCCcccCCcccchHHHhc
Q psy8966         114 SRKAHIRTHTGEKPYRCAHEFCSKSFKT  141 (175)
Q Consensus       114 ~l~~H~~~h~~~~~~~C~~~~C~~~f~~  141 (175)
                      +|..|+++|++++||.|  ++|+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C--~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKC--PYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEE--SSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCC--CCCcCeeCc
Confidence            57899999999999999  889998863


No 19 
>PHA00733 hypothetical protein
Probab=98.71  E-value=2.3e-08  Score=63.38  Aligned_cols=84  Identities=20%  Similarity=0.346  Sum_probs=64.8

Q ss_pred             CCCCCccCCCccchhhccChHHHHHH--Hh---hhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccch
Q psy8966           7 SGIRPYKCPVEYCEKAFSTQYSRKAH--IR---THTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLI   81 (175)
Q Consensus         7 ~~~~~~~C~~~~C~~~f~~~~~L~~h--~~---~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~   81 (175)
                      ..++++.|.  .|...|.....|..+  +.   .+.+..+|.|..  |++.|.+...|..|++.+               
T Consensus        36 ~~~~~~~~~--~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~--Cgk~Fss~s~L~~H~r~h---------------   96 (128)
T PHA00733         36 PEQKRLIRA--VVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPL--CLMPFSSSVSLKQHIRYT---------------   96 (128)
T ss_pred             hhhhhHHHH--HHhhhccChhhhcchHHHHhhcccCCCCCccCCC--CCCcCCCHHHHHHHHhcC---------------
Confidence            346778997  899888877776665  22   234467899965  999999999999997754               


Q ss_pred             hcccchhhhhccCCcceeccCCCcccccCCHHHHHHHHhhhcC
Q psy8966          82 VREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTG  124 (175)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~  124 (175)
                                   ..++.|.  .|++.|.....|..|+...++
T Consensus        97 -------------~~~~~C~--~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         97 -------------EHSKVCP--VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             -------------CcCccCC--CCCCccCCHHHHHHHHHHhcC
Confidence                         1257886  899999999999999876543


No 20 
>KOG3993|consensus
Probab=98.61  E-value=2.5e-08  Score=73.20  Aligned_cols=106  Identities=23%  Similarity=0.405  Sum_probs=75.6

Q ss_pred             ccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCC--C-ccchhcccchh
Q psy8966          12 YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGI--D-SRLIVREDFVH   88 (175)
Q Consensus        12 ~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~--~-~~~~~~~~~~~   88 (175)
                      |.|.  .|...|.+...|.+|....+-...|.|++  |++.|+-.++|..|++.|..........  . +..........
T Consensus       268 yiCq--LCK~kYeD~F~LAQHrC~RIV~vEYrCPE--C~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~  343 (500)
T KOG3993|consen  268 YICQ--LCKEKYEDAFALAQHRCPRIVHVEYRCPE--CDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQ  343 (500)
T ss_pred             HHHH--HHHHhhhhHHHHhhccCCeeEEeeecCCc--ccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhh
Confidence            8887  99999999999999998777777899987  9999999999999999998754322100  0 00000000000


Q ss_pred             ----hhhccCCcceeccCCCcccccCCHHHHHHHHhhhc
Q psy8966          89 ----LRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHT  123 (175)
Q Consensus        89 ----~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~  123 (175)
                          .-....+..|.|.  .|++.|..+.-|..|+.+|.
T Consensus       344 ea~rsg~dss~gi~~C~--~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  344 EAERSGDDSSSGIFSCH--TCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hccccCCcccCceeecH--HhhhhhHHHHHHHHhHHhhh
Confidence                0011335688896  89999999999999976653


No 21 
>PHA00616 hypothetical protein
Probab=98.41  E-value=1.5e-07  Score=47.39  Aligned_cols=32  Identities=16%  Similarity=0.318  Sum_probs=30.2

Q ss_pred             ceeccCCCcccccCCHHHHHHHHhhhcCCCcccC
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRC  130 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C  130 (175)
                      ||.|+  .||+.|..+++|..|++.|++++++.|
T Consensus         1 pYqC~--~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCL--RCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccc--hhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            68897  999999999999999999999999888


No 22 
>PHA00732 hypothetical protein
Probab=98.14  E-value=1e-06  Score=50.91  Aligned_cols=47  Identities=34%  Similarity=0.719  Sum_probs=37.3

Q ss_pred             ceeccCCCcccccCCHHHHHHHHhh-hcCCCcccCCcccchHHHhchhhHHHHHHHhc
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIRT-HTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHT  153 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~  153 (175)
                      ||.|.  .|++.|.+.++|..|++. |.   ++.|  ++|++.|.   .+..|..++.
T Consensus         1 py~C~--~Cgk~F~s~s~Lk~H~r~~H~---~~~C--~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCP--ICGFTTVTLFALKQHARRNHT---LTKC--PVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCC--CCCCccCCHHHHHHHhhcccC---CCcc--CCCCCEeC---ChhhhhcccC
Confidence            57786  899999999999999874 54   4589  88999998   5778886543


No 23 
>PHA00732 hypothetical protein
Probab=98.10  E-value=1.5e-06  Score=50.18  Aligned_cols=38  Identities=24%  Similarity=0.344  Sum_probs=33.0

Q ss_pred             cccCCcccchHHHhchhhHHHHHHH-hcCCccccCCcchhhhcc
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRT-HTGKYTAEVPGSILDCLS  169 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~c~~~~~~  169 (175)
                      ||.|  +.|++.|.....|..|++. |++   +.|+.||+.|.+
T Consensus         1 py~C--~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKC--PICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR   39 (79)
T ss_pred             CccC--CCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC
Confidence            6889  8899999999999999985 654   589999998874


No 24 
>KOG3993|consensus
Probab=98.08  E-value=1.1e-06  Score=64.80  Aligned_cols=81  Identities=31%  Similarity=0.638  Sum_probs=65.2

Q ss_pred             eeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccCCHHHHHHHHhh
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRT  121 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~  121 (175)
                      |.|  ++|...|.+.-.|.+|.-...                          .-..|+|+  +|++.|+...+|..|.++
T Consensus       268 yiC--qLCK~kYeD~F~LAQHrC~RI--------------------------V~vEYrCP--EC~KVFsCPANLASHRRW  317 (500)
T KOG3993|consen  268 YIC--QLCKEKYEDAFALAQHRCPRI--------------------------VHVEYRCP--ECDKVFSCPANLASHRRW  317 (500)
T ss_pred             HHH--HHHHHhhhhHHHHhhccCCee--------------------------EEeeecCC--cccccccCchhhhhhhcc
Confidence            788  569999999988888843211                          12358997  999999999999999999


Q ss_pred             hc--------CCC-------------------------cccCCcccchHHHhchhhHHHHHHHhcC
Q psy8966         122 HT--------GEK-------------------------PYRCAHEFCSKSFKTSGDLQKHVRTHTG  154 (175)
Q Consensus       122 h~--------~~~-------------------------~~~C~~~~C~~~f~~~~~l~~H~~~h~~  154 (175)
                      |.        +.+                         .|.|  .+|+|.|+....|+.|+.+|+.
T Consensus       318 HKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C--~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  318 HKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSC--HTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             cCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeec--HHhhhhhHHHHHHHHhHHhhhc
Confidence            83        111                         3999  8999999999999999888764


No 25 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.02  E-value=1.6e-06  Score=61.74  Aligned_cols=54  Identities=43%  Similarity=0.845  Sum_probs=43.2

Q ss_pred             CcceeccCCCcccccCCHHHHHHHHhhhc-------------------CCCcccCCcccchHHHhchhhHHHHHH
Q psy8966          95 IRPYKCPVEYCEKAFSTQYSRKAHIRTHT-------------------GEKPYRCAHEFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus        95 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~~~C~~~f~~~~~l~~H~~  150 (175)
                      ++||+|++..|++.+..+.+|+-|+.-.+                   .+|||.|  ++|+|.|+.--.|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrC--evC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRC--EVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceec--cccchhhccCccceeccc
Confidence            48999999999999999999999975321                   2478888  888888888877777754


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.99  E-value=2.1e-05  Score=42.18  Aligned_cols=51  Identities=27%  Similarity=0.597  Sum_probs=39.5

Q ss_pred             ceeccCCCcccccCCHHHHHHHHhh-hcC-CCcccCCcccchHHHhchhhHHHHHHHhcC
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIRT-HTG-EKPYRCAHEFCSKSFKTSGDLQKHVRTHTG  154 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~~-h~~-~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~  154 (175)
                      .|.||  .|++ ..+..+|..|... |.. .+.+.|  ++|...+.  .+|.+|+.++++
T Consensus         2 ~f~CP--~C~~-~~~~~~L~~H~~~~H~~~~~~v~C--PiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCP--YCGK-GFSESSLVEHCEDEHRSESKNVVC--PICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCC--CCCC-ccCHHHHHHHHHhHCcCCCCCccC--CCchhhhh--hHHHHHHHHhcC
Confidence            47897  7999 5667899999755 544 357999  99998655  489999987653


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.96  E-value=2.4e-06  Score=37.31  Aligned_cols=22  Identities=41%  Similarity=1.081  Sum_probs=12.9

Q ss_pred             ccCCcccchHHHhchhhHHHHHHH
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      |+|  ++|++.|..+..|..|++.
T Consensus         1 y~C--~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKC--PICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEE--TTTTEEESSHHHHHHHHHH
T ss_pred             CCC--CCCCCccCCHHHHHHHHhH
Confidence            455  5566666666666666554


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.64  E-value=5.7e-05  Score=32.79  Aligned_cols=22  Identities=41%  Similarity=1.044  Sum_probs=13.0

Q ss_pred             eeccccccCcccCChHHHHHHHHH
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRT   65 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~   65 (175)
                      |.|+.  |++.|.+...|..|++.
T Consensus         1 y~C~~--C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPI--CGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETT--TTEEESSHHHHHHHHHH
T ss_pred             CCCCC--CCCccCCHHHHHHHHhH
Confidence            45533  66666666666666654


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.61  E-value=2.6e-05  Score=34.11  Aligned_cols=23  Identities=43%  Similarity=1.131  Sum_probs=12.1

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHh
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h  152 (175)
                      |.|  ++|++.|.+...|..|++.|
T Consensus         1 ~~C--~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQC--PICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE---SSTS-EESSHHHHHHHHHHH
T ss_pred             CCC--cCCCCcCCcHHHHHHHHHhh
Confidence            455  55666666666666666554


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.56  E-value=1.8e-05  Score=35.92  Aligned_cols=23  Identities=35%  Similarity=0.901  Sum_probs=12.7

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHh
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h  152 (175)
                      |.|  .+|++.|.+..+|..|++.|
T Consensus         2 ~~C--~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FEC--DECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEE--TTTTEEESSHHHHHHHHCTT
T ss_pred             CCC--CccCCccCChhHHHHHhHHh
Confidence            455  55555555555555555544


No 31 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.25  E-value=0.00027  Score=31.26  Aligned_cols=24  Identities=50%  Similarity=0.964  Sum_probs=16.6

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHhc
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTHT  153 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h~  153 (175)
                      |.|  +.|++.|.....|..|++.|.
T Consensus         1 ~~C--~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRC--PECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCC--CCCcchhCCHHHHHHHHHHhc
Confidence            456  667777777777777777554


No 32 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.24  E-value=0.00084  Score=35.87  Aligned_cols=50  Identities=30%  Similarity=0.622  Sum_probs=38.3

Q ss_pred             CccCCCccchhhccChHHHHHHHhh-hcCC-CCeeccccccCcccCChHHHHHHHHHhc
Q psy8966          11 PYKCPVEYCEKAFSTQYSRKAHIRT-HTGE-KPYRCAHEFCSKSFKTSGDLQKHVRTHT   67 (175)
Q Consensus        11 ~~~C~~~~C~~~f~~~~~L~~h~~~-~~~~-~~~~C~~~~C~~~f~~~~~l~~H~~~h~   67 (175)
                      .|.|+  .|++ ..+...|..|... |..+ +.+.|+.  |...+.  .+|..|+..++
T Consensus         2 ~f~CP--~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPi--C~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCP--YCGK-GFSESSLVEHCEDEHRSESKNVVCPI--CSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCC--CCCC-ccCHHHHHHHHHhHCcCCCCCccCCC--chhhhh--hHHHHHHHHhc
Confidence            48898  9999 6778999999885 5443 4589966  998654  48999988765


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.20  E-value=0.00046  Score=29.91  Aligned_cols=23  Identities=43%  Similarity=1.096  Sum_probs=11.6

Q ss_pred             eeccccccCcccCChHHHHHHHHHh
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTH   66 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h   66 (175)
                      |.|+.  |+..|.+...|..|+..+
T Consensus         1 ~~C~~--C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPI--CGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SS--TS-EESSHHHHHHHHHHH
T ss_pred             CCCcC--CCCcCCcHHHHHHHHHhh
Confidence            34533  666666666666665544


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.17  E-value=0.00035  Score=31.53  Aligned_cols=24  Identities=33%  Similarity=0.875  Sum_probs=14.7

Q ss_pred             eeccccccCcccCChHHHHHHHHHhc
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHT   67 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~   67 (175)
                      |.|..  |+..|.+..+|..|++.|.
T Consensus         2 ~~C~~--C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDE--CGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETT--TTEEESSHHHHHHHHCTTT
T ss_pred             CCCCc--cCCccCChhHHHHHhHHhc
Confidence            56633  6666666666666665553


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.16  E-value=0.00022  Score=51.21  Aligned_cols=72  Identities=25%  Similarity=0.466  Sum_probs=50.0

Q ss_pred             CCCeeccccccCcccCChHHHHHHHHH-hcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccCCHHHHHH
Q psy8966          39 EKPYRCAHEFCSKSFKTSGDLQKHVRT-HTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKA  117 (175)
Q Consensus        39 ~~~~~C~~~~C~~~f~~~~~l~~H~~~-h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~  117 (175)
                      .++|+|+.++|.+.+++.-.|.=|+.- |..........        +..+.-.-...+||+|+  .|++.++...+|+-
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~--------p~~~~~F~~~~KPYrCe--vC~KRYKNlNGLKY  416 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS--------PEKMNIFSAKDKPYRCE--VCDKRYKNLNGLKY  416 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCC--------ccccccccccCCceecc--ccchhhccCcccee
Confidence            488999988999999999999988764 33322211110        01112223446899997  79999999999998


Q ss_pred             HHh
Q psy8966         118 HIR  120 (175)
Q Consensus       118 H~~  120 (175)
                      |+.
T Consensus       417 Hr~  419 (423)
T COG5189         417 HRK  419 (423)
T ss_pred             ccc
Confidence            864


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.10  E-value=0.00031  Score=36.26  Aligned_cols=31  Identities=26%  Similarity=0.560  Sum_probs=14.6

Q ss_pred             CCcccCCcccchHHHhchhhHHHHHHHhcCCcc
Q psy8966         125 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYT  157 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~  157 (175)
                      ++|-.|  ++|+..+.+..+|.+|+.+.++.+|
T Consensus        22 ~~PatC--P~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATC--PICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE---TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCC--CcchhhccchhhHHHHHHHHhcccC
Confidence            455566  5566666666666666665555443


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.01  E-value=0.0008  Score=40.61  Aligned_cols=24  Identities=33%  Similarity=1.028  Sum_probs=16.5

Q ss_pred             ceeccCCCcccccCCHHHHHHHHhhh
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIRTH  122 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~~h  122 (175)
                      .+.|.  .|++.|.+..+|..|++.+
T Consensus        50 ~~~C~--~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCP--YCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBS--SSS-EESSHHHHHHHHHHT
T ss_pred             CCCCC--ccCCCCcCHHHHHHHHcCc
Confidence            56776  6777777777777777654


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=96.89  E-value=0.0005  Score=45.33  Aligned_cols=35  Identities=23%  Similarity=0.446  Sum_probs=24.0

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhhh
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDC  167 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~~  167 (175)
                      +|.|  . |+.   ....+.+|.++|+++.+|.|..|+..+
T Consensus       119 ~Y~C--~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        119 PYRC--K-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEc--C-CCC---eeCHHHHHHHHhcCCccEECCCCCcee
Confidence            4777  5 765   556667777777777777777776554


No 39 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.52  E-value=0.0011  Score=40.01  Aligned_cols=47  Identities=30%  Similarity=0.852  Sum_probs=21.3

Q ss_pred             CcccccCCHHHHHHHHhhhcC-----------------------CCcccCCcccchHHHhchhhHHHHHHHh
Q psy8966         104 YCEKAFSTQYSRKAHIRTHTG-----------------------EKPYRCAHEFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus       104 ~C~~~f~~~~~l~~H~~~h~~-----------------------~~~~~C~~~~C~~~f~~~~~l~~H~~~h  152 (175)
                      .|+..|.+...|..|+...++                       ...+.|  ..|++.|.+...|..||+.+
T Consensus         4 ~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C--~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    4 FCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRC--PYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------SSEEB--SSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccCCCCCC--CccCCCCcCHHHHHHHHcCc
Confidence            566666666666666532211                       124899  89999999999999999974


No 40 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.47  E-value=0.0011  Score=28.95  Aligned_cols=19  Identities=32%  Similarity=0.672  Sum_probs=8.6

Q ss_pred             ccchHHHhchhhHHHHHHHh
Q psy8966         133 EFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus       133 ~~C~~~f~~~~~l~~H~~~h  152 (175)
                      +.|++... ...|..|++.+
T Consensus         4 ~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    4 PHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCcCC-HHHHHHHHHhh
Confidence            44554444 44555555443


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.46  E-value=0.0007  Score=29.87  Aligned_cols=22  Identities=36%  Similarity=1.014  Sum_probs=13.9

Q ss_pred             ccCCcccchHHHhchhhHHHHHHH
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      |.|  ++|++.|.+...|..|++.
T Consensus         1 ~~C--~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYC--DICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEE--TTTTEEESSHHHHHHHHTT
T ss_pred             CCC--CCCCCCcCCHHHHHHHHCc
Confidence            456  6666666666666666654


No 42 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.37  E-value=0.0059  Score=31.65  Aligned_cols=33  Identities=21%  Similarity=0.500  Sum_probs=23.7

Q ss_pred             cCCcceeccCCCcccccCCHHHHHHHHhhhcCCCc
Q psy8966          93 SGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKP  127 (175)
Q Consensus        93 ~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~  127 (175)
                      ..+.|-.||  .|+..+.+..+|.+|+.+.++.+|
T Consensus        20 ~S~~PatCP--~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCP--ICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-T--TT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCC--cchhhccchhhHHHHHHHHhcccC
Confidence            346788998  899999999999999988888776


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.20  E-value=0.0044  Score=27.20  Aligned_cols=23  Identities=35%  Similarity=0.979  Sum_probs=16.3

Q ss_pred             eeccccccCcccCChHHHHHHHHHh
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTH   66 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h   66 (175)
                      |.|  +.|+..|.+...|..|++.+
T Consensus         1 ~~C--~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYC--DICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEE--TTTTEEESSHHHHHHHHTTH
T ss_pred             CCC--CCCCCCcCCHHHHHHHHCcC
Confidence            467  44888888888888877653


No 44 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.14  E-value=0.0071  Score=26.37  Aligned_cols=17  Identities=47%  Similarity=0.931  Sum_probs=8.9

Q ss_pred             cCcccCChHHHHHHHHH
Q psy8966          49 CSKSFKTSGDLQKHVRT   65 (175)
Q Consensus        49 C~~~f~~~~~l~~H~~~   65 (175)
                      |++.|.+...|..|++.
T Consensus         6 C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        6 CGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CcchhCCHHHHHHHHHH
Confidence            55555555555555543


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.04  E-value=0.009  Score=25.94  Aligned_cols=23  Identities=39%  Similarity=0.969  Sum_probs=13.8

Q ss_pred             eeccccccCcccCChHHHHHHHHHhc
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHT   67 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~   67 (175)
                      |.|+.  |+.... ...|..|++.++
T Consensus         1 y~C~~--C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPH--CSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SS--SS-EES-HHHHHHHHHHHH
T ss_pred             CCCCC--CCCcCC-HHHHHHHHHhhC
Confidence            46744  777766 667777776654


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=95.91  E-value=0.0037  Score=41.30  Aligned_cols=40  Identities=35%  Similarity=0.808  Sum_probs=33.1

Q ss_pred             cceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchh
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSG  143 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~  143 (175)
                      -+|.|   .|+.   ....+.+|.++|+++++|.|  ..|+..|....
T Consensus       118 ~~Y~C---~C~~---~~~~~rrH~ri~~g~~~YrC--~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRC---KCQE---HQLTVRRHNRVVRGEAVYRC--RRCGETLVFKG  157 (160)
T ss_pred             EEEEc---CCCC---eeCHHHHHHHHhcCCccEEC--CCCCceeEEec
Confidence            47888   4877   55678899999999999999  88999887543


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.22  E-value=0.0041  Score=47.42  Aligned_cols=151  Identities=23%  Similarity=0.344  Sum_probs=104.5

Q ss_pred             CccCCCccchhhccChHHHHHHHh--hhcCC--CCeeccccccCcccCChHHHHHHHHHhcCCCCCCC----CCCccchh
Q psy8966          11 PYKCPVEYCEKAFSTQYSRKAHIR--THTGE--KPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGP----GIDSRLIV   82 (175)
Q Consensus        11 ~~~C~~~~C~~~f~~~~~L~~h~~--~~~~~--~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~----~~~~~~~~   82 (175)
                      ++.|.  .|...|.....|..|..  .|.++  .++.|+...|++.|.....+..|...|.+..+...    ........
T Consensus       289 ~~~~~--~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  366 (467)
T COG5048         289 PIKSK--QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPL  366 (467)
T ss_pred             CCCCc--cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccc
Confidence            56776  89999999999999999  79998  89999722599999999999999999887553211    10000000


Q ss_pred             cc-----cchhhhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCC--cccCCcccchHHHhchhhHHHHHHHhcCC
Q psy8966          83 RE-----DFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEK--PYRCAHEFCSKSFKTSGDLQKHVRTHTGK  155 (175)
Q Consensus        83 ~~-----~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~--~~~C~~~~C~~~f~~~~~l~~H~~~h~~~  155 (175)
                      ..     ...............+....|...+.....+..|...+....  .+.+  ..|.+.+.....+..|++.+...
T Consensus       367 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~  444 (467)
T COG5048         367 LNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKN--PPCSKSFNRHYNLIPHKKIHTNH  444 (467)
T ss_pred             cCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCC--CcchhhccCcccccccccccccC
Confidence            00     001111112233444554457677777777777777776655  3566  88999999999999999999888


Q ss_pred             ccccCCcchh
Q psy8966         156 YTAEVPGSIL  165 (175)
Q Consensus       156 ~~~~C~~c~~  165 (175)
                      .+..|..++.
T Consensus       445 ~~~~~~~~~~  454 (467)
T COG5048         445 APLLCSILKS  454 (467)
T ss_pred             Cceeeccccc
Confidence            7777766553


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.05  E-value=0.0019  Score=29.09  Aligned_cols=18  Identities=28%  Similarity=0.761  Sum_probs=9.7

Q ss_pred             ccchHHHhchhhHHHHHH
Q psy8966         133 EFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus       133 ~~C~~~f~~~~~l~~H~~  150 (175)
                      ..|++.|.+...|..|++
T Consensus         5 ~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    5 DACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             TTTTBBBSSHHHHHCCTT
T ss_pred             ccCCCCcCCHHHHHHHHc
Confidence            455555555555555544


No 49 
>KOG4173|consensus
Probab=94.84  E-value=0.015  Score=39.45  Aligned_cols=91  Identities=29%  Similarity=0.572  Sum_probs=67.9

Q ss_pred             CccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhh
Q psy8966          11 PYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLR   90 (175)
Q Consensus        11 ~~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~   90 (175)
                      .+.|++..|-.+|....+...|-.+.++.   .|..  |.+.|.+..-|..|+...+...                --..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~--C~r~~Pt~hLLd~HI~E~HDs~----------------Fqa~  137 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSF--CKRAFPTGHLLDAHILEWHDSL----------------FQAL  137 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHH--HHHhCCchhhhhHHHHHHHHHH----------------HHHH
Confidence            37787778999999988888887765553   7866  9999999999999987655311                0112


Q ss_pred             hccCCcceeccCCCcccccCCHHHHHHHH-hhh
Q psy8966          91 IHSGIRPYKCPVEYCEKAFSTQYSRKAHI-RTH  122 (175)
Q Consensus        91 ~~~~~~~~~C~~~~C~~~f~~~~~l~~H~-~~h  122 (175)
                      ...|..-|.|-+.+|+..|.+..+...|+ ..|
T Consensus       138 veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  138 VERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            23345678898889999999998888885 444


No 50 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.33  E-value=0.015  Score=26.13  Aligned_cols=22  Identities=27%  Similarity=0.824  Sum_probs=16.8

Q ss_pred             eeccccccCcccCChHHHHHHHHH
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRT   65 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~   65 (175)
                      |.|.  .|++.|.+...|..|+++
T Consensus         2 ~~C~--~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCD--ACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBT--TTTBBBSSHHHHHCCTTS
T ss_pred             CCcc--cCCCCcCCHHHHHHHHcc
Confidence            6784  488888888888887664


No 51 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.10  E-value=0.014  Score=27.69  Aligned_cols=24  Identities=17%  Similarity=0.278  Sum_probs=14.3

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      |+|  .+||+.+....            .++.||.||.
T Consensus         2 ~~C--~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVC--PVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EEC--CCCCCEECCCc------------CCCcCcCCCC
Confidence            567  66776544221            6677777764


No 52 
>KOG1146|consensus
Probab=92.90  E-value=0.034  Score=47.62  Aligned_cols=140  Identities=18%  Similarity=0.300  Sum_probs=85.1

Q ss_pred             cchhhccChHHHHHHHh-hhcCCCCeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchh-hhhccCC
Q psy8966          18 YCEKAFSTQYSRKAHIR-THTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVH-LRIHSGI   95 (175)
Q Consensus        18 ~C~~~f~~~~~L~~h~~-~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~   95 (175)
                      -|+..+.....+.-++. .+.-.+.+.|+.  |+..|.....|..||++-+.+..-  .............. .....+.
T Consensus       441 ~~e~~~~s~r~~~~~t~~L~S~~kt~~cpk--c~~~yk~a~~L~vhmRskhp~~~~--~~c~~gq~~~~~arg~~~~~~~  516 (1406)
T KOG1146|consen  441 KAEPLLESKRSLEGQTVVLHSFFKTLKCPK--CNWHYKLAQTLGVHMRSKHPESQS--AYCKAGQNHPRLARGEVYRCPG  516 (1406)
T ss_pred             chhhhhhhhcccccceeeeecccccccCCc--cchhhhhHHHhhhcccccccccch--hHhHhccccccccccccccCCC
Confidence            34444444444444443 244446689976  999999999999999984432211  00000000000000 0112235


Q ss_pred             cceeccCCCcccccCCHHHHHHHHhhh--c-----------------------------------C------CCcccCCc
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRTH--T-----------------------------------G------EKPYRCAH  132 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~h--~-----------------------------------~------~~~~~C~~  132 (175)
                      +||.|.  .|...+....+|.+|+..-  .                                   +      ..+|.|  
T Consensus       517 ~p~~C~--~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C--  592 (1406)
T KOG1146|consen  517 KPYPCR--ACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRC--  592 (1406)
T ss_pred             Ccccce--eeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcch--
Confidence            788896  8999999999999997531  0                                   0      013999  


Q ss_pred             ccchHHHhchhhHHHHHHH-hcCCccccCCcchh
Q psy8966         133 EFCSKSFKTSGDLQKHVRT-HTGKYTAEVPGSIL  165 (175)
Q Consensus       133 ~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~c~~  165 (175)
                      .+|++--.-..+|+.||.. ++...|-.+-.++.
T Consensus       593 ~vc~yetniarnlrihmtss~~s~~p~~~Lq~~i  626 (1406)
T KOG1146|consen  593 EVCSYETNIARNLRIHMTASPSSSPPSLVLQQNI  626 (1406)
T ss_pred             hhhcchhhhhhccccccccCCCCCChHHHhhhcc
Confidence            9999999999999999974 44444455554443


No 53 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=92.16  E-value=0.07  Score=39.29  Aligned_cols=105  Identities=22%  Similarity=0.338  Sum_probs=60.6

Q ss_pred             CeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCC-c-------cchh-cccchhhhhccCC----cceeccCCCccc
Q psy8966          41 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGID-S-------RLIV-REDFVHLRIHSGI----RPYKCPVEYCEK  107 (175)
Q Consensus        41 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~-~-------~~~~-~~~~~~~~~~~~~----~~~~C~~~~C~~  107 (175)
                      .|.|+.+-|.........|+.|.++.++...|..+.. .       .++. ..+..|......+    +--.|.  .|..
T Consensus       151 ~F~CP~skc~~~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~--FC~~  228 (493)
T COG5236         151 SFKCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCI--FCKI  228 (493)
T ss_pred             HhcCCchhhhhhhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhh--hccc
Confidence            3777766677777777888888888777655443221 1       1111 1122233333222    122476  7999


Q ss_pred             ccCCHHHHHHHHhhhcCCCcccCCcccch----HHHhchhhHHHHHH
Q psy8966         108 AFSTQYSRKAHIRTHTGEKPYRCAHEFCS----KSFKTSGDLQKHVR  150 (175)
Q Consensus       108 ~f~~~~~l~~H~~~h~~~~~~~C~~~~C~----~~f~~~~~l~~H~~  150 (175)
                      .|-+...|..|.+.-+ ++-+.|  +.-+    .-|+.-.+|.+|.+
T Consensus       229 ~FYdDDEL~~HcR~~H-E~ChIC--D~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         229 YFYDDDELRRHCRLRH-EACHIC--DMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             eecChHHHHHHHHhhh-hhhhhh--hccCccchhhhhCHHHHHHHhh
Confidence            9999999999976542 344444  2222    24666667777765


No 54 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=92.15  E-value=0.079  Score=23.30  Aligned_cols=17  Identities=29%  Similarity=0.757  Sum_probs=8.0

Q ss_pred             ccchHHHhchhhHHHHHH
Q psy8966         133 EFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus       133 ~~C~~~f~~~~~l~~H~~  150 (175)
                      +.||..| ....|..|++
T Consensus         6 ~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    6 PICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CCCCCEE-CHHHHHHHHH
Confidence            4455555 3344445543


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.55  E-value=0.21  Score=23.56  Aligned_cols=23  Identities=17%  Similarity=0.644  Sum_probs=18.4

Q ss_pred             CeeccccccCcccCChHHHHHHHHH
Q psy8966          41 PYRCAHEFCSKSFKTSGDLQKHVRT   65 (175)
Q Consensus        41 ~~~C~~~~C~~~f~~~~~l~~H~~~   65 (175)
                      +|.|  +.|+..|.+..++..|+..
T Consensus         3 ~~~C--~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYC--KLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEc--cccCCccCCHHHHHHHHCh
Confidence            4788  5599999988888888765


No 56 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.47  E-value=0.096  Score=24.82  Aligned_cols=22  Identities=18%  Similarity=0.689  Sum_probs=14.7

Q ss_pred             cccCCcccchHHHhchhhHHHHHH
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~  150 (175)
                      +|.|  +.|+..|.....+..|++
T Consensus         3 ~~~C--~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYC--KLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEc--cccCCccCCHHHHHHHHC
Confidence            4567  667777776666666664


No 57 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.55  E-value=1  Score=33.47  Aligned_cols=74  Identities=19%  Similarity=0.281  Sum_probs=36.0

Q ss_pred             ccCcccCChHHHHHHHHHhcCC-CCCCCCCCccchhcccchhhhhccCCcceeccCCCccc----ccCCHHHHHHHHhh
Q psy8966          48 FCSKSFKTSGDLQKHVRTHTGK-YTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEK----AFSTQYSRKAHIRT  121 (175)
Q Consensus        48 ~C~~~f~~~~~l~~H~~~h~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~----~f~~~~~l~~H~~~  121 (175)
                      +|...|.+...|..|++..+.. ..|.........+.........|-..--|.|+.+.|..    .|.....|..|+..
T Consensus       225 FC~~~FYdDDEL~~HcR~~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~~hy~ct~qtc~~~k~~vf~~~~el~~h~~~  303 (493)
T COG5236         225 FCKIYFYDDDELRRHCRLRHEACHICDMVGPIRYQYFKSYEDLEAHFRNAHYCCTFQTCRVGKCYVFPYHTELLEHLTR  303 (493)
T ss_pred             hccceecChHHHHHHHHhhhhhhhhhhccCccchhhhhCHHHHHHHhhcCceEEEEEEEecCcEEEeccHHHHHHHHHH
Confidence            3777777777777777764432 23433333333333333333333333344444433432    35555556666543


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.23  E-value=0.095  Score=24.98  Aligned_cols=25  Identities=12%  Similarity=0.234  Sum_probs=16.8

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      .|+|  .+||+.+...            +.|-.||.||.
T Consensus         2 ~~~C--~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVC--PVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEEC--CCCCCEeECC------------cCCCcCcCCCC
Confidence            3778  7788654422            25678888885


No 59 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.22  E-value=0.12  Score=34.33  Aligned_cols=24  Identities=21%  Similarity=0.411  Sum_probs=19.2

Q ss_pred             CcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcch
Q psy8966         126 KPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSI  164 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~  164 (175)
                      +.|+|  ++||+...             |+.|-.||+||
T Consensus       133 ~~~vC--~vCGy~~~-------------ge~P~~CPiCg  156 (166)
T COG1592         133 KVWVC--PVCGYTHE-------------GEAPEVCPICG  156 (166)
T ss_pred             CEEEc--CCCCCccc-------------CCCCCcCCCCC
Confidence            36999  88997443             68999999998


No 60 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.83  E-value=0.17  Score=31.18  Aligned_cols=14  Identities=14%  Similarity=0.024  Sum_probs=7.9

Q ss_pred             CCccccCCcchhhh
Q psy8966         154 GKYTAEVPGSILDC  167 (175)
Q Consensus       154 ~~~~~~C~~c~~~~  167 (175)
                      ++.|-.||+||..|
T Consensus        23 nk~PivCP~CG~~~   36 (108)
T PF09538_consen   23 NKDPIVCPKCGTEF   36 (108)
T ss_pred             CCCCccCCCCCCcc
Confidence            44566666666544


No 61 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.10  E-value=0.058  Score=41.13  Aligned_cols=63  Identities=33%  Similarity=0.628  Sum_probs=51.3

Q ss_pred             ceeccCCCcccccCCHHHHHHHHh--hhcCC--CcccCCcc--cchHHHhchhhHHHHHHHhcCCccccCCcc
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIR--THTGE--KPYRCAHE--FCSKSFKTSGDLQKHVRTHTGKYTAEVPGS  163 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~~~--~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c  163 (175)
                      ++.|.  .|...|.....|..|..  .|.++  +++.|  +  .|++.|.....+.+|...|++..+..+..-
T Consensus       289 ~~~~~--~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~--p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (467)
T COG5048         289 PIKSK--QCNISFSRSSPLTRHLRSVNHSGESLKPFSC--PYSLCGKLFSRNDALKRHILLHTSISPAKEKLL  357 (467)
T ss_pred             CCCCc--cccCCccccccccccccccccccccCCceee--eccCCCccccccccccCCcccccCCCccccccc
Confidence            46665  88888888888888988  78888  88999  6  699999999888899888888766666543


No 62 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=88.56  E-value=0.23  Score=26.67  Aligned_cols=32  Identities=9%  Similarity=0.075  Sum_probs=15.8

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      .|.|  +.||..-..+....+     ....+|.|+.||+
T Consensus        27 ~F~C--PnCGe~~I~Rc~~CR-----k~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPC--PNCGEVEIYRCAKCR-----KLGNPYRCPKCGF   58 (61)
T ss_pred             EeeC--CCCCceeeehhhhHH-----HcCCceECCCcCc
Confidence            3666  556654443332222     1235667777664


No 63 
>KOG2893|consensus
Probab=88.11  E-value=0.16  Score=35.48  Aligned_cols=40  Identities=25%  Similarity=0.591  Sum_probs=33.1

Q ss_pred             CCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHH
Q psy8966         103 EYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKH  148 (175)
Q Consensus       103 ~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H  148 (175)
                      +.|++.|.+...|.+|++    .|-|+|  -+|.+...+--.|..|
T Consensus        14 wycnrefddekiliqhqk----akhfkc--hichkkl~sgpglsih   53 (341)
T KOG2893|consen   14 WYCNREFDDEKILIQHQK----AKHFKC--HICHKKLFSGPGLSIH   53 (341)
T ss_pred             eecccccchhhhhhhhhh----hcccee--eeehhhhccCCCceee
Confidence            489999999999999965    457999  9999988777666655


No 64 
>KOG2893|consensus
Probab=87.65  E-value=0.19  Score=35.16  Aligned_cols=50  Identities=24%  Similarity=0.612  Sum_probs=38.6

Q ss_pred             CCCccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHH-HHHhc
Q psy8966           9 IRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKH-VRTHT   67 (175)
Q Consensus         9 ~~~~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H-~~~h~   67 (175)
                      .++|-+   .|++.|.+..-|.+|++.    +-|+|  .+|.+...+...|..| |.+|.
T Consensus         9 ~kpwcw---ycnrefddekiliqhqka----khfkc--hichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen    9 DKPWCW---YCNREFDDEKILIQHQKA----KHFKC--HICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             CCceee---ecccccchhhhhhhhhhh----cccee--eeehhhhccCCCceeehhhhhh
Confidence            356655   899999999999999875    34899  5599987777777777 55564


No 65 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=86.69  E-value=0.22  Score=22.13  Aligned_cols=9  Identities=22%  Similarity=0.069  Sum_probs=5.3

Q ss_pred             cCCcchhhh
Q psy8966         159 EVPGSILDC  167 (175)
Q Consensus       159 ~C~~c~~~~  167 (175)
                      .|+.||+.|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            566666655


No 66 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=85.60  E-value=0.23  Score=25.22  Aligned_cols=11  Identities=0%  Similarity=-0.260  Sum_probs=6.4

Q ss_pred             ccccCCcchhh
Q psy8966         156 YTAEVPGSILD  166 (175)
Q Consensus       156 ~~~~C~~c~~~  166 (175)
                      .+..|+.||..
T Consensus        18 ~~irC~~CG~r   28 (44)
T smart00659       18 DVVRCRECGYR   28 (44)
T ss_pred             CceECCCCCce
Confidence            55666666644


No 67 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.75  E-value=0.28  Score=26.43  Aligned_cols=10  Identities=10%  Similarity=0.019  Sum_probs=6.9

Q ss_pred             ccccCCcchh
Q psy8966         156 YTAEVPGSIL  165 (175)
Q Consensus       156 ~~~~C~~c~~  165 (175)
                      .+|.|+.||+
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            5677777765


No 68 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.09  E-value=0.82  Score=24.22  Aligned_cols=25  Identities=24%  Similarity=0.551  Sum_probs=13.1

Q ss_pred             CCCCccCCCccchhhccChHHHHHHHh
Q psy8966           8 GIRPYKCPVEYCEKAFSTQYSRKAHIR   34 (175)
Q Consensus         8 ~~~~~~C~~~~C~~~f~~~~~L~~h~~   34 (175)
                      |+.-+.|+  -||..|....+..+|++
T Consensus        14 GE~~lrCP--RC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          14 GEEFLRCP--RCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CceeeeCC--chhHHHHHhHHHHHHhh
Confidence            44445554  55555555555555554


No 69 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.42  E-value=0.54  Score=29.60  Aligned_cols=13  Identities=15%  Similarity=0.475  Sum_probs=6.1

Q ss_pred             CcccCCcccchHHHh
Q psy8966         126 KPYRCAHEFCSKSFK  140 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~  140 (175)
                      .|..|  ++||..|.
T Consensus        25 ~p~vc--P~cg~~~~   37 (129)
T TIGR02300        25 RPAVS--PYTGEQFP   37 (129)
T ss_pred             CCccC--CCcCCccC
Confidence            34455  44554443


No 70 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=82.86  E-value=0.96  Score=29.97  Aligned_cols=30  Identities=10%  Similarity=0.134  Sum_probs=21.6

Q ss_pred             CCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         125 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      ..-|.|  +.|+..|....++.         .-|.||.||.
T Consensus       107 ~~~Y~C--p~c~~r~tf~eA~~---------~~F~Cp~Cg~  136 (158)
T TIGR00373       107 NMFFIC--PNMCVRFTFNEAME---------LNFTCPRCGA  136 (158)
T ss_pred             CCeEEC--CCCCcEeeHHHHHH---------cCCcCCCCCC
Confidence            345888  77888887777663         3688888874


No 71 
>PHA00626 hypothetical protein
Probab=82.32  E-value=0.18  Score=26.70  Aligned_cols=13  Identities=23%  Similarity=0.409  Sum_probs=6.2

Q ss_pred             CcccCCcccchHHHh
Q psy8966         126 KPYRCAHEFCSKSFK  140 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~  140 (175)
                      ..|+|  +.||+.|.
T Consensus        22 nrYkC--kdCGY~ft   34 (59)
T PHA00626         22 DDYVC--CDCGYNDS   34 (59)
T ss_pred             cceEc--CCCCCeec
Confidence            34555  44555444


No 72 
>KOG1146|consensus
Probab=81.68  E-value=0.95  Score=39.47  Aligned_cols=56  Identities=34%  Similarity=0.694  Sum_probs=43.0

Q ss_pred             ccCCcceeccCCCcccccCCHHHHHHHHhh-hc------------------------CCCcccCCcccchHHHhchhhHH
Q psy8966          92 HSGIRPYKCPVEYCEKAFSTQYSRKAHIRT-HT------------------------GEKPYRCAHEFCSKSFKTSGDLQ  146 (175)
Q Consensus        92 ~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~-h~------------------------~~~~~~C~~~~C~~~f~~~~~l~  146 (175)
                      +...+.+.|+  .|+..|.....|..|++. |.                        +-++|.|  ..|...+..+.+|.
T Consensus       460 ~S~~kt~~cp--kc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C--~~C~~stttng~Ls  535 (1406)
T KOG1146|consen  460 HSFFKTLKCP--KCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPC--RACNYSTTTNGNLS  535 (1406)
T ss_pred             ecccccccCC--ccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccc--eeeeeeeecchHHH
Confidence            3345677887  899999999899999876 11                        1246888  88999999999999


Q ss_pred             HHHHH
Q psy8966         147 KHVRT  151 (175)
Q Consensus       147 ~H~~~  151 (175)
                      +|+.+
T Consensus       536 ihlqS  540 (1406)
T KOG1146|consen  536 IHLQS  540 (1406)
T ss_pred             HHHHH
Confidence            99874


No 73 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.91  E-value=0.44  Score=23.41  Aligned_cols=10  Identities=20%  Similarity=-0.134  Sum_probs=5.4

Q ss_pred             ccccCCcchh
Q psy8966         156 YTAEVPGSIL  165 (175)
Q Consensus       156 ~~~~C~~c~~  165 (175)
                      ..-.||.||.
T Consensus        25 ~~~~CP~Cg~   34 (41)
T smart00834       25 PLATCPECGG   34 (41)
T ss_pred             CCCCCCCCCC
Confidence            4445666654


No 74 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=80.76  E-value=1.5  Score=23.31  Aligned_cols=25  Identities=36%  Similarity=0.707  Sum_probs=14.0

Q ss_pred             CCCcccCCcccchHHHhchhhHHHHHH
Q psy8966         124 GEKPYRCAHEFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus       124 ~~~~~~C~~~~C~~~f~~~~~l~~H~~  150 (175)
                      |+.-+.|  +.|+..|....+..+|..
T Consensus        14 GE~~lrC--PRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          14 GEEFLRC--PRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CceeeeC--CchhHHHHHhHHHHHHhh
Confidence            3444556  556666666666655553


No 75 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=80.11  E-value=1.1  Score=30.32  Aligned_cols=29  Identities=17%  Similarity=0.301  Sum_probs=19.9

Q ss_pred             CcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         126 KPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      .-|.|  +.|+..|....++         +.-|.||.||.
T Consensus       116 ~~Y~C--p~C~~rytf~eA~---------~~~F~Cp~Cg~  144 (178)
T PRK06266        116 MFFFC--PNCHIRFTFDEAM---------EYGFRCPQCGE  144 (178)
T ss_pred             CEEEC--CCCCcEEeHHHHh---------hcCCcCCCCCC
Confidence            44888  6688777766655         24688888873


No 76 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=80.07  E-value=0.69  Score=20.10  Aligned_cols=9  Identities=11%  Similarity=-0.005  Sum_probs=4.5

Q ss_pred             ccccCCcch
Q psy8966         156 YTAEVPGSI  164 (175)
Q Consensus       156 ~~~~C~~c~  164 (175)
                      .+|.||.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            345555554


No 77 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=78.91  E-value=0.41  Score=23.96  Aligned_cols=29  Identities=24%  Similarity=0.486  Sum_probs=14.4

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchh
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSIL  165 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~  165 (175)
                      |.|  ..||..|.....+      .. ..+..||.||.
T Consensus         6 y~C--~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRC--EECGHEFEVLQSI------SE-DDPVPCPECGS   34 (42)
T ss_pred             EEe--CCCCCEEEEEEEc------CC-CCCCcCCCCCC
Confidence            556  5566555533221      11 45556666664


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=78.37  E-value=1.1  Score=29.29  Aligned_cols=36  Identities=17%  Similarity=0.181  Sum_probs=20.7

Q ss_pred             CCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhh
Q psy8966         125 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                      ..-|.|  +.|+..|.....+..   .. .+.-|.||.||..
T Consensus        97 ~~~Y~C--p~C~~~y~~~ea~~~---~d-~~~~f~Cp~Cg~~  132 (147)
T smart00531       97 NAYYKC--PNCQSKYTFLEANQL---LD-MDGTFTCPRCGEE  132 (147)
T ss_pred             CcEEEC--cCCCCEeeHHHHHHh---cC-CCCcEECCCCCCE
Confidence            345888  668877775433321   01 2333888888754


No 79 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=77.89  E-value=0.55  Score=24.36  Aligned_cols=28  Identities=14%  Similarity=0.316  Sum_probs=14.9

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhh
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                      .|+|  ..||+.|...          .......|+.||..
T Consensus         6 ~Y~C--~~Cg~~~~~~----------~~~~~irCp~Cg~r   33 (49)
T COG1996           6 EYKC--ARCGREVELD----------QETRGIRCPYCGSR   33 (49)
T ss_pred             EEEh--hhcCCeeehh----------hccCceeCCCCCcE
Confidence            4666  6666665211          22345667777654


No 80 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=77.78  E-value=0.67  Score=21.72  Aligned_cols=12  Identities=8%  Similarity=-0.108  Sum_probs=6.7

Q ss_pred             ccccCCcchhhh
Q psy8966         156 YTAEVPGSILDC  167 (175)
Q Consensus       156 ~~~~C~~c~~~~  167 (175)
                      .+-.|+.||...
T Consensus        16 ~~irC~~CG~RI   27 (32)
T PF03604_consen   16 DPIRCPECGHRI   27 (32)
T ss_dssp             STSSBSSSS-SE
T ss_pred             CcEECCcCCCeE
Confidence            455666666554


No 81 
>KOG4173|consensus
Probab=77.03  E-value=1.7  Score=29.87  Aligned_cols=80  Identities=35%  Similarity=0.681  Sum_probs=58.6

Q ss_pred             eeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcccccCCHHHHHHHH-h
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCEKAFSTQYSRKAHI-R  120 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~-~  120 (175)
                      |.|+..+|-..|.+......|..+-++                             -.|.  .|.+.|.+.--|..|+ .
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~-----------------------------~sCs--~C~r~~Pt~hLLd~HI~E  128 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG-----------------------------NSCS--FCKRAFPTGHLLDAHILE  128 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc-----------------------------chhH--HHHHhCCchhhhhHHHHH
Confidence            677766677777776666666544332                             2464  8999999988888886 3


Q ss_pred             hh---------cCCCcccCCcccchHHHhchhhHHHHHH-Hh
Q psy8966         121 TH---------TGEKPYRCAHEFCSKSFKTSGDLQKHVR-TH  152 (175)
Q Consensus       121 ~h---------~~~~~~~C~~~~C~~~f~~~~~l~~H~~-~h  152 (175)
                      +|         .|...|.|-.+.|+..|.+..+-..|+- +|
T Consensus       129 ~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  129 WHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             HHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            44         2445699977889999999999999986 45


No 82 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=76.51  E-value=0.4  Score=25.09  Aligned_cols=11  Identities=45%  Similarity=1.274  Sum_probs=5.7

Q ss_pred             ccCCcccchHHHh
Q psy8966         128 YRCAHEFCSKSFK  140 (175)
Q Consensus       128 ~~C~~~~C~~~f~  140 (175)
                      |.|  ..||..|.
T Consensus         6 y~C--~~Cg~~fe   16 (52)
T TIGR02605         6 YRC--TACGHRFE   16 (52)
T ss_pred             EEe--CCCCCEeE
Confidence            455  44555444


No 83 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=75.28  E-value=0.42  Score=25.08  Aligned_cols=32  Identities=31%  Similarity=0.592  Sum_probs=17.5

Q ss_pred             CCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcch
Q psy8966         125 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSI  164 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~  164 (175)
                      ...|.|  +.|+..|=..-++-.|..+|      .||+|.
T Consensus        19 ~~~y~C--~~C~~~FC~dCD~fiHE~LH------~CPGC~   50 (51)
T PF07975_consen   19 SSRYRC--PKCKNHFCIDCDVFIHETLH------NCPGCE   50 (51)
T ss_dssp             -EEE----TTTT--B-HHHHHTTTTTS-------SSSTT-
T ss_pred             CCeEEC--CCCCCccccCcChhhhcccc------CCcCCC
Confidence            456888  77888888877777776555      677663


No 84 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.07  E-value=1.1  Score=27.36  Aligned_cols=12  Identities=8%  Similarity=-0.216  Sum_probs=5.5

Q ss_pred             ccccCCcchhhh
Q psy8966         156 YTAEVPGSILDC  167 (175)
Q Consensus       156 ~~~~C~~c~~~~  167 (175)
                      .|..||+||.+|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            444444444444


No 85 
>KOG2231|consensus
Probab=74.69  E-value=8.5  Score=31.65  Aligned_cols=43  Identities=19%  Similarity=0.264  Sum_probs=21.8

Q ss_pred             hhccChHHHHHHHhhhcCCCCeeccc-c------ccCcccCChHHHHHHHHH
Q psy8966          21 KAFSTQYSRKAHIRTHTGEKPYRCAH-E------FCSKSFKTSGDLQKHVRT   65 (175)
Q Consensus        21 ~~f~~~~~L~~h~~~~~~~~~~~C~~-~------~C~~~f~~~~~l~~H~~~   65 (175)
                      ..|....+|+.|+...++.  +.|.. .      .|.....+...|+.|++.
T Consensus       122 ~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~  171 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRAELNLHLMF  171 (669)
T ss_pred             cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHHHHHHHHhc
Confidence            4445778888888643332  23321 0      022233445667777664


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=74.61  E-value=0.82  Score=23.30  Aligned_cols=9  Identities=11%  Similarity=-0.049  Sum_probs=5.0

Q ss_pred             cccCCcchh
Q psy8966         157 TAEVPGSIL  165 (175)
Q Consensus       157 ~~~C~~c~~  165 (175)
                      ...||.||.
T Consensus        21 ~~~Cp~CG~   29 (46)
T PRK00398         21 GVRCPYCGY   29 (46)
T ss_pred             ceECCCCCC
Confidence            455666654


No 87 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=71.12  E-value=7.8  Score=24.05  Aligned_cols=54  Identities=24%  Similarity=0.443  Sum_probs=37.8

Q ss_pred             eccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcch
Q psy8966          99 KCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSI  164 (175)
Q Consensus        99 ~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~  164 (175)
                      .|-  .|...|.......  ...-.....|.|  +.|...|-...++-.|...|      .|++|.
T Consensus        57 ~C~--~C~~~f~~~~~~~--~~~~~~~~~y~C--~~C~~~FC~dCD~fiHe~Lh------~CPGC~  110 (112)
T TIGR00622        57 FCF--GCQGPFPKPPVSP--FDELKDSHRYVC--AVCKNVFCVDCDVFVHESLH------CCPGCI  110 (112)
T ss_pred             ccc--CcCCCCCCccccc--ccccccccceeC--CCCCCccccccchhhhhhcc------CCcCCC
Confidence            475  7988887643111  000123446999  88999999999999999888      488875


No 88 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=69.17  E-value=4.5  Score=20.42  Aligned_cols=27  Identities=15%  Similarity=0.284  Sum_probs=19.4

Q ss_pred             cceeccCCCcccccCCHHHHHHHHhhh
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRTH  122 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~h  122 (175)
                      +||...|-+|......++.|..|++..
T Consensus        17 kp~~ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   17 KPFKYKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             CCccceeecCCcccchHHHHHHHHHHH
Confidence            444333348999999999999998754


No 89 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=68.80  E-value=1.2  Score=21.52  Aligned_cols=8  Identities=0%  Similarity=-0.350  Sum_probs=3.6

Q ss_pred             ccCCcchh
Q psy8966         158 AEVPGSIL  165 (175)
Q Consensus       158 ~~C~~c~~  165 (175)
                      ..|+.|+.
T Consensus        26 v~C~~C~~   33 (38)
T TIGR02098        26 VRCGKCGH   33 (38)
T ss_pred             EECCCCCC
Confidence            44444443


No 90 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=68.44  E-value=1.5  Score=20.74  Aligned_cols=17  Identities=24%  Similarity=0.225  Sum_probs=10.9

Q ss_pred             ccccCCcchhhhccccc
Q psy8966         156 YTAEVPGSILDCLSGRF  172 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~~  172 (175)
                      ..+.|+.|+..+..++|
T Consensus         3 ~~~~C~nC~R~v~a~Rf   19 (33)
T PF08209_consen    3 PYVECPNCGRPVAASRF   19 (33)
T ss_dssp             -EEE-TTTSSEEEGGGH
T ss_pred             CeEECCCCcCCcchhhh
Confidence            34778888887776654


No 91 
>KOG4124|consensus
Probab=66.11  E-value=1  Score=33.52  Aligned_cols=53  Identities=45%  Similarity=0.840  Sum_probs=39.5

Q ss_pred             CcceeccCCCcccccCCHHHHHHHHhhhc-------------------CCCcccCCcccchHHHhchhhHHHHH
Q psy8966          95 IRPYKCPVEYCEKAFSTQYSRKAHIRTHT-------------------GEKPYRCAHEFCSKSFKTSGDLQKHV  149 (175)
Q Consensus        95 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~-------------------~~~~~~C~~~~C~~~f~~~~~l~~H~  149 (175)
                      .+++.|+++.|++.+....+|..|....+                   ..|+|.|  ++|.+.++....|.-|.
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~--~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRC--EVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccC--hhhhhhhccCCCCCcee
Confidence            58999999999999999888888754321                   2367888  88888888766554443


No 92 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=65.98  E-value=3.1  Score=21.52  Aligned_cols=17  Identities=35%  Similarity=0.743  Sum_probs=8.2

Q ss_pred             CcccccCCH-----HHHHHHHh
Q psy8966         104 YCEKAFSTQ-----YSRKAHIR  120 (175)
Q Consensus       104 ~C~~~f~~~-----~~l~~H~~  120 (175)
                      .|++.+...     ++|.+|+.
T Consensus        23 ~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       23 YCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             CCCCEeeeCCCCCcHHHHHHHH
Confidence            555555433     34555544


No 93 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=64.43  E-value=4  Score=25.07  Aligned_cols=19  Identities=16%  Similarity=0.275  Sum_probs=11.3

Q ss_pred             CcccccCCHHHHHHHHhhh
Q psy8966         104 YCEKAFSTQYSRKAHIRTH  122 (175)
Q Consensus       104 ~C~~~f~~~~~l~~H~~~h  122 (175)
                      .|++.+.+...+..|.+.+
T Consensus        89 ~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             CCCcEeccHHHHHHHHHHh
Confidence            5666666666666665544


No 94 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=63.84  E-value=7.6  Score=23.81  Aligned_cols=25  Identities=36%  Similarity=0.822  Sum_probs=21.5

Q ss_pred             eec----cccccCcccCChHHHHHHHHHhcC
Q psy8966          42 YRC----AHEFCSKSFKTSGDLQKHVRTHTG   68 (175)
Q Consensus        42 ~~C----~~~~C~~~f~~~~~l~~H~~~h~~   68 (175)
                      |.|    ..  |+..+.+...|..|++.+++
T Consensus        81 ~~C~~~~~~--C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPH--CGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCC--CCcEeccHHHHHHHHHHhcC
Confidence            788    65  99999999999999987664


No 95 
>KOG2482|consensus
Probab=62.94  E-value=31  Score=26.05  Aligned_cols=103  Identities=22%  Similarity=0.409  Sum_probs=63.1

Q ss_pred             eeccccccCcccCChHHHHHHHHH--hcCCCCCCCCCCccchh-------------cc--------------cchhhhhc
Q psy8966          42 YRCAHEFCSKSFKTSGDLQKHVRT--HTGKYTPGPGIDSRLIV-------------RE--------------DFVHLRIH   92 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~~~l~~H~~~--h~~~~~~~~~~~~~~~~-------------~~--------------~~~~~~~~   92 (175)
                      +.|-.  |.+.|..+..|..||+.  |....|....++..+.+             ..              .+..+..+
T Consensus       196 ~~CLy--CekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  196 LRCLY--CEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             heeee--eccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcC
Confidence            67866  99999999999999976  33222311111111100             00              01111111


Q ss_pred             cCCcc--eeccCCCcccccCCHHHHHHHHhhhcC---------------------------CCcccCCcccchHHHhchh
Q psy8966          93 SGIRP--YKCPVEYCEKAFSTQYSRKAHIRTHTG---------------------------EKPYRCAHEFCSKSFKTSG  143 (175)
Q Consensus        93 ~~~~~--~~C~~~~C~~~f~~~~~l~~H~~~h~~---------------------------~~~~~C~~~~C~~~f~~~~  143 (175)
                       +..+  ..|.  .|....-+...|..|++.-+.                           .+.-.|  .+|.-.|....
T Consensus       274 -~a~a~~v~CL--fC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c--~~cd~~F~~e~  348 (423)
T KOG2482|consen  274 -DAEALSVVCL--FCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRC--AECDLSFWKEP  348 (423)
T ss_pred             -CCCccceEEE--eeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhcccc--ccccccccCcc
Confidence             1122  4786  899888888999999875321                           112567  78889999999


Q ss_pred             hHHHHHHH
Q psy8966         144 DLQKHVRT  151 (175)
Q Consensus       144 ~l~~H~~~  151 (175)
                      .|..||.-
T Consensus       349 ~l~~hm~e  356 (423)
T KOG2482|consen  349 GLLIHMVE  356 (423)
T ss_pred             hhhhhccc
Confidence            99999964


No 96 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=61.78  E-value=3.7  Score=26.34  Aligned_cols=24  Identities=46%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             eeccCCCcccccCCHHHHHHHHhhhcCCC
Q psy8966          98 YKCPVEYCEKAFSTQYSRKAHIRTHTGEK  126 (175)
Q Consensus        98 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~  126 (175)
                      ..|-  +||+.|..   |.+|...|+|-.
T Consensus        73 i~cl--ecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   73 IICL--ECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             EE-T--BT--EESB---HHHHHHHTT-S-
T ss_pred             eEEc--cCCcccch---HHHHHHHccCCC
Confidence            3453  56666544   356666655543


No 97 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=60.19  E-value=1.5  Score=24.90  Aligned_cols=18  Identities=33%  Similarity=0.562  Sum_probs=9.1

Q ss_pred             CCcccCCcccchHHHhch
Q psy8966         125 EKPYRCAHEFCSKSFKTS  142 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~  142 (175)
                      +.-+.|++.+||..|...
T Consensus        25 ~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         25 ERYHQCQNVNCSATFITY   42 (72)
T ss_pred             eeeeecCCCCCCCEEEEE
Confidence            334556333566665543


No 98 
>KOG4377|consensus
Probab=57.37  E-value=10  Score=29.09  Aligned_cols=29  Identities=24%  Similarity=0.425  Sum_probs=20.8

Q ss_pred             CCCccCCCccchhhccChHHHHHHHhhhc
Q psy8966           9 IRPYKCPVEYCEKAFSTQYSRKAHIRTHT   37 (175)
Q Consensus         9 ~~~~~C~~~~C~~~f~~~~~L~~h~~~~~   37 (175)
                      ...|.|..+.|+..+-.+.++.+|...|.
T Consensus       269 rEhyhcl~e~C~ykr~~k~DvirH~~~hk  297 (480)
T KOG4377|consen  269 REHYHCLNEYCFYKRGQKNDVIRHVEIHK  297 (480)
T ss_pred             chhhcccCccccccccchhhhHHHHHHHh
Confidence            44577766678777777888888877664


No 99 
>KOG3408|consensus
Probab=56.52  E-value=8.3  Score=24.18  Aligned_cols=27  Identities=26%  Similarity=0.498  Sum_probs=22.9

Q ss_pred             cCCcceeccCCCcccccCCHHHHHHHHhh
Q psy8966          93 SGIRPYKCPVEYCEKAFSTQYSRKAHIRT  121 (175)
Q Consensus        93 ~~~~~~~C~~~~C~~~f~~~~~l~~H~~~  121 (175)
                      .|.+.|.|.  .|.+-|.+.+.|..|.++
T Consensus        53 PG~GqfyCi--~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCI--ECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehh--hhhhhhcchHHHHHHHhc
Confidence            356788997  999999999999999754


No 100
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=55.01  E-value=3.8  Score=21.86  Aligned_cols=17  Identities=18%  Similarity=0.534  Sum_probs=6.9

Q ss_pred             HHHHHHhhhcCCCcccC
Q psy8966         114 SRKAHIRTHTGEKPYRC  130 (175)
Q Consensus       114 ~l~~H~~~h~~~~~~~C  130 (175)
                      .|..|....-..++..|
T Consensus        25 ~l~~H~~~~C~~~~v~C   41 (60)
T PF02176_consen   25 ELDDHLENECPKRPVPC   41 (60)
T ss_dssp             CHHHHHHTTSTTSEEE-
T ss_pred             HHHHHHHccCCCCcEEC
Confidence            44455443333334444


No 101
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=54.62  E-value=7.3  Score=19.39  Aligned_cols=17  Identities=35%  Similarity=0.853  Sum_probs=6.2

Q ss_pred             ccchHHHhch----hhHHHHH
Q psy8966         133 EFCSKSFKTS----GDLQKHV  149 (175)
Q Consensus       133 ~~C~~~f~~~----~~l~~H~  149 (175)
                      ..|++.+...    +.|.+|+
T Consensus        20 ~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   20 KYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             TTTTEE-----SSTHHHHHHH
T ss_pred             CCCCeEEeeCCCcHHHHHHhh
Confidence            4455444432    3444554


No 102
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=54.55  E-value=8.6  Score=16.90  Aligned_cols=19  Identities=16%  Similarity=0.564  Sum_probs=10.9

Q ss_pred             cCCcccchHHHhchhhHHHHHH
Q psy8966         129 RCAHEFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus       129 ~C~~~~C~~~f~~~~~l~~H~~  150 (175)
                      .|  ++|++.+ ....+..|.-
T Consensus         3 ~C--PiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QC--PVCFREV-PENLINSHLD   21 (26)
T ss_pred             cC--CCCcCcc-cHHHHHHHHH
Confidence            46  6677766 4445555553


No 103
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=54.27  E-value=8.7  Score=21.91  Aligned_cols=6  Identities=0%  Similarity=-0.319  Sum_probs=2.7

Q ss_pred             cCCcch
Q psy8966         159 EVPGSI  164 (175)
Q Consensus       159 ~C~~c~  164 (175)
                      .|+.|+
T Consensus        35 ~ce~c~   40 (82)
T COG2331          35 TCEECG   40 (82)
T ss_pred             cChhhC
Confidence            444444


No 104
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=53.96  E-value=7.3  Score=24.93  Aligned_cols=20  Identities=40%  Similarity=0.416  Sum_probs=11.1

Q ss_pred             CcccccCCHHHHHHHHhhhcCCC
Q psy8966         104 YCEKAFSTQYSRKAHIRTHTGEK  126 (175)
Q Consensus       104 ~C~~~f~~~~~l~~H~~~h~~~~  126 (175)
                      ++|+.|.   +|++|..+|.+--
T Consensus        81 EDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          81 EDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             ccCcchH---HHHHHHhcccCCC
Confidence            5666653   3556666665533


No 105
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=52.71  E-value=5.9  Score=21.05  Aligned_cols=8  Identities=50%  Similarity=1.041  Sum_probs=4.4

Q ss_pred             ccchHHHh
Q psy8966         133 EFCSKSFK  140 (175)
Q Consensus       133 ~~C~~~f~  140 (175)
                      ++|++.|.
T Consensus         9 ~~Cg~~~~   16 (54)
T PF14446_consen    9 PVCGKKFK   16 (54)
T ss_pred             hhhCCccc
Confidence            55665554


No 106
>PF12907 zf-met2:  Zinc-binding
Probab=52.32  E-value=11  Score=18.72  Aligned_cols=26  Identities=23%  Similarity=0.585  Sum_probs=15.9

Q ss_pred             ccCCcccchHHHhc---hhhHHHHHHHhcCC
Q psy8966         128 YRCAHEFCSKSFKT---SGDLQKHVRTHTGK  155 (175)
Q Consensus       128 ~~C~~~~C~~~f~~---~~~l~~H~~~h~~~  155 (175)
                      ++|  .+|...|..   ...|..|....+.+
T Consensus         2 i~C--~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IIC--KICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCc--HHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            467  777765554   35577777754443


No 107
>KOG2593|consensus
Probab=51.82  E-value=14  Score=28.70  Aligned_cols=36  Identities=11%  Similarity=0.108  Sum_probs=24.5

Q ss_pred             CCCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcch
Q psy8966         124 GEKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSI  164 (175)
Q Consensus       124 ~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~  164 (175)
                      ....|.|  +.|.+.|..-.   .-.-+-..+.-|.|..|+
T Consensus       125 ~~~~Y~C--p~C~kkyt~Le---a~~L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVC--PNCQKKYTSLE---ALQLLDNETGEFHCENCG  160 (436)
T ss_pred             ccccccC--CccccchhhhH---HHHhhcccCceEEEecCC
Confidence            3456999  88999888543   333344445778899987


No 108
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=51.18  E-value=14  Score=17.74  Aligned_cols=33  Identities=27%  Similarity=0.816  Sum_probs=21.0

Q ss_pred             cCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccC
Q psy8966          13 KCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFK   54 (175)
Q Consensus        13 ~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~   54 (175)
                      .|+  .|+..|.-..+     +...+.....|+.  |+..|.
T Consensus         4 ~CP--~C~~~f~v~~~-----~l~~~~~~vrC~~--C~~~f~   36 (37)
T PF13719_consen    4 TCP--NCQTRFRVPDD-----KLPAGGRKVRCPK--CGHVFR   36 (37)
T ss_pred             ECC--CCCceEEcCHH-----HcccCCcEEECCC--CCcEee
Confidence            466  88888876553     1223334578976  988764


No 109
>KOG4167|consensus
Probab=50.91  E-value=7.7  Score=32.11  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=22.8

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHhcC
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTHTG  154 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h~~  154 (175)
                      |.|  -+|++.|---.++..||++|..
T Consensus       793 FpC--reC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPC--RECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeh--HHHHHHHHHHhhhhHHHHHHHH
Confidence            999  8899999999999999999853


No 110
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=50.54  E-value=8.3  Score=20.58  Aligned_cols=17  Identities=18%  Similarity=0.405  Sum_probs=10.2

Q ss_pred             CCCcccCCcccchHHHhch
Q psy8966         124 GEKPYRCAHEFCSKSFKTS  142 (175)
Q Consensus       124 ~~~~~~C~~~~C~~~f~~~  142 (175)
                      +...|.|  +.||..+..+
T Consensus        11 ~~v~~~C--p~cGipthcS   27 (55)
T PF13824_consen   11 AHVNFEC--PDCGIPTHCS   27 (55)
T ss_pred             cccCCcC--CCCCCcCccC
Confidence            3455777  6677655544


No 111
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=49.28  E-value=2.2  Score=29.85  Aligned_cols=16  Identities=38%  Similarity=0.883  Sum_probs=10.5

Q ss_pred             cceeccCCCcccccCCHH
Q psy8966          96 RPYKCPVEYCEKAFSTQY  113 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~  113 (175)
                      +...||  .|+..|..+.
T Consensus         4 k~~~CP--vC~~~F~~~~   19 (214)
T PF09986_consen    4 KKITCP--VCGKEFKTKK   19 (214)
T ss_pred             CceECC--CCCCeeeeeE
Confidence            446676  6887776653


No 112
>KOG2231|consensus
Probab=48.93  E-value=32  Score=28.50  Aligned_cols=102  Identities=20%  Similarity=0.280  Sum_probs=57.7

Q ss_pred             cccCChHHHHHHHHHhcCCCCCCC---CCCccchh------cccchhhhhccC-C----cceeccCCCcccccCCHHHHH
Q psy8966          51 KSFKTSGDLQKHVRTHTGKYTPGP---GIDSRLIV------REDFVHLRIHSG-I----RPYKCPVEYCEKAFSTQYSRK  116 (175)
Q Consensus        51 ~~f~~~~~l~~H~~~h~~~~~~~~---~~~~~~~~------~~~~~~~~~~~~-~----~~~~C~~~~C~~~f~~~~~l~  116 (175)
                      ..|.+.-.|..|+...+....|..   ......+.      .....|++...- +    +--.|.  .|...|.....|.
T Consensus       122 ~~~~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~--~C~~~fld~~el~  199 (669)
T KOG2231|consen  122 TEFKSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCK--FCHERFLDDDELY  199 (669)
T ss_pred             cchhHHHHHHHHHHHhhhhhccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccch--hhhhhhccHHHHH
Confidence            444577889999976555433222   11111111      122234442211 1    123576  7999999999999


Q ss_pred             HHHhhhcCCCcccCCcccc------hHHHhchhhHHHHHHHhcCCccccCC--cch
Q psy8966         117 AHIRTHTGEKPYRCAHEFC------SKSFKTSGDLQKHVRTHTGKYTAEVP--GSI  164 (175)
Q Consensus       117 ~H~~~h~~~~~~~C~~~~C------~~~f~~~~~l~~H~~~h~~~~~~~C~--~c~  164 (175)
                      .|++.++    |-|  ..|      ...|..-.+|..|.+..+    |.|+  .|.
T Consensus       200 rH~~~~h----~~c--hfC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~  245 (669)
T KOG2231|consen  200 RHLRFDH----EFC--HFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCR  245 (669)
T ss_pred             Hhhccce----ehe--eecCcccccchhcccchHHHHHhhhcC----ccccccccc
Confidence            9977653    233  334      456666778888876543    4565  554


No 113
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=47.49  E-value=20  Score=23.04  Aligned_cols=62  Identities=19%  Similarity=0.334  Sum_probs=40.2

Q ss_pred             hhhccCCcceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhch--hhHHHHHHHhcCCccccCCcchhh
Q psy8966          89 LRIHSGIRPYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTS--GDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus        89 ~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~--~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                      +..-...+-|+|.  .|........          =-||-.|    ||++.-..  .+|+.|-.+|     -.||+|..+
T Consensus        72 mnvF~d~~lYeCn--IC~etS~ee~----------FLKPneC----CgY~iCn~Cya~LWK~~~~y-----pvCPvCkTS  130 (140)
T PF05290_consen   72 MNVFLDPKLYECN--ICKETSAEER----------FLKPNEC----CGYSICNACYANLWKFCNLY-----PVCPVCKTS  130 (140)
T ss_pred             heeecCCCceecc--Ccccccchhh----------cCCcccc----cchHHHHHHHHHHHHHcccC-----CCCCccccc
Confidence            3344455789996  8887765532          2467778    88765543  4565554433     479999999


Q ss_pred             hcccc
Q psy8966         167 CLSGR  171 (175)
Q Consensus       167 ~~~~~  171 (175)
                      |.|+-
T Consensus       131 FKss~  135 (140)
T PF05290_consen  131 FKSSS  135 (140)
T ss_pred             ccccc
Confidence            98864


No 114
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=47.31  E-value=2.8  Score=22.34  Aligned_cols=20  Identities=20%  Similarity=0.263  Sum_probs=14.3

Q ss_pred             ccccCCcchhhhcccccccC
Q psy8966         156 YTAEVPGSILDCLSGRFRLF  175 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~~~~~  175 (175)
                      .+..|.-||+....++|||+
T Consensus         3 f~lVCsTCGrDlSeeRy~Ll   22 (63)
T PHA03082          3 FQLVCSTCGRDLSEERYRLL   22 (63)
T ss_pred             eeeeecccCcchhHHHHHHH
Confidence            35678888887777777764


No 115
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=46.83  E-value=2.8  Score=22.32  Aligned_cols=20  Identities=20%  Similarity=0.263  Sum_probs=14.2

Q ss_pred             ccccCCcchhhhcccccccC
Q psy8966         156 YTAEVPGSILDCLSGRFRLF  175 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~~~~~  175 (175)
                      .+..|.-||+...-++|||+
T Consensus         3 f~lvCSTCGrDlSeeRy~Ll   22 (63)
T PF05864_consen    3 FQLVCSTCGRDLSEERYRLL   22 (63)
T ss_pred             eeeeecccCCcchHHHHHHH
Confidence            35677888887777777764


No 116
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=46.31  E-value=19  Score=17.20  Aligned_cols=32  Identities=22%  Similarity=0.727  Sum_probs=20.6

Q ss_pred             cCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCccc
Q psy8966          13 KCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSF   53 (175)
Q Consensus        13 ~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f   53 (175)
                      .|+  .|+..|.-..+.     .-......+|+.  |+..|
T Consensus         4 ~Cp--~C~~~y~i~d~~-----ip~~g~~v~C~~--C~~~f   35 (36)
T PF13717_consen    4 TCP--NCQAKYEIDDEK-----IPPKGRKVRCSK--CGHVF   35 (36)
T ss_pred             ECC--CCCCEEeCCHHH-----CCCCCcEEECCC--CCCEe
Confidence            566  888888766542     223334578976  98876


No 117
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=45.94  E-value=6.8  Score=18.03  Aligned_cols=8  Identities=13%  Similarity=-0.081  Sum_probs=3.4

Q ss_pred             cccCCcch
Q psy8966         157 TAEVPGSI  164 (175)
Q Consensus       157 ~~~C~~c~  164 (175)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 118
>KOG2186|consensus
Probab=44.78  E-value=19  Score=25.86  Aligned_cols=46  Identities=17%  Similarity=0.553  Sum_probs=34.2

Q ss_pred             ccCCCccchhhccChHHHHHHHhhhcCCCCeeccccccCcccCChHHHHHHHH
Q psy8966          12 YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVR   64 (175)
Q Consensus        12 ~~C~~~~C~~~f~~~~~L~~h~~~~~~~~~~~C~~~~C~~~f~~~~~l~~H~~   64 (175)
                      |.|.  .||.+... ..+.+|+.+-.+ ..|.|-.  |+..|.. .++..|..
T Consensus         4 FtCn--vCgEsvKK-p~vekH~srCrn-~~fSCID--C~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCN--VCGESVKK-PQVEKHMSRCRN-AYFSCID--CGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehh--hhhhhccc-cchHHHHHhccC-CeeEEee--ccccccc-chhhhhhh
Confidence            5676  89998654 668889887666 5699965  9999998 55666654


No 119
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=43.08  E-value=6.7  Score=18.85  Aligned_cols=12  Identities=8%  Similarity=-0.277  Sum_probs=6.0

Q ss_pred             CCccccCCcchh
Q psy8966         154 GKYTAEVPGSIL  165 (175)
Q Consensus       154 ~~~~~~C~~c~~  165 (175)
                      +...-.|..||-
T Consensus        18 P~~~~~Cd~cg~   29 (36)
T PF05191_consen   18 PKVEGVCDNCGG   29 (36)
T ss_dssp             -SSTTBCTTTTE
T ss_pred             CCCCCccCCCCC
Confidence            344455666654


No 120
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=41.82  E-value=11  Score=22.22  Aligned_cols=13  Identities=23%  Similarity=0.767  Sum_probs=7.0

Q ss_pred             CcccCCcccchHHHh
Q psy8966         126 KPYRCAHEFCSKSFK  140 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~  140 (175)
                      -.|.|  ..|+..|.
T Consensus        52 GIW~C--~kCg~~fA   64 (89)
T COG1997          52 GIWKC--RKCGAKFA   64 (89)
T ss_pred             CeEEc--CCCCCeec
Confidence            34566  55655554


No 121
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=40.71  E-value=5  Score=26.25  Aligned_cols=37  Identities=19%  Similarity=0.284  Sum_probs=22.3

Q ss_pred             hhcCCCc----ccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhhhcc
Q psy8966         121 THTGEKP----YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILDCLS  169 (175)
Q Consensus       121 ~h~~~~~----~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~~~~  169 (175)
                      .+.|+.+    |.|  ..||....          ..+....-.||.||-.-++
T Consensus       102 Y~sGE~~g~G~l~C--~~Cg~~~~----------~~~~~~l~~Cp~C~~~~F~  142 (146)
T PF07295_consen  102 YHSGEVVGPGTLVC--ENCGHEVE----------LTHPERLPPCPKCGHTEFT  142 (146)
T ss_pred             eecCcEecCceEec--ccCCCEEE----------ecCCCcCCCCCCCCCCeee
Confidence            4455554    888  77885322          2234456788888865443


No 122
>KOG4167|consensus
Probab=40.62  E-value=11  Score=31.30  Aligned_cols=24  Identities=42%  Similarity=0.749  Sum_probs=13.2

Q ss_pred             CccCCCccchhhccChHHHHHHHhhh
Q psy8966          11 PYKCPVEYCEKAFSTQYSRKAHIRTH   36 (175)
Q Consensus        11 ~~~C~~~~C~~~f~~~~~L~~h~~~~   36 (175)
                      .|.|.  .||++|....++..|+++|
T Consensus       792 iFpCr--eC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  792 IFPCR--ECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             eeehH--HHHHHHHHHhhhhHHHHHH
Confidence            35554  5555555555555555554


No 123
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=40.49  E-value=12  Score=18.58  Aligned_cols=12  Identities=17%  Similarity=0.086  Sum_probs=6.5

Q ss_pred             ccCCcchhhhcc
Q psy8966         158 AEVPGSILDCLS  169 (175)
Q Consensus       158 ~~C~~c~~~~~~  169 (175)
                      +.|+.||..+++
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            456666655544


No 124
>KOG3408|consensus
Probab=40.47  E-value=19  Score=22.63  Aligned_cols=23  Identities=26%  Similarity=0.622  Sum_probs=21.0

Q ss_pred             cccCCcccchHHHhchhhHHHHHHH
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      .|.|  ..|.+-|.....|..|.++
T Consensus        57 qfyC--i~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYC--IECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeeh--hhhhhhhcchHHHHHHHhc
Confidence            3899  8899999999999999985


No 125
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=40.07  E-value=11  Score=22.35  Aligned_cols=14  Identities=7%  Similarity=-0.064  Sum_probs=8.2

Q ss_pred             ccccCCcchhhhcc
Q psy8966         156 YTAEVPGSILDCLS  169 (175)
Q Consensus       156 ~~~~C~~c~~~~~~  169 (175)
                      .|..|..||+.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            55566666665554


No 126
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=38.52  E-value=13  Score=19.61  Aligned_cols=13  Identities=31%  Similarity=0.943  Sum_probs=6.8

Q ss_pred             ccCCcccchHHHhch
Q psy8966         128 YRCAHEFCSKSFKTS  142 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~  142 (175)
                      |+|  +.||..|..+
T Consensus        29 W~C--~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKC--PKCGHEWKAS   41 (55)
T ss_pred             EEC--CCCCCeeEcc
Confidence            556  5565554443


No 127
>KOG2807|consensus
Probab=37.72  E-value=34  Score=25.60  Aligned_cols=59  Identities=25%  Similarity=0.490  Sum_probs=41.1

Q ss_pred             cceeccCCCcccccCCHHHHHHHHhh----------hcC-----------------CCcccCCcccchHHHhchhhHHHH
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRT----------HTG-----------------EKPYRCAHEFCSKSFKTSGDLQKH  148 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~----------h~~-----------------~~~~~C~~~~C~~~f~~~~~l~~H  148 (175)
                      -|..||  .|+....+...|.+-.+-          ..+                 ...|.|  ..|...|-...+.-.|
T Consensus       289 LP~eCp--iC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C--~~Ck~~FCldCDv~iH  364 (378)
T KOG2807|consen  289 LPIECP--ICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRC--ESCKNVFCLDCDVFIH  364 (378)
T ss_pred             CCccCC--ccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEc--hhccceeeccchHHHH
Confidence            466676  688887777777654321          111                 123888  8899999998888888


Q ss_pred             HHHhcCCccccCCcch
Q psy8966         149 VRTHTGKYTAEVPGSI  164 (175)
Q Consensus       149 ~~~h~~~~~~~C~~c~  164 (175)
                      ...|      .|++|.
T Consensus       365 esLh------~CpgCe  374 (378)
T KOG2807|consen  365 ESLH------NCPGCE  374 (378)
T ss_pred             hhhh------cCCCcC
Confidence            8777      788775


No 128
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=37.17  E-value=30  Score=23.43  Aligned_cols=29  Identities=14%  Similarity=0.288  Sum_probs=14.9

Q ss_pred             CCcccCCcccchHHHhchhhHHHHHHHhcCCccccCCcch
Q psy8966         125 EKPYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSI  164 (175)
Q Consensus       125 ~~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~  164 (175)
                      ..-|.|  +.|...|....++      ..   -|.||.||
T Consensus       111 ~~~y~C--~~~~~r~sfdeA~------~~---~F~Cp~Cg  139 (176)
T COG1675         111 NNYYVC--PNCHVKYSFDEAM------EL---GFTCPKCG  139 (176)
T ss_pred             CCceeC--CCCCCcccHHHHH------Hh---CCCCCCCC
Confidence            344666  5566555543332      11   16666666


No 129
>KOG1280|consensus
Probab=36.69  E-value=24  Score=26.60  Aligned_cols=21  Identities=29%  Similarity=0.641  Sum_probs=10.9

Q ss_pred             ceeccCCCcccccCCHHHHHHHH
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHI  119 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~  119 (175)
                      .|.||  .|+.+-.+...|..|+
T Consensus        79 SftCP--yC~~~Gfte~~f~~Hv   99 (381)
T KOG1280|consen   79 SFTCP--YCGIMGFTERQFGTHV   99 (381)
T ss_pred             cccCC--cccccccchhHHHHHh
Confidence            44554  4555555555555554


No 130
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=36.26  E-value=12  Score=23.26  Aligned_cols=11  Identities=27%  Similarity=0.438  Sum_probs=6.6

Q ss_pred             ccCCcccchHHHh
Q psy8966         128 YRCAHEFCSKSFK  140 (175)
Q Consensus       128 ~~C~~~~C~~~f~  140 (175)
                      +.|  ..|+..|.
T Consensus        71 ~~C--~~Cg~~~~   81 (113)
T PRK12380         71 AWC--WDCSQVVE   81 (113)
T ss_pred             EEc--ccCCCEEe
Confidence            666  55765554


No 131
>KOG2907|consensus
Probab=35.77  E-value=13  Score=23.04  Aligned_cols=13  Identities=23%  Similarity=0.626  Sum_probs=7.5

Q ss_pred             eeccccccCcccCCh
Q psy8966          42 YRCAHEFCSKSFKTS   56 (175)
Q Consensus        42 ~~C~~~~C~~~f~~~   56 (175)
                      ..|..  |...|...
T Consensus        26 ~~C~~--Ck~~~~v~   38 (116)
T KOG2907|consen   26 VLCIR--CKIEYPVS   38 (116)
T ss_pred             eEecc--ccccCCHH
Confidence            45744  77766543


No 132
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=34.99  E-value=11  Score=22.32  Aligned_cols=17  Identities=12%  Similarity=0.059  Sum_probs=9.5

Q ss_pred             ccccCCcchhhhccccc
Q psy8966         156 YTAEVPGSILDCLSGRF  172 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~~  172 (175)
                      -.+.|..|++.|.-+.+
T Consensus        53 GIW~C~~C~~~~AGGAy   69 (90)
T PTZ00255         53 GIWRCKGCKKTVAGGAW   69 (90)
T ss_pred             EEEEcCCCCCEEeCCcc
Confidence            44666666666555543


No 133
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=34.82  E-value=13  Score=23.12  Aligned_cols=11  Identities=36%  Similarity=0.782  Sum_probs=6.8

Q ss_pred             ccCCcccchHHHh
Q psy8966         128 YRCAHEFCSKSFK  140 (175)
Q Consensus       128 ~~C~~~~C~~~f~  140 (175)
                      ..|  ..|+..|.
T Consensus        71 ~~C--~~Cg~~~~   81 (115)
T TIGR00100        71 CEC--EDCSEEVS   81 (115)
T ss_pred             EEc--ccCCCEEe
Confidence            667  56775554


No 134
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=32.73  E-value=6.6  Score=23.32  Aligned_cols=16  Identities=6%  Similarity=-0.022  Sum_probs=9.7

Q ss_pred             cccCCcchhhhccccc
Q psy8966         157 TAEVPGSILDCLSGRF  172 (175)
Q Consensus       157 ~~~C~~c~~~~~~~~~  172 (175)
                      .+.|..|++.|..+.+
T Consensus        53 IW~C~~C~~~~AGGAy   68 (90)
T PF01780_consen   53 IWKCKKCGKKFAGGAY   68 (90)
T ss_dssp             EEEETTTTEEEE-BSS
T ss_pred             EeecCCCCCEEeCCCc
Confidence            4667777766666554


No 135
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=32.70  E-value=51  Score=16.24  Aligned_cols=23  Identities=30%  Similarity=0.624  Sum_probs=16.1

Q ss_pred             ccCCCccchhhcc--ChHHHHHHHhhh
Q psy8966          12 YKCPVEYCEKAFS--TQYSRKAHIRTH   36 (175)
Q Consensus        12 ~~C~~~~C~~~f~--~~~~L~~h~~~~   36 (175)
                      -.|+  .||..|.  ...+-..|.+.|
T Consensus        14 ~~C~--~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCP--TCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCC--CCCCEECCCCHHHHHHHHHHH
Confidence            4686  8999875  556666676655


No 136
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=32.15  E-value=11  Score=18.64  Aligned_cols=11  Identities=9%  Similarity=-0.136  Sum_probs=5.7

Q ss_pred             cccCCcchhhh
Q psy8966         157 TAEVPGSILDC  167 (175)
Q Consensus       157 ~~~C~~c~~~~  167 (175)
                      +..|++||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45555555443


No 137
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=31.99  E-value=18  Score=22.64  Aligned_cols=11  Identities=45%  Similarity=0.972  Sum_probs=7.2

Q ss_pred             ccCCcccchHHHh
Q psy8966         128 YRCAHEFCSKSFK  140 (175)
Q Consensus       128 ~~C~~~~C~~~f~  140 (175)
                      +.|  ..||..|.
T Consensus        72 ~~C--~~Cg~~~~   82 (117)
T PRK00564         72 LEC--KDCSHVFK   82 (117)
T ss_pred             EEh--hhCCCccc
Confidence            677  66776555


No 138
>KOG2636|consensus
Probab=31.55  E-value=30  Score=27.04  Aligned_cols=29  Identities=24%  Similarity=0.605  Sum_probs=23.9

Q ss_pred             hhhcCCCcccCCcccch-HHHhchhhHHHHHH
Q psy8966         120 RTHTGEKPYRCAHEFCS-KSFKTSGDLQKHVR  150 (175)
Q Consensus       120 ~~h~~~~~~~C~~~~C~-~~f~~~~~l~~H~~  150 (175)
                      +.|.=+..|.|  .+|| +++..+.++.+|..
T Consensus       394 KLHGL~~ey~C--EICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNC--EICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccce--eeccCccccCcHHHHHHhH
Confidence            44555677999  9999 89999999999986


No 139
>KOG2785|consensus
Probab=31.30  E-value=57  Score=25.01  Aligned_cols=52  Identities=23%  Similarity=0.556  Sum_probs=42.8

Q ss_pred             cceeccCCCcccccCCHHHHHHHHhhhcCC-----------------------CcccCCcccch---HHHhchhhHHHHH
Q psy8966          96 RPYKCPVEYCEKAFSTQYSRKAHIRTHTGE-----------------------KPYRCAHEFCS---KSFKTSGDLQKHV  149 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~~~C~---~~f~~~~~l~~H~  149 (175)
                      .|-.|.  .|+..+.+...-..||..+++-                       .-|.|  ..|.   +.|.+-.+.+.||
T Consensus       165 ~Pt~CL--fC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~C--L~CN~~~~~f~sleavr~HM  240 (390)
T KOG2785|consen  165 IPTDCL--FCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFIC--LFCNELGRPFSSLEAVRAHM  240 (390)
T ss_pred             CCccee--ecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceE--EEeccccCcccccHHHHHHH
Confidence            456787  8999999999999999877652                       12888  8899   8999999999999


Q ss_pred             HH
Q psy8966         150 RT  151 (175)
Q Consensus       150 ~~  151 (175)
                      ..
T Consensus       241 ~~  242 (390)
T KOG2785|consen  241 RD  242 (390)
T ss_pred             hh
Confidence            74


No 140
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=31.28  E-value=15  Score=25.78  Aligned_cols=25  Identities=32%  Similarity=0.688  Sum_probs=12.5

Q ss_pred             cccCCcccchHHHhchhhHHHHHHHhc
Q psy8966         127 PYRCAHEFCSKSFKTSGDLQKHVRTHT  153 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~~~l~~H~~~h~  153 (175)
                      .|.|  ..|+|.|.-..-+..|+...+
T Consensus        77 K~~C--~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   77 KWRC--PLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEE---SSS-EESSHHHHHHHHHHH-
T ss_pred             EECC--CCCCcccCChHHHHHHHhhcC
Confidence            3566  556666666655555655433


No 141
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=30.85  E-value=11  Score=27.04  Aligned_cols=27  Identities=30%  Similarity=0.545  Sum_probs=19.8

Q ss_pred             CCCcccCCcccchHHHhchhhHHHHHHHh
Q psy8966         124 GEKPYRCAHEFCSKSFKTSGDLQKHVRTH  152 (175)
Q Consensus       124 ~~~~~~C~~~~C~~~f~~~~~l~~H~~~h  152 (175)
                      ..++++|  +.|++-.....+|.+-.++|
T Consensus       206 k~k~~PC--PKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  206 KGKPIPC--PKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             cCCCCCC--CCCCCcccccccceeeeecc
Confidence            3478889  88998777777776666655


No 142
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=30.52  E-value=17  Score=19.07  Aligned_cols=11  Identities=9%  Similarity=-0.372  Sum_probs=4.9

Q ss_pred             cCCcchhhhcc
Q psy8966         159 EVPGSILDCLS  169 (175)
Q Consensus       159 ~C~~c~~~~~~  169 (175)
                      .||+|+..|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            78888766543


No 143
>KOG2186|consensus
Probab=30.49  E-value=33  Score=24.71  Aligned_cols=46  Identities=17%  Similarity=0.504  Sum_probs=32.2

Q ss_pred             eeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhchhhHHHHHH
Q psy8966          98 YKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTSGDLQKHVR  150 (175)
Q Consensus        98 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~~~l~~H~~  150 (175)
                      |.|.  .||....- ..+.+|+..-++ .-|.|  ..|++.|.. .+...|.+
T Consensus         4 FtCn--vCgEsvKK-p~vekH~srCrn-~~fSC--IDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCN--VCGESVKK-PQVEKHMSRCRN-AYFSC--IDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehh--hhhhhccc-cchHHHHHhccC-CeeEE--eeccccccc-chhhhhhh
Confidence            5664  78877654 456678777665 66888  778888887 55666765


No 144
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=30.44  E-value=20  Score=17.54  Aligned_cols=11  Identities=0%  Similarity=-0.502  Sum_probs=6.9

Q ss_pred             cccCCcchhhh
Q psy8966         157 TAEVPGSILDC  167 (175)
Q Consensus       157 ~~~C~~c~~~~  167 (175)
                      |+.|..|+..|
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            66677666554


No 145
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=29.26  E-value=22  Score=15.96  Aligned_cols=11  Identities=9%  Similarity=0.084  Sum_probs=3.3

Q ss_pred             ccccCCcchhh
Q psy8966         156 YTAEVPGSILD  166 (175)
Q Consensus       156 ~~~~C~~c~~~  166 (175)
                      ..|.|..|.+.
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            44555555543


No 146
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=28.99  E-value=15  Score=21.87  Aligned_cols=17  Identities=6%  Similarity=-0.113  Sum_probs=9.4

Q ss_pred             ccccCCcchhhhccccc
Q psy8966         156 YTAEVPGSILDCLSGRF  172 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~~  172 (175)
                      -.+.|..|++.|.-+.+
T Consensus        52 GIW~C~~C~~~~AGGAy   68 (91)
T TIGR00280        52 GIWTCRKCGAKFAGGAY   68 (91)
T ss_pred             EEEEcCCCCCEEeCCcc
Confidence            34566666666555443


No 147
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.71  E-value=11  Score=24.19  Aligned_cols=7  Identities=14%  Similarity=0.102  Sum_probs=3.7

Q ss_pred             ccCCcch
Q psy8966         158 AEVPGSI  164 (175)
Q Consensus       158 ~~C~~c~  164 (175)
                      +.||.||
T Consensus       108 ~~CP~Cg  114 (135)
T PRK03824        108 LKCPKCG  114 (135)
T ss_pred             cCCcCCC
Confidence            4455555


No 148
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.79  E-value=23  Score=18.15  Aligned_cols=12  Identities=17%  Similarity=0.454  Sum_probs=6.4

Q ss_pred             cccCCcccchHHHh
Q psy8966         127 PYRCAHEFCSKSFK  140 (175)
Q Consensus       127 ~~~C~~~~C~~~f~  140 (175)
                      -|.|  +.||+.+.
T Consensus        20 ~~vC--~~Cg~~~~   31 (52)
T smart00661       20 RFVC--RKCGYEEP   31 (52)
T ss_pred             EEEC--CcCCCeEE
Confidence            4566  55665443


No 149
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=27.75  E-value=16  Score=18.13  Aligned_cols=12  Identities=0%  Similarity=-0.269  Sum_probs=5.9

Q ss_pred             ccccCCcchhhh
Q psy8966         156 YTAEVPGSILDC  167 (175)
Q Consensus       156 ~~~~C~~c~~~~  167 (175)
                      .|+.|+.|+..|
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            456666666544


No 150
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=27.67  E-value=8.4  Score=23.91  Aligned_cols=25  Identities=20%  Similarity=0.441  Sum_probs=14.1

Q ss_pred             ccCCcccchHHHhchhhHHHHHHHhcCCccccCCcchhh
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRTHTGKYTAEVPGSILD  166 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~c~~~  166 (175)
                      +.|  ..||+.|....            ..+.||.||..
T Consensus        71 ~~C--~~Cg~~~~~~~------------~~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARC--RDCGHEFEPDE------------FDFSCPRCGSP   95 (113)
T ss_dssp             EEE--TTTS-EEECHH------------CCHH-SSSSSS
T ss_pred             EEC--CCCCCEEecCC------------CCCCCcCCcCC
Confidence            778  67887776432            22458888743


No 151
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=26.81  E-value=34  Score=26.63  Aligned_cols=14  Identities=21%  Similarity=0.743  Sum_probs=7.6

Q ss_pred             cccCCcccchHHHhch
Q psy8966         127 PYRCAHEFCSKSFKTS  142 (175)
Q Consensus       127 ~~~C~~~~C~~~f~~~  142 (175)
                      -|+|  +.||..+...
T Consensus       367 g~rC--~kCg~~~~~~  380 (421)
T COG1571         367 GFRC--KKCGTRARET  380 (421)
T ss_pred             Cccc--ccccccCCcc
Confidence            5556  5566555543


No 152
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.61  E-value=23  Score=19.47  Aligned_cols=12  Identities=17%  Similarity=0.603  Sum_probs=7.0

Q ss_pred             CCcccCCcccchHH
Q psy8966         125 EKPYRCAHEFCSKS  138 (175)
Q Consensus       125 ~~~~~C~~~~C~~~  138 (175)
                      .+.|.|  +.||..
T Consensus        44 ~r~~~C--~~Cg~~   55 (69)
T PF07282_consen   44 GRVFTC--PNCGFE   55 (69)
T ss_pred             cceEEc--CCCCCE
Confidence            455666  556654


No 153
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=26.47  E-value=13  Score=22.52  Aligned_cols=11  Identities=18%  Similarity=0.413  Sum_probs=5.8

Q ss_pred             ccCCcccchHHHh
Q psy8966         128 YRCAHEFCSKSFK  140 (175)
Q Consensus       128 ~~C~~~~C~~~f~  140 (175)
                      ..|  ++||..+.
T Consensus        43 ~~C--~~CG~y~~   53 (99)
T PRK14892         43 ITC--GNCGLYTE   53 (99)
T ss_pred             EEC--CCCCCccC
Confidence            456  55665444


No 154
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=26.36  E-value=22  Score=22.08  Aligned_cols=7  Identities=14%  Similarity=0.207  Sum_probs=4.5

Q ss_pred             ccCCcch
Q psy8966         158 AEVPGSI  164 (175)
Q Consensus       158 ~~C~~c~  164 (175)
                      +.||.||
T Consensus        88 ~~CP~Cg   94 (114)
T PRK03681         88 RRCPQCH   94 (114)
T ss_pred             CcCcCcC
Confidence            4577776


No 155
>KOG2785|consensus
Probab=25.65  E-value=1e+02  Score=23.78  Aligned_cols=74  Identities=23%  Similarity=0.452  Sum_probs=46.0

Q ss_pred             CeeccccccCcccCChHHHHHHHHHhcCCCCCCCCCCccchhcccchhhhhccCCcceeccCCCcc---cccCCHHHHHH
Q psy8966          41 PYRCAHEFCSKSFKTSGDLQKHVRTHTGKYTPGPGIDSRLIVREDFVHLRIHSGIRPYKCPVEYCE---KAFSTQYSRKA  117 (175)
Q Consensus        41 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~C~---~~f~~~~~l~~  117 (175)
                      |-.|-  +|+..+.+...-..||..+++-+.....+.....---...-.++.   .-+.|.  .|+   +.|.+......
T Consensus       166 Pt~CL--fC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~---~~~~CL--~CN~~~~~f~sleavr~  238 (390)
T KOG2785|consen  166 PTDCL--FCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVG---IGFICL--FCNELGRPFSSLEAVRA  238 (390)
T ss_pred             Cccee--ecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhc---cCceEE--EeccccCcccccHHHHH
Confidence            34574  499999999999999999888555443222221000001112222   236676  688   88999999999


Q ss_pred             HHhh
Q psy8966         118 HIRT  121 (175)
Q Consensus       118 H~~~  121 (175)
                      ||..
T Consensus       239 HM~~  242 (390)
T KOG2785|consen  239 HMRD  242 (390)
T ss_pred             HHhh
Confidence            9854


No 156
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=25.26  E-value=37  Score=20.81  Aligned_cols=25  Identities=24%  Similarity=0.448  Sum_probs=20.7

Q ss_pred             CCcceeccCCCcccccCCHHHHHHHHh
Q psy8966          94 GIRPYKCPVEYCEKAFSTQYSRKAHIR  120 (175)
Q Consensus        94 ~~~~~~C~~~~C~~~f~~~~~l~~H~~  120 (175)
                      |-+.+.|.  +|.+-|.+...|..|.+
T Consensus        52 GlGqhYCi--eCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCI--ECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeee--hhHHHHHHHHHHHHHhc
Confidence            45567786  89999999999999974


No 157
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=25.20  E-value=33  Score=21.93  Aligned_cols=14  Identities=0%  Similarity=-0.261  Sum_probs=7.9

Q ss_pred             CccccCCcchhhhc
Q psy8966         155 KYTAEVPGSILDCL  168 (175)
Q Consensus       155 ~~~~~C~~c~~~~~  168 (175)
                      .+.|.|+.|++.|.
T Consensus        51 ~qRyrC~~C~~tf~   64 (129)
T COG3677          51 HQRYKCKSCGSTFT   64 (129)
T ss_pred             ccccccCCcCccee
Confidence            45566666665543


No 158
>KOG2482|consensus
Probab=24.87  E-value=37  Score=25.62  Aligned_cols=51  Identities=25%  Similarity=0.656  Sum_probs=35.4

Q ss_pred             ceeccCCCcccccCCH-HHHHHHH-hhhc---C--C----------------CcccCCcccchHHHhchhhHHHHHHH
Q psy8966          97 PYKCPVEYCEKAFSTQ-YSRKAHI-RTHT---G--E----------------KPYRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~-~~l~~H~-~~h~---~--~----------------~~~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      .-.|.  .|+..+... +....|+ ..|.   |  +                ..+.|  -.|.+.|+.+..|..||+.
T Consensus       144 slqCl--FCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~C--LyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCL--FCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRC--LYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEE--EecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhhee--eeeccccCCcHHHHHHHHh
Confidence            44575  788776554 4455665 3331   1  1                13889  8999999999999999985


No 159
>PF14353 CpXC:  CpXC protein
Probab=24.23  E-value=26  Score=22.07  Aligned_cols=12  Identities=8%  Similarity=0.157  Sum_probs=6.0

Q ss_pred             ccccCCcchhhh
Q psy8966         156 YTAEVPGSILDC  167 (175)
Q Consensus       156 ~~~~C~~c~~~~  167 (175)
                      ..+.||.||..+
T Consensus        37 ~~~~CP~Cg~~~   48 (128)
T PF14353_consen   37 FSFTCPSCGHKF   48 (128)
T ss_pred             CEEECCCCCCce
Confidence            345555555444


No 160
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=24.13  E-value=29  Score=18.44  Aligned_cols=9  Identities=22%  Similarity=0.228  Sum_probs=5.1

Q ss_pred             ccCCcchhh
Q psy8966         158 AEVPGSILD  166 (175)
Q Consensus       158 ~~C~~c~~~  166 (175)
                      +.||.||..
T Consensus         3 ~~CP~CG~~   11 (54)
T TIGR01206         3 FECPDCGAE   11 (54)
T ss_pred             cCCCCCCCE
Confidence            456666643


No 161
>KOG3507|consensus
Probab=23.90  E-value=27  Score=18.88  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=9.3

Q ss_pred             CcccCCcccchHHHhch
Q psy8966         126 KPYRCAHEFCSKSFKTS  142 (175)
Q Consensus       126 ~~~~C~~~~C~~~f~~~  142 (175)
                      -++.|  -+||+...++
T Consensus        36 D~irC--ReCG~RIlyK   50 (62)
T KOG3507|consen   36 DVIRC--RECGYRILYK   50 (62)
T ss_pred             CcEeh--hhcchHHHHH
Confidence            35677  6677765554


No 162
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=23.86  E-value=10  Score=22.90  Aligned_cols=16  Identities=19%  Similarity=0.654  Sum_probs=9.4

Q ss_pred             CcceeccCCCcccccCCH
Q psy8966          95 IRPYKCPVEYCEKAFSTQ  112 (175)
Q Consensus        95 ~~~~~C~~~~C~~~f~~~  112 (175)
                      .+.|.||  .|+..-...
T Consensus        20 ~k~FtCp--~Cghe~vs~   35 (104)
T COG4888          20 PKTFTCP--RCGHEKVSS   35 (104)
T ss_pred             CceEecC--ccCCeeeeE
Confidence            4566676  676655443


No 163
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=23.64  E-value=36  Score=17.69  Aligned_cols=14  Identities=21%  Similarity=0.598  Sum_probs=7.1

Q ss_pred             cceeccCCCcccccCC
Q psy8966          96 RPYKCPVEYCEKAFST  111 (175)
Q Consensus        96 ~~~~C~~~~C~~~f~~  111 (175)
                      +.+.|.  .||..|..
T Consensus         3 k~l~C~--dCg~~Fvf   16 (49)
T PF13451_consen    3 KTLTCK--DCGAEFVF   16 (49)
T ss_pred             eeEEcc--cCCCeEEE
Confidence            344554  56655543


No 164
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.34  E-value=40  Score=16.76  Aligned_cols=11  Identities=9%  Similarity=-0.067  Sum_probs=8.0

Q ss_pred             ccccCCcchhh
Q psy8966         156 YTAEVPGSILD  166 (175)
Q Consensus       156 ~~~~C~~c~~~  166 (175)
                      +|..|+.||..
T Consensus         1 ~~~~Cp~Cg~~   11 (47)
T PF14690_consen    1 KPPRCPHCGSP   11 (47)
T ss_pred             CCccCCCcCCC
Confidence            36789999844


No 165
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=22.00  E-value=36  Score=17.94  Aligned_cols=9  Identities=11%  Similarity=-0.134  Sum_probs=5.9

Q ss_pred             cCCcchhhh
Q psy8966         159 EVPGSILDC  167 (175)
Q Consensus       159 ~C~~c~~~~  167 (175)
                      .||+||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            577887543


No 166
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=21.96  E-value=35  Score=17.74  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=6.8

Q ss_pred             CcccCCcccchHHH
Q psy8966         126 KPYRCAHEFCSKSF  139 (175)
Q Consensus       126 ~~~~C~~~~C~~~f  139 (175)
                      ..+.|  ..||..+
T Consensus        36 ~r~~C--~~Cgyt~   47 (50)
T PRK00432         36 DRWHC--GKCGYTE   47 (50)
T ss_pred             CcEEC--CCcCCEE
Confidence            45666  5566543


No 167
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=21.76  E-value=25  Score=17.71  Aligned_cols=10  Identities=0%  Similarity=-0.187  Sum_probs=5.1

Q ss_pred             CccccCCcch
Q psy8966         155 KYTAEVPGSI  164 (175)
Q Consensus       155 ~~~~~C~~c~  164 (175)
                      ...|.|..|+
T Consensus        35 ~~~~~C~~C~   44 (46)
T PF12760_consen   35 RGRYRCKACR   44 (46)
T ss_pred             CCeEECCCCC
Confidence            3445555554


No 168
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=21.72  E-value=32  Score=17.01  Aligned_cols=7  Identities=14%  Similarity=-0.059  Sum_probs=3.0

Q ss_pred             ccCCcch
Q psy8966         158 AEVPGSI  164 (175)
Q Consensus       158 ~~C~~c~  164 (175)
                      -.||.||
T Consensus         4 ~pCP~CG   10 (40)
T PF08273_consen    4 GPCPICG   10 (40)
T ss_dssp             E--TTTT
T ss_pred             CCCCCCc
Confidence            4566665


No 169
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=21.72  E-value=21  Score=26.36  Aligned_cols=33  Identities=24%  Similarity=0.285  Sum_probs=17.8

Q ss_pred             ceeccCCCcccccCCHHHHHHHHhhhcCCCcccCCcccchHHHhch
Q psy8966          97 PYKCPVEYCEKAFSTQYSRKAHIRTHTGEKPYRCAHEFCSKSFKTS  142 (175)
Q Consensus        97 ~~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~~~C~~~f~~~  142 (175)
                      ..+|+  .|+.....+ .|        .++-+.|  +.|++-|+-.
T Consensus        38 w~kc~--~C~~~~~~~-~l--------~~~~~vc--p~c~~h~rlt   70 (296)
T CHL00174         38 WVQCE--NCYGLNYKK-FL--------KSKMNIC--EQCGYHLKMS   70 (296)
T ss_pred             eeECC--CccchhhHH-HH--------HHcCCCC--CCCCCCcCCC
Confidence            34565  676654332 22        2334677  6687766543


No 170
>KOG0717|consensus
Probab=21.40  E-value=44  Score=26.38  Aligned_cols=22  Identities=36%  Similarity=0.751  Sum_probs=19.1

Q ss_pred             ccCCcccchHHHhchhhHHHHHHH
Q psy8966         128 YRCAHEFCSKSFKTSGDLQKHVRT  151 (175)
Q Consensus       128 ~~C~~~~C~~~f~~~~~l~~H~~~  151 (175)
                      +.|  .+|.++|.+...|..|..+
T Consensus       293 lyC--~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYC--VVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEE--eeccccccchHHHHhhHHH
Confidence            779  8899999999999988864


No 171
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.27  E-value=35  Score=16.19  Aligned_cols=14  Identities=0%  Similarity=-0.102  Sum_probs=5.6

Q ss_pred             cCCcchhhhccccc
Q psy8966         159 EVPGSILDCLSGRF  172 (175)
Q Consensus       159 ~C~~c~~~~~~~~~  172 (175)
                      .|..|+..|.-+++
T Consensus         5 ~C~eC~~~f~dSyL   18 (34)
T PF01286_consen    5 KCDECGKPFMDSYL   18 (34)
T ss_dssp             E-TTT--EES-SSC
T ss_pred             hHhHhCCHHHHHHH
Confidence            56666666555443


No 172
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=21.11  E-value=23  Score=21.06  Aligned_cols=16  Identities=13%  Similarity=-0.149  Sum_probs=8.8

Q ss_pred             ccccCCcchhhhcccc
Q psy8966         156 YTAEVPGSILDCLSGR  171 (175)
Q Consensus       156 ~~~~C~~c~~~~~~~~  171 (175)
                      -.+.|..|++.|.-+.
T Consensus        53 GIW~C~~C~~~~AGGA   68 (90)
T PRK03976         53 GIWECRKCGAKFAGGA   68 (90)
T ss_pred             EEEEcCCCCCEEeCCc
Confidence            3456666665555443


No 173
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=20.63  E-value=49  Score=18.30  Aligned_cols=14  Identities=7%  Similarity=-0.033  Sum_probs=9.1

Q ss_pred             cCCcchhhhccccc
Q psy8966         159 EVPGSILDCLSGRF  172 (175)
Q Consensus       159 ~C~~c~~~~~~~~~  172 (175)
                      .||.||-..+|..+
T Consensus        19 ~Cp~Cgs~~~S~~w   32 (64)
T PRK06393         19 TCPVHGDEKTTTEW   32 (64)
T ss_pred             cCCCCCCCcCCcCc
Confidence            78888776655443


No 174
>COG2879 Uncharacterized small protein [Function unknown]
Probab=20.13  E-value=1e+02  Score=16.99  Aligned_cols=14  Identities=14%  Similarity=0.275  Sum_probs=9.3

Q ss_pred             hHHHHHHHhcCCcc
Q psy8966         144 DLQKHVRTHTGKYT  157 (175)
Q Consensus       144 ~l~~H~~~h~~~~~  157 (175)
                      +...||+.+++.+|
T Consensus        27 nYVehmr~~hPd~p   40 (65)
T COG2879          27 NYVEHMRKKHPDKP   40 (65)
T ss_pred             HHHHHHHHhCcCCC
Confidence            45678887766655


Done!