RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy897
         (125 letters)



>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended
           (e) SDRs.  SDRs are Rossmann-fold NAD(P)H-binding
           proteins, many of which may function as fatty acyl CoA
           reductases (FAR), acting on medium and long chain fatty
           acids, and have been reported to be involved in diverse
           processes such as biosynthesis of insect pheromones,
           plant cuticular wax production, and mammalian wax
           biosynthesis. In Arabidopsis thaliana, proteins with
           this particular architecture have also been identified
           as the MALE STERILITY 2 (MS2) gene product, which is
           implicated in male gametogenesis. Mutations in MS2
           inhibit the synthesis of exine (sporopollenin),
           rendering plants unable to reduce pollen wall fatty
           acids to corresponding alcohols. This N-terminal domain
           shares the catalytic triad (but not the upstream Asn)
           and characteristic NADP-binding motif of the extended
           SDR family. Extended SDRs are distinct from classical
           SDRs. In addition to the Rossmann fold (alpha/beta
           folding pattern with a central beta-sheet) core region
           typical of all SDRs, extended SDRs have a less conserved
           C-terminal extension of approximately 100 amino acids.
           Extended SDRs are a diverse collection of proteins, and
           include isomerases, epimerases, oxidoreductases, and
           lyases; they typically have a TGXXGXXG cofactor binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 320

 Score = 98.9 bits (247), Expect = 4e-26
 Identities = 46/138 (33%), Positives = 68/138 (49%), Gaps = 30/138 (21%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFAN 75
           + +TG TGF+GKVLL+ LLR  P I  IY+L+R + G S +ER+ ++L  +  +F    N
Sbjct: 3   VLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELL--KDKLFDRGRN 60

Query: 76  LVRLKTQRIRFI---------FL-------------------ATLRFDEELKIAIRTNIC 107
           L  L   +I  I          L                   AT+ FDE L  A+  N+ 
Sbjct: 61  LNPLFESKIVPIEGDLSEPNLGLSDEDLQTLIEEVNIIIHCAATVTFDERLDEALSINVL 120

Query: 108 ATQTVVKLAKQCPHLRLF 125
            T  +++LAK+C  L+ F
Sbjct: 121 GTLRLLELAKRCKKLKAF 138


>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein.  This family
           represents the C-terminal region of the male sterility
           protein in a number of arabidopsis and drosophila. A
           sequence-related jojoba acyl CoA reductase is also
           included.
          Length = 245

 Score = 88.0 bits (219), Expect = 1e-22
 Identities = 42/130 (32%), Positives = 58/130 (44%), Gaps = 25/130 (19%)

Query: 18  LTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFANLV 77
           LTG TGF+GKVLL+ LLR  P +  IY LVR + G S  ER+ + L  +  +F     L 
Sbjct: 1   LTGATGFLGKVLLEKLLRSTPEVK-IYCLVRAKDGESALERLRQELL-KYGLFDRLKALE 58

Query: 78  RLK---------------------TQRIRFIF--LATLRFDEELKIAIRTNICATQTVVK 114
           R+                       + +  I    AT+ F E       TN+  T+ V++
Sbjct: 59  RIIPVAGDLSEPNLGLSDEDFQELAEEVDVIIHNAATVNFVEPYSDLRATNVLGTREVLR 118

Query: 115 LAKQCPHLRL 124
           LAKQ   L  
Sbjct: 119 LAKQMKKLPF 128


>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like,
           extended (e) SDRs.  This subgroup of extended SDR family
           domains have the characteristic active site tetrad and a
           well-conserved NAD(P)-binding motif. This subgroup is
           not well characterized, its members are annotated as
           having a variety of putative functions. One
           characterized member is Pseudomonas fluorescens MupV a
           protein  involved in the biosynthesis of Mupirocin, a
           polyketide-derived antibiotic. Extended SDRs are
           distinct from classical SDRs. In addition to the
           Rossmann fold (alpha/beta folding pattern with a central
           beta-sheet) core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids. Extended SDRs are a
           diverse collection of proteins, and include isomerases,
           epimerases, oxidoreductases, and lyases; they typically
           have a TGXXGXXG cofactor binding motif. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 293

 Score = 60.8 bits (148), Expect = 3e-12
 Identities = 34/123 (27%), Positives = 53/123 (43%), Gaps = 16/123 (13%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERI-------EKMLDNEGP 68
           +F+TGGTGF+G+ L+  LL        + +LVR        ERI       +++   EG 
Sbjct: 1   VFVTGGTGFLGRHLVKRLLEN---GFKVLVLVRSESLGEAHERIEEAGLEADRVRVLEGD 57

Query: 69  IFK-----DFANLVRLKTQRIRFIFLA-TLRFDEELKIAIRTNICATQTVVKLAKQCPHL 122
           + +       A    L  +    I  A +  F    + A RTNI  T+ V++LA +    
Sbjct: 58  LTQPNLGLSAAASRELAGKVDHVIHCAASYDFQAPNEDAWRTNIDGTEHVLELAARLDIQ 117

Query: 123 RLF 125
           R  
Sbjct: 118 RFH 120


>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1.  This family
          consists of an SDR module of multidomain proteins
          identified as putative polyketide sythases fatty acid
          synthases (FAS), and nonribosomal peptide synthases,
          among others. However, unlike the usual ketoreductase
          modules of FAS and polyketide synthase, these domains
          are related to the extended SDRs, and have canonical
          NAD(P)-binding motifs and an active site tetrad.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 290

 Score = 54.2 bits (131), Expect = 1e-09
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 15 VIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGP 68
           + LTG TGF+G  LL  LL+R      IY LVR +   +  ER+   L   G 
Sbjct: 1  TVLLTGATGFLGAYLLRELLKRKNVSK-IYCLVRAKDEEAALERLIDNLKEYGL 53


>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2.
          Length = 605

 Score = 49.1 bits (117), Expect = 7e-08
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 32/141 (22%)

Query: 17  FLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIE-KMLDNE--------- 66
            +TG TGF+ KVL++ +LR  P +  IY+L++ +   +  ER++ +++D E         
Sbjct: 123 LITGATGFLAKVLIEKILRTNPDVGKIYLLIKAKDKEAAIERLKNEVIDAELFKCLQETH 182

Query: 67  GPIFKDF--------------------ANLVRLKTQRIRFIF--LATLRFDEELKIAIRT 104
           G  ++ F                     +L     + +  I    A   FDE   +AI  
Sbjct: 183 GKSYQSFMLSKLVPVVGNVCESNLGLEPDLADEIAKEVDVIINSAANTTFDERYDVAIDI 242

Query: 105 NICATQTVVKLAKQCPHLRLF 125
           N      ++  AK+C  L+LF
Sbjct: 243 NTRGPCHLMSFAKKCKKLKLF 263


>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain.  This
          model includes the terminal domain from the fungal
          alpha aminoadipate reductase enzyme (also known as
          aminoadipate semialdehyde dehydrogenase) which is
          involved in the biosynthesis of lysine , as well as the
          reductase-containing component of the myxochelin
          biosynthetic gene cluster, MxcG. The mechanism of
          reduction involves activation of the substrate by
          adenylation and transfer to a covalently-linked
          pantetheine cofactor as a thioester. This thioester is
          then reduced to give an aldehyde (thus releasing the
          product) and a regenerated pantetheine thiol. (In
          myxochelin biosynthesis this aldehyde is further
          reduced to an alcohol or converted to an amine by an
          aminotransferase.) This is a fundamentally different
          reaction than beta-ketoreductase domains of polyketide
          synthases which act at a carbonyl two carbons removed
          from the thioester and forms an alcohol as a product.
          This domain is invariably found at the C-terminus of
          the proteins which contain it (presumably because it
          results in the release of the product). The majority of
          hits to this model are non-ribosomal peptide
          synthetases in which this domain is similarly located
          proximal to a thiolation domain (pfam00550). In some
          cases this domain is found at the end of a polyketide
          synthetase enzyme, but is unlike ketoreductase domains
          which are found before the thiolase domains. Exceptions
          to this observed relationship with the thiolase domain
          include three proteins which consist of stand-alone
          reductase domains (GP|466833 from M. leprae, GP|435954
          from Anabaena and OMNI|NTL02SC1199 from Strep.
          coelicolor) and one protein (OMNI|NTL01NS2636 from
          Nostoc) which contains N-terminal homology with a small
          group of hypothetical proteins but no evidence of a
          thiolation domain next to the putative reductase
          domain. Below the noise cutoff to this model are
          proteins containing more distantly related
          ketoreductase and dehydratase/epimerase domains. It has
          been suggested that a NADP-binding motif can be found
          in the N-terminal portion of this domain that may form
          a Rossman-type fold.
          Length = 367

 Score = 45.5 bits (108), Expect = 1e-06
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEG 67
          + LTG TGF+G  LL+ LLRR      +  LVR        ER+ + L +  
Sbjct: 2  VLLTGATGFLGAYLLEELLRRSTQA-KVICLVRAASEEHAMERLREALRSYR 52


>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase.
          Length = 491

 Score = 43.9 bits (104), Expect = 4e-06
 Identities = 34/148 (22%), Positives = 60/148 (40%), Gaps = 33/148 (22%)

Query: 10  FYKDGVIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQER-----IEKML- 63
           F ++  I +TG TGF+ K+ ++ +LR  P++  +Y+L+R     S  +R     I K L 
Sbjct: 8   FLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRASDAKSATQRLHDEVIGKDLF 67

Query: 64  ----DNEGPIFKDFA--------------NL----VRLKTQRIRFI-----FLATLRFDE 96
               +  G                     +L      L+ +  + I       AT  FDE
Sbjct: 68  KVLREKLGENLNSLISEKVTPVPGDISYDDLGVKDSNLREEMWKEIDIVVNLAATTNFDE 127

Query: 97  ELKIAIRTNICATQTVVKLAKQCPHLRL 124
              +A+  N      V+  AK+C  +++
Sbjct: 128 RYDVALGINTLGALNVLNFAKKCVKVKM 155


>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of
          multifunctional non-ribosomal peptide synthetases and
          related enzymes [Secondary metabolites biosynthesis,
          transport, and catabolism].
          Length = 382

 Score = 43.5 bits (103), Expect = 5e-06
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLD 64
          + LTG TGF+G  LL  LL R  +   +  LVR +   +   R+EK  D
Sbjct: 3  VLLTGATGFLGAYLLLELLDRSDA--KVICLVRAQSDEAALARLEKTFD 49


>gnl|CDD|233570 TIGR01777, yfcH, TIGR01777 family protein.  This model represents a
           clade of proteins of unknown function including the E.
           coli yfcH protein [Hypothetical proteins, Conserved].
          Length = 291

 Score = 41.1 bits (97), Expect = 4e-05
 Identities = 29/112 (25%), Positives = 43/112 (38%), Gaps = 19/112 (16%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFAN 75
           I +TGGTGF+G+ L   L +R    H + IL R                 EG   K +A 
Sbjct: 1   ILITGGTGFIGRALTQRLTKRG---HEVTILTR-------SPPPGANTKWEGY--KPWAG 48

Query: 76  LVRLKTQRIRFIF------LATLRFDEELKIAIR-TNICATQTVVKLAKQCP 120
                 +    +       +A  R+ EE K  IR + I  T+ +V+      
Sbjct: 49  EDADSLEGADAVINLAGEPIADKRWTEERKQEIRDSRIDTTRLLVEAIAAAE 100


>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional.
          Length = 657

 Score = 38.8 bits (91), Expect = 3e-04
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 31/122 (25%)

Query: 17  FLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEG-----PIF- 70
           F+TGGTGF+G+ L+  LL R     ++++LVR         R+E +    G     P+  
Sbjct: 4   FVTGGTGFIGRRLVSRLLDRRRE-ATVHVLVRR----QSLSRLEALAAYWGADRVVPLVG 58

Query: 71  -----------KDFANLVRLKTQRIRFIFLAT---LRFDEELKIAIRTNICATQTVVKLA 116
                       D A L  +       + LA    L  DEE       N+  T+ VV+LA
Sbjct: 59  DLTEPGLGLSEADIAELGDID----HVVHLAAIYDLTADEE--AQRAANVDGTRNVVELA 112

Query: 117 KQ 118
           ++
Sbjct: 113 ER 114


>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8.  This subgroup
           contains atypical SDRs of unknown function. Proteins in
           this subgroup have a glycine-rich NAD(P)-binding motif
           consensus that resembles that of the extended SDRs,
           (GXXGXXG or GGXGXXG), but lacks the characteristic
           active site residues of the SDRs. A Cys often replaces
           the usual Lys of the YXXXK active site motif, while the
           upstream Ser is generally present and Arg replaces the
           usual Asn. Atypical SDRs generally lack the catalytic
           residues characteristic of the SDRs, and their
           glycine-rich NAD(P)-binding motif is often different
           from the forms normally seen in classical or extended
           SDRs. Atypical SDRs include biliverdin IX beta reductase
           (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. In addition to the
           Rossmann fold core region typical of all SDRs, extended
           SDRs have a less conserved C-terminal extension of
           approximately 100 amino acids, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 296

 Score = 37.6 bits (88), Expect = 6e-04
 Identities = 28/112 (25%), Positives = 43/112 (38%), Gaps = 15/112 (13%)

Query: 15  VIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVR-ERKGVSPQERIEKMLDNEGPIFKDF 73
            I +TGGTGF+G+ L   L       H + +L R   K     E I    D       + 
Sbjct: 1   KIVITGGTGFIGRALTRRLTAAG---HEVVVLSRRPGKAEGLAEVIT--WDGLSLGPWEL 55

Query: 74  AN---LVRLKTQRIRFIFLATLRFDEELKIAIR-TNICATQTVVKLAKQCPH 121
                ++ L  + I     A  R+ E  K  I  + I +T+ +V+     P 
Sbjct: 56  PGADAVINLAGEPI-----ACRRWTEANKKEILSSRIESTRVLVEAIANAPA 102


>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs.  Extended or
           atypical short-chain dehydrogenases/reductases (SDRs,
           aka tyrosine-dependent oxidoreductases) are distinct
           from classical SDRs. In addition to the Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet)
           core region typical of all SDRs, extended SDRs have a
           less conserved C-terminal extension of approximately 100
           amino acids. Extended SDRs are a diverse collection of
           proteins, and include isomerases, epimerases,
           oxidoreductases, and lyases; they typically have a
           TGXXGXXG cofactor binding motif. Atypical SDRs generally
           lack the catalytic residues characteristic of the SDRs,
           and their glycine-rich NAD(P)-binding motif is often
           different from the forms normally seen in classical or
           extended SDRs. Atypical SDRs include biliverdin IX beta
           reductase (BVR-B,aka flavin reductase), NMRa (a negative
           transcriptional regulator of various fungi),
           progesterone 5-beta-reductase like proteins,
           phenylcoumaran benzylic ether and
           pinoresinol-lariciresinol reductases, phenylpropene
           synthases, eugenol synthase, triphenylmethane reductase,
           isoflavone reductases, and others. SDRs are a
           functionally diverse family of oxidoreductases that have
           a single domain with a structurally conserved Rossmann
           fold, an NAD(P)(H)-binding region, and a structurally
           diverse C-terminal region. Sequence identity between
           different SDR enzymes is typically in the 15-30% range;
           they catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Complex
           (multidomain) SDRs such as ketoreductase domains of
           fatty acid synthase have a GGXGXXG NAD(P)-binding motif
           and an altered active site motif (YXXXN). Fungal type
           ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
           motif.
          Length = 176

 Score = 35.8 bits (83), Expect = 0.002
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 7/102 (6%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFAN 75
           I + G TGF+G+ L   LL +    H + +LVR  K +S  +  ++ +       +D  +
Sbjct: 1   ILILGATGFIGRALARELLEQG---HEVTLLVRNTKRLS--KEDQEPVAVVEGDLRDLDS 55

Query: 76  LVRLKTQRIRFIFLATLRFDEELKIAIRTNICATQTVVKLAK 117
           L          I LA      + +     ++  T+ V++ AK
Sbjct: 56  LSDAVQGVDVVIHLAGA--PRDTRDFCEVDVEGTRNVLEAAK 95


>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase. 
            Members of this protein family are
            L-aminoadipate-semialdehyde dehydrogenase (EC 1.2.1.31),
            product of the LYS2 gene. It is also called
            alpha-aminoadipate reductase. In fungi, lysine is
            synthesized via aminoadipate. Currently, all members of
            this family are fungal.
          Length = 1389

 Score = 36.2 bits (84), Expect = 0.002
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 4    YPTVEDFYKDGVI--FLTGGTGFMGKVLL-DTLLRRFPSIHSIYILVRERKGVSPQERIE 60
            YP+ ++      I  FLTG TGF+G  +L D L RR  S   ++  VR +   +  ER+ 
Sbjct: 960  YPSRKELDASTPITVFLTGATGFLGSFILRDLLTRRSNSNFKVFAHVRAKSEEAGLERLR 1019

Query: 61   K 61
            K
Sbjct: 1020 K 1020


>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell
           envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 314

 Score = 35.7 bits (82), Expect = 0.003
 Identities = 22/111 (19%), Positives = 40/111 (36%), Gaps = 12/111 (10%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFAN 75
           I +TGG GF+G  L++ LL      H +  L R R G+     +  +      +  D   
Sbjct: 3   ILVTGGAGFIGSHLVERLLAA---GHDVRGLDRLRDGL--DPLLSGVEFVVLDLT-DRDL 56

Query: 76  LVRLKTQRIRFIF-LATLRF-----DEELKIAIRTNICATQTVVKLAKQCP 120
           +  L       +  LA           +    +  N+  T  +++ A+   
Sbjct: 57  VDELAKGVPDAVIHLAAQSSVPDSNASDPAEFLDVNVDGTLNLLEAARAAG 107


>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde
          reductase and flavonoid reductase related proteins,
          extended (e) SDRs.  This subgroup contains proteins of
          unknown function related to aldehyde reductase and
          flavonoid reductase of the extended SDR-type. Aldehyde
          reductase I (aka carbonyl reductase) is an NADP-binding
          SDR; it has an NADP-binding motif consensus that is
          slightly different from the canonical SDR form and
          lacks the Asn of the extended SDR active site tetrad.
          Aldehyde reductase I catalyzes the NADP-dependent
          reduction of ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. The related flavonoid
          reductases act in the NADP-dependent reduction of
          flavonoids, ketone-containing plant secondary
          metabolites. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 318

 Score = 35.0 bits (81), Expect = 0.005
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 5/47 (10%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVS--PQERIE 60
          I +TG TGF+G  L+  LL +    + +  LVR            +E
Sbjct: 1  ILVTGATGFLGSNLVRALLAQG---YRVRALVRSGSDAVLLDGLPVE 44


>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked
           N-acetylglucosamine) inverting 4,6-dehydratase, extended
           (e) SDRs.  UDP-Glcnac inverting 4,6-dehydratase was
           identified in Helicobacter pylori as the hexameric flaA1
           gene product (FlaA1). FlaA1 is hexameric, possesses
           UDP-GlcNAc-inverting 4,6-dehydratase activity,  and
           catalyzes the first step in the creation of a
           pseudaminic acid derivative in protein glycosylation.
           Although this subgroup has the NADP-binding motif
           characteristic of extended SDRs, its members tend to
           have a Met substituted for the active site Tyr found in
           most SDR families. Extended SDRs are distinct from
           classical SDRs. In addition to the Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet)
           core region typical of all SDRs, extended SDRs have a
           less conserved C-terminal extension of approximately 100
           amino acids. Extended SDRs are a diverse collection of
           proteins, and include isomerases, epimerases,
           oxidoreductases, and lyases; they typically have a
           TGXXGXXG cofactor binding motif. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold, an
           NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Sequence identity between different
           SDR enzymes is typically in the 15-30% range; they
           catalyze a wide range of activities including the
           metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           15-hydroxyprostaglandin dehydrogenase numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser and/or an Asn, contributing to the active site;
           while substrate binding is in the C-terminal region,
           which determines specificity. The standard reaction
           mechanism is a 4-pro-S hydride transfer and proton relay
           involving the conserved Tyr and Lys, a water molecule
           stabilized by Asn, and nicotinamide. Atypical SDRs
           generally lack the catalytic residues characteristic of
           the SDRs, and their glycine-rich NAD(P)-binding motif is
           often different from the forms normally seen in
           classical or extended SDRs. Complex (multidomain) SDRs
           such as ketoreductase domains of fatty acid synthase
           have a GGXGXXG NAD(P)-binding motif and an altered
           active site motif (YXXXN). Fungal type ketoacyl
           reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 287

 Score = 33.7 bits (78), Expect = 0.012
 Identities = 31/126 (24%), Positives = 51/126 (40%), Gaps = 24/126 (19%)

Query: 12  KDGVIFLTGGTGFMGKVLLDTLLRRFPS-IH-------SIYILVRERKGVSPQERIEKML 63
           K   I +TGG G +G  L+  +L+  P  +         ++ LVRE        R     
Sbjct: 1   KGKTILVTGGAGSIGSELVRQILKFGPKKLIVFDRDENKLHELVREL-------RSRFPH 53

Query: 64  DNEGPIFKDFANLVRL----KTQRIRFIF-LATLRF----DEELKIAIRTNICATQTVVK 114
           D    I  D  +  RL    K +    +F  A L+     ++  + AI+TN+  T+ V+ 
Sbjct: 54  DKLRFIIGDVRDKERLRRAFKERGPDIVFHAAALKHVPSMEDNPEEAIKTNVLGTKNVID 113

Query: 115 LAKQCP 120
            A +  
Sbjct: 114 AAIENG 119


>gnl|CDD|224015 COG1090, COG1090, Predicted nucleoside-diphosphate sugar
          epimerase [General function prediction only].
          Length = 297

 Score = 33.0 bits (76), Expect = 0.020
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVS 54
          I +TGGTG +G+ L   L +     H + IL R     S
Sbjct: 1  ILITGGTGLIGRALTARLRK---GGHQVTILTRRPPKAS 36


>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine
           4,6-dehydratase/5-epimerase.  The FnlA enzyme is the
           first step in the biosynthesis of UDP-FucNAc from
           UDP-GlcNAc in E. coli (along with FnlB and FnlC). The
           proteins identified by this model include FnlA homologs
           in the O-antigen clusters of O4, O25, O26, O29 (Shigella
           D11), O118, O145 and O172 serotype strains, all of which
           produce O-antigens containing FucNAc (or the further
           modified FucNAm). A homolog from Pseudomonas aerugiosa
           serotype O11, WbjB, also involved in the biosynthesis of
           UDP-FucNAc has been characterized and is now believed to
           carry out both the initial 4,6-dehydratase reaction and
           the subsequent epimerization of the resulting methyl
           group at C-5. A phylogenetic tree of related sequences
           shows a distinct clade of enzymes involved in the
           biosynthesis of UDP-QuiNAc (Qui=qinovosamine). This
           clade appears to be descendant from the common ancestor
           of the Pseudomonas and E. coli fucose-biosynthesis
           enzymes. It has been hypothesized that the first step in
           the biosynthesis of these two compounds may be the same,
           and thus that these enzymes all have the same function.
           At present, lacking sufficient confirmation of this, the
           current model trusted cutoff only covers the tree
           segment surrounding the E. coli genes. The clades
           containing the Pseudomonas and QuiNAc biosynthesis
           enzymes score above the noise cutoff. Immediately below
           the noise cutoff are enzymes involved in the
           biosynthesis of UDP-RhaNAc (Rha=rhamnose), which again
           may or may not produce the same product.
          Length = 337

 Score = 33.0 bits (75), Expect = 0.027
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 20/118 (16%)

Query: 11  YKDGVIFLTGGTGFMGKVLLDTLLRRFPS--IHSIYILVRERKGVSPQERIEKMLDNEGP 68
           +KD ++ +TGGTG  G    + +LRRF    I  I I  R+ K    Q+ + K  +N   
Sbjct: 2   FKDKILLITGGTGSFG----NAVLRRFLDTDIKEIRIFSRDEK---KQDDMRKKYNNSKL 54

Query: 69  IF-----KDFANLVRLKTQRIRFIF-LATLRFDEELKI----AIRTNICATQTVVKLA 116
            F     +D+ +++   T+ + FI+  A L+     +     A++TN+  T+ V++ A
Sbjct: 55  KFYIGDVRDYRSILN-ATRGVDFIYHAAALKQVPSCEFHPMEAVKTNVLGTENVLEAA 111


>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs.  Extended SDRs are distinct
          from classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 200

 Score = 32.7 bits (75), Expect = 0.029
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVR 48
          I +TGG GF+G  L+  LL R    H + ++ R
Sbjct: 1  ILVTGGAGFIGSHLVRRLLERG---HEVVVIDR 30


>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 275

 Score = 32.2 bits (73), Expect = 0.053
 Identities = 22/106 (20%), Positives = 41/106 (38%), Gaps = 10/106 (9%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQER-IEKMLDNEGPIFKDFA 74
           I +TG TGF+G  ++  LL R    H +   VR  +  +     +E +L +     +D  
Sbjct: 3   ILVTGATGFVGGAVVRELLARG---HEVRAAVRNPEAAAALAGGVEVVLGD----LRDPK 55

Query: 75  NLVRLKTQRIRFIFLATLRFDEELKIA--IRTNICATQTVVKLAKQ 118
           +LV         + ++ L    +   A  +   + A +      K 
Sbjct: 56  SLVAGAKGVDGVLLISGLLDGSDAFRAVQVTAVVRAAEAAGAGVKH 101


>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7.  This subgroup
          contains atypical SDRs of unknown function. Members of
          this subgroup have a glycine-rich NAD(P)-binding motif
          consensus that matches the extended SDRs, TGXXGXXG, but
          lacks the characteristic active site residues of the
          SDRs. This subgroup has basic residues (HXXXR) in place
          of the active site motif YXXXK, these may have a
          catalytic role. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 291

 Score = 31.2 bits (71), Expect = 0.11
 Identities = 8/19 (42%), Positives = 14/19 (73%)

Query: 16 IFLTGGTGFMGKVLLDTLL 34
          +F+TG TGF+G  ++  L+
Sbjct: 3  VFVTGATGFIGSAVVRELV 21


>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family.
           This family of proteins utilise NAD as a cofactor. The
          proteins in this family use nucleotide-sugar substrates
          for a variety of chemical reactions.
          Length = 233

 Score = 30.7 bits (70), Expect = 0.14
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 16 IFLTGGTGFMGKVLLDTLLRR 36
          I +TGGTGF+G  L+  LL+ 
Sbjct: 1  ILVTGGTGFIGSHLVRRLLQE 21


>gnl|CDD|178263 PLN02657, PLN02657, 3,8-divinyl protochlorophyllide a 8-vinyl
          reductase.
          Length = 390

 Score = 30.9 bits (70), Expect = 0.15
 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 12 KDGVIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGV 53
          KD  + + G TG++GK ++  L+RR    +++  + RE+ G+
Sbjct: 59 KDVTVLVVGATGYIGKFVVRELVRRG---YNVVAVAREKSGI 97


>gnl|CDD|181205 PRK08040, PRK08040, putative semialdehyde dehydrogenase;
          Provisional.
          Length = 336

 Score = 30.4 bits (69), Expect = 0.21
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 16 IFLTGGTGFMGKVLLDTLL-RRFPSIHSIYILVRER 50
          I L G TG +G+ LL+ L  R+FP +  +Y L  E 
Sbjct: 7  IALLGATGAVGEALLELLAERQFP-VGELYALASEE 41


>gnl|CDD|187560 cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs.
          Atypical SDRs in this subgroup include CC3 (also known
          as TIP30) which is implicated in tumor suppression.
          Atypical SDRs are distinct from classical SDRs. Members
          of this subgroup have a glycine rich NAD(P)-binding
          motif that resembles the extended SDRs, and have an
          active site triad of the SDRs (YXXXK and upstream Ser),
          although the upstream Asn of the usual SDR active site
          is substituted with Asp. For CC3, the Tyr of the triad
          is displaced compared to the usual SDRs and the protein
          is monomeric, both these observations suggest that the
          usual SDR catalytic activity is not present. NADP
          appears to serve an important role as a ligand, and may
          be important in the interaction with other
          macromolecules. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 214

 Score = 30.0 bits (68), Expect = 0.26
 Identities = 24/83 (28%), Positives = 32/83 (38%), Gaps = 15/83 (18%)

Query: 17 FLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQ--ERIEKMLDNEGPIFKDFA 74
           + G TG +GK LL  LL+  P    +  +VR RK   P+  E++         I  DF 
Sbjct: 4  LVLGATGLVGKHLLRELLKS-PYYSKVTAIVR-RKLTFPEAKEKLV-------QIVVDFE 54

Query: 75 NLVRLKTQRIR----FIFLATLR 93
           L             F  L T R
Sbjct: 55 RLDEYLEAFQNPDVGFCCLGTTR 77


>gnl|CDD|187575 cd05265, SDR_a1, atypical (a) SDRs, subgroup 1.  Atypical SDRs in
          this subgroup are poorly defined and have been
          identified putatively as isoflavones reductase, sugar
          dehydratase, mRNA binding protein etc. Atypical SDRs
          are distinct from classical SDRs. Members of this
          subgroup retain the canonical active site triad (though
          not the upstream Asn found in most SDRs) but have an
          unusual putative glycine-rich NAD(P)-binding motif,
          GGXXXXG, in the usual location. Atypical SDRs generally
          lack the catalytic residues characteristic of the SDRs,
          and their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 250

 Score = 29.6 bits (67), Expect = 0.34
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 20 GGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIE 60
          GGT F+GK L++ LL      H + +  R R      E +E
Sbjct: 7  GGTRFIGKALVEELLAAG---HDVTVFNRGRTKPDLPEGVE 44


>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5.  This subgroup
          contains atypical SDRs, some of which are identified as
          putative NAD(P)-dependent epimerases, one as a putative
          NAD-dependent epimerase/dehydratase. Atypical SDRs are
          distinct from classical SDRs. Members of this subgroup
          have a glycine-rich NAD(P)-binding motif that is very
          similar to the extended SDRs, GXXGXXG, and binds NADP.
          Generally, this subgroup has poor conservation of the
          active site tetrad; however, individual sequences do
          contain matches to the YXXXK active site motif, the
          upstream Ser, and there is a highly conserved Asp in
          place of the usual active site Asn throughout the
          subgroup. Atypical SDRs generally lack the catalytic
          residues characteristic of the SDRs, and their
          glycine-rich NAD(P)-binding motif is often different
          from the forms normally seen in classical or extended
          SDRs. Atypical SDRs include biliverdin IX beta
          reductase (BVR-B,aka flavin reductase), NMRa (a
          negative transcriptional regulator of various fungi),
          progesterone 5-beta-reductase like proteins,
          phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 203

 Score = 29.5 bits (67), Expect = 0.35
 Identities = 11/42 (26%), Positives = 20/42 (47%), Gaps = 3/42 (7%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQE 57
          + + G TG +G+ ++  LL R    + +  LVR+       E
Sbjct: 2  VLVVGATGKVGRHVVRELLDRG---YQVRALVRDPSQAEKLE 40


>gnl|CDD|181609 PRK09009, PRK09009, C factor cell-cell signaling protein;
          Provisional.
          Length = 235

 Score = 29.3 bits (66), Expect = 0.45
 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFP--SIHSIY 44
          I + GG+G +GK ++  LL R+P  ++H+ Y
Sbjct: 3  ILIVGGSGGIGKAMVKQLLERYPDATVHATY 33


>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup
          3, extended (e) SDRs.  Members of this bacterial
          subgroup are identified as possible sugar epimerases,
          such as UDP-glucose 4 epimerase. However, while the
          NAD(P)-binding motif is fairly well conserved, not all
          members retain the canonical active site tetrad of the
          extended SDRs. UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 306

 Score = 29.3 bits (66), Expect = 0.49
 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQ 56
          I +TG  G +G++L    L   P +  +  L R R   SP 
Sbjct: 1  ILVTGAAGGLGRLLA-RRLAASPRVIGVDGLDRRRPPGSPP 40


>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase.  This
          enzyme catalyzes the first step in the biosynthesis of
          pseudaminic acid, the conversion of
          UDP-N-acetylglucosamine to
          UDP-4-keto-6-deoxy-N-acetylglucosamine. These sequences
          are members of the broader pfam01073 (3-beta
          hydroxysteroid dehydrogenase/isomerase family) family.
          Length = 324

 Score = 29.3 bits (66), Expect = 0.51
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRE 49
          I +TGGTG  GK  +  LL  + +   I I  R+
Sbjct: 7  ILITGGTGSFGKAFISRLLENY-NPKKIIIYSRD 39


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 29.3 bits (66), Expect = 0.58
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 11  YKDGVIFL-TGGTGFMGKVLLDTLLRRF 37
            K G ++L TGG G +G+ L   L RR+
Sbjct: 202 LKPGGVYLVTGGAGGIGRALARALARRY 229


>gnl|CDD|203953 pfam08468, MTS_N, Methyltransferase small domain N-terminal.  This
           domain is found to the N-terminus of the
           methyltransferase small domain (pfam05175) in bacterial
           proteins.
          Length = 155

 Score = 28.4 bits (64), Expect = 0.63
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 3/43 (6%)

Query: 29  LLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFK 71
           LL  LL + P    I+I+   R GV      EKML   GP+ K
Sbjct: 87  LLMNLLSKLPIGTEIFIVGENRSGV---RSAEKMLAAYGPLRK 126


>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases
           [Cell envelope biogenesis, outer membrane / Carbohydrate
           transport and metabolism].
          Length = 588

 Score = 28.8 bits (65), Expect = 0.68
 Identities = 26/133 (19%), Positives = 48/133 (36%), Gaps = 36/133 (27%)

Query: 10  FYKDGVIFLTGGTGFMGKVLLDTLLRRFP-----------SIHSIYILVRERKGVSPQER 58
                 + +TGG G +G  L   +L+  P            ++ I + +RE+        
Sbjct: 247 MLTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPE----- 301

Query: 59  IEKMLDNEGPIFKDFANLVRLK----TQRIRFIF-LATL-------RFDEELKIAIRTNI 106
             K+         D  +  R++      ++  +F  A L          EE   AI+TN+
Sbjct: 302 -LKLR----FYIGDVRDRDRVERAMEGHKVDIVFHAAALKHVPLVEYNPEE---AIKTNV 353

Query: 107 CATQTVVKLAKQC 119
             T+ V + A + 
Sbjct: 354 LGTENVAEAAIKN 366


>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs.
          This subgroup contains FRs of the extended SDR-type and
          related proteins. These FRs act in the NADP-dependent
          reduction of  flavonoids, ketone-containing plant
          secondary metabolites; they have the characteristic
          active site triad of the SDRs (though not the upstream
          active site Asn) and a NADP-binding motif that is very
          similar to the typical extended SDR motif. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 293

 Score = 28.3 bits (64), Expect = 0.86
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 19 TGGTGFMGKVLLDTLLRR 36
          TG +GF+G  L+  LL+R
Sbjct: 4  TGASGFIGSWLVKRLLQR 21


>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          archaeal and bacterial proteins, and has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 305

 Score = 28.4 bits (64), Expect = 0.87
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 16 IFLTGGTGFMGKVLLDTLLRR 36
          I +TGG GF+G  L+D LL  
Sbjct: 2  ILVTGGAGFIGSHLVDRLLEE 22


>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4,
          extended (e) SDRs.  UDP-glucose 4 epimerase (aka
          UDP-galactose-4-epimerase), is a homodimeric extended
          SDR. It catalyzes the NAD-dependent conversion of
          UDP-galactose to UDP-glucose, the final step in Leloir
          galactose synthesis. This subgroup is comprised of
          bacterial proteins, and includes the Staphylococcus
          aureus capsular polysaccharide Cap5N, which may have a
          role in the synthesis of UDP-N-acetyl-d-fucosamine.
          This subgroup has the characteristic active site tetrad
          and NAD-binding motif of the extended SDRs. Extended
          SDRs are distinct from classical SDRs. In addition to
          the Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 303

 Score = 28.5 bits (64), Expect = 0.88
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGP 68
          + +TG  GF+G+ L+D LL R      + I VR  +   P   + ++ D +  
Sbjct: 2  VLVTGANGFIGRALVDKLLSRG---EEVRIAVRNAENAEPSVVLAELPDIDSF 51


>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup
          5, extended (e) SDRs.  This subgroup partially
          conserves the characteristic active site tetrad and
          NAD-binding motif of the extended SDRs, and has been
          identified as possible UDP-glucose 4-epimerase (aka
          UDP-galactose 4-epimerase), a homodimeric member of the
          extended SDR family. UDP-glucose 4-epimerase catalyzes
          the NAD-dependent conversion of UDP-galactose to
          UDP-glucose, the final step in Leloir galactose
          synthesis. Extended SDRs are distinct from classical
          SDRs. In addition to the Rossmann fold (alpha/beta
          folding pattern with a central beta-sheet) core region
          typical of all SDRs, extended SDRs have a less
          conserved C-terminal extension of approximately 100
          amino acids. Extended SDRs are a diverse collection of
          proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 28.4 bits (64), Expect = 0.93
 Identities = 18/75 (24%), Positives = 30/75 (40%), Gaps = 7/75 (9%)

Query: 18 LTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFANLV 77
          + GG GF+G  L+D LL   P +        +R  + P E     +D     +++ A+L 
Sbjct: 4  IVGGNGFIGSHLVDALLEEGPQVRVF-----DRS-IPPYELPLGGVDYIKGDYENRADLE 57

Query: 78 R-LKTQRIRFIFLAT 91
            L          +T
Sbjct: 58 SALVGIDTVIHLAST 72


>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7.  These proteins
          are members of the classical SDR family, with a
          canonical active site triad (and also an active site
          Asn) and a typical Gly-rich NAD-binding motif. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet), an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Classical SDRs
          are typically about 250 residues long, while extended
          SDRS are approximately 350 residues. Sequence identity
          between different SDR enzymes are typically in the
          15-30% range, but the enzymes share the Rossmann fold
          NAD-binding motif and characteristic NAD-binding and
          catalytic sequence patterns. These enzymes have a
          3-glycine N-terminal NAD(P)(H)-binding pattern
          (typically, TGxxxGxG in classical SDRs and TGxxGxxG in
          extended SDRs), while substrate binding is in the
          C-terminal region. A critical catalytic Tyr residue
          (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase
          (15-PGDH) numbering), is often found in a conserved
          YXXXK pattern. In addition to the Tyr and Lys, there is
          often an upstream Ser (Ser-138, 15-PGDH numbering)
          and/or an Asn (Asn-107, 15-PGDH numbering) or
          additional Ser, contributing to the active site.
          Substrates for these enzymes include sugars, steroids,
          alcohols, and aromatic compounds. The standard reaction
          mechanism is a proton relay involving the conserved Tyr
          and Lys, as well as Asn (or Ser). Some SDR family
          members, including 17 beta-hydroxysteroid dehydrogenase
          contain an additional helix-turn-helix motif that is
          not generally found among SDRs.
          Length = 235

 Score = 28.1 bits (63), Expect = 1.1
 Identities = 15/64 (23%), Positives = 27/64 (42%), Gaps = 4/64 (6%)

Query: 12 KDGVIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFK 71
          KD  + +TG    +GK  +++LL        +Y  VR+    +    + K  D   P+  
Sbjct: 2  KDKTVLVTGANRGIGKAFVESLLAHGAK--KVYAAVRDPGSAA--HLVAKYGDKVVPLRL 57

Query: 72 DFAN 75
          D  +
Sbjct: 58 DVTD 61


>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains CDP-D-glucose
          4,6-dehydratase, an extended SDR, which catalyzes the
          conversion of CDP-D-glucose to
          CDP-4-keto-6-deoxy-D-glucose. This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 336

 Score = 28.1 bits (63), Expect = 1.2
 Identities = 9/25 (36%), Positives = 13/25 (52%)

Query: 10 FYKDGVIFLTGGTGFMGKVLLDTLL 34
          F++   + +TG TGF G  L   L 
Sbjct: 1  FWQGKRVLVTGHTGFKGSWLSLWLQ 25


>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein.
           This is a family of diverse bacterial polysaccharide
           biosynthesis proteins including the CapD protein, WalL
           protein mannosyl-transferase and several putative
           epimerases (e.g. WbiI).
          Length = 280

 Score = 27.8 bits (63), Expect = 1.2
 Identities = 26/122 (21%), Positives = 45/122 (36%), Gaps = 26/122 (21%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFKDFAN 75
           + +TGG G +G  L   +L+   +   I +  R+         I + L  E    K    
Sbjct: 1   VLVTGGGGSIGSELCRQILKF--NPKKIILFSRDEFK---LYEIRQELRQEYNDPKLRFF 55

Query: 76  L--VR--------LKTQRIRFIF-LATL-------RFDEELKIAIRTNICATQTVVKLAK 117
           +  VR        ++   +  +F  A L           E   AI+TN+  T+ V + A 
Sbjct: 56  IGDVRDRERLERAMEQHGVDTVFHAAALKHVPLVEYNPME---AIKTNVLGTENVAEAAI 112

Query: 118 QC 119
           + 
Sbjct: 113 EN 114


>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase.
          Length = 442

 Score = 28.0 bits (62), Expect = 1.3
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 16  IFLTGGTGFMGKVLLDTLLRRFPSI 40
           + +TGG GF+G  L+D L+ R  S+
Sbjct: 122 VVVTGGAGFVGSHLVDRLMARGDSV 146


>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid
          dehydrogenase) and HSD3B1(delta 5-delta
          4-isomerase)-like, extended (e) SDRs.  This
          extended-SDR subgroup includes human 3 beta-HSD/HSD3B1
          and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7], and related proteins. These proteins have the
          characteristic active site tetrad and NAD(P)-binding
          motif of extended SDRs. 3 beta-HSD catalyzes the
          oxidative conversion of delta 5-3 beta-hydroxysteroids
          to the delta 4-3-keto configuration; this activity is
          essential for the biosynthesis of all classes of
          hormonal steroids. C(27) 3beta-HSD is a membrane-bound
          enzyme of the endoplasmic reticulum, it catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 354

 Score = 27.9 bits (62), Expect = 1.6
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 15 VIFLTGGTGFMGKVLLDTLLRRFPSIHSIYIL 46
          V  +TGG GF+G+ ++  LL R   +  I +L
Sbjct: 1  VCLVTGGGGFLGQHIIRLLLERKEELKEIRVL 32


>gnl|CDD|187569 cd05259, PCBER_SDR_a, phenylcoumaran benzylic ether reductase
          (PCBER) like, atypical (a) SDRs.  PCBER and
          pinoresinol-lariciresinol reductases are
          NADPH-dependent aromatic alcohol reductases, and are
          atypical members of the SDR family. Other proteins in
          this subgroup are identified as eugenol synthase. These
          proteins contain an N-terminus characteristic of
          NAD(P)-binding proteins and a small C-terminal domain
          presumed to be involved in substrate binding, but they
          do not have the conserved active site Tyr residue
          typically found in SDRs. Numerous other members have
          unknown functions. The glycine rich NADP-binding motif
          in this subgroup is of 2 forms: GXGXXG and G[GA]XGXXG;
          it tends to be atypical compared with the forms
          generally seen in classical or extended SDRs. The usual
          SDR active site tetrad is not present, but a critical
          active site Lys at the usual SDR position has been
          identified in various members, though other charged and
          polar residues are found at this position in this
          subgroup. Atypical SDR-related proteins retain the
          Rossmann fold of the SDRs, but have limited sequence
          identity and generally lack the catalytic properties of
          the archetypical members. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 282

 Score = 27.7 bits (62), Expect = 1.6
 Identities = 9/36 (25%), Positives = 16/36 (44%), Gaps = 2/36 (5%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERK 51
          I + G TG +G  ++  LL       ++ +L R   
Sbjct: 2  IAIAGATGTLGGPIVSALLASPG--FTVTVLTRPSS 35


>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone
           protein, and related proteins.  This bacterial subfamily
           includes the uncharacterized Escherichia coli YegD. It
           belongs to the heat shock protein 70 (HSP70) family of
           chaperones that assist in protein folding and assembly
           and can direct incompetent "client" proteins towards
           degradation. Typically, HSP70s have a nucleotide-binding
           domain (NBD) and a substrate-binding domain (SBD). The
           nucleotide sits in a deep cleft formed between the two
           lobes of the NBD. The two subdomains of each lobe change
           conformation between ATP-bound, ADP-bound, and
           nucleotide-free states. ATP binding opens up the
           substrate-binding site; substrate-binding increases the
           rate of ATP hydrolysis. YegD lacks the SBD. HSP70
           chaperone activity is regulated by various
           co-chaperones: J-domain proteins and nucleotide exchange
           factors (NEFs). Some family members are not chaperones
           but instead, function as NEFs for their Hsp70 partners,
           other family members function as both chaperones and
           NEFs.
          Length = 415

 Score = 27.5 bits (62), Expect = 2.1
 Identities = 8/24 (33%), Positives = 12/24 (50%), Gaps = 1/24 (4%)

Query: 15  VIFLTGGTGFMGKVLLDTLLRRFP 38
            +FLTGG+  +   +      RFP
Sbjct: 371 RVFLTGGSSLVP-AVRQAFAARFP 393


>gnl|CDD|204268 pfam09550, DUF2376, Conserved hypothetical phage protein
          (DUF2376).  This entry describes a family of proteins
          found exclusively in phage or in prophage regions of
          bacterial genomes, including the phage-like Rhodobacter
          capsulatus gene transfer agent, which packages DNA.
          Length = 43

 Score = 25.3 bits (56), Expect = 2.4
 Identities = 8/21 (38%), Positives = 11/21 (52%)

Query: 18 LTGGTGFMGKVLLDTLLRRFP 38
             G   + +  LD L+RRFP
Sbjct: 22 ARAGAAPLDRAGLDALMRRFP 42


>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase.  The
          sequences in this family are members of the pfam01370
          superfamily of NAD-dependent epimerases and
          dehydratases typically acting on nucleotide-sugar
          substrates. The genes of the family modeled here are
          generally in the same locus with genes involved in the
          biosynthesis and elaboration of hopene, the cyclization
          product of the polyisoprenoid squalene. This gene and
          its association with hopene biosynthesis in Zymomonas
          mobilis has been noted in the literature where the gene
          symbol hpnA was assigned. Hopanoids are known to be
          components of the plasma membrane and to have polar
          sugar head groups in Z. mobilis and other species.
          Length = 328

 Score = 26.9 bits (60), Expect = 2.7
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 14 GVIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNE 66
            + +TG TGF+G  ++  LL +      + +LVR     S +  +E  LD E
Sbjct: 1  MKVLVTGATGFVGSAVVRLLLEQG---EEVRVLVRPT---SDRRNLE-GLDVE 46


>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs.  This
          subgroup contains aldehyde reductase of the extended
          SDR-type and related proteins. Aldehyde reductase I
          (aka carbonyl reductase) is an NADP-binding SDR; it has
          an NADP-binding motif consensus that is slightly
          different from the canonical SDR form and lacks the Asn
          of the extended SDR active site tetrad. Aldehyde
          reductase I catalyzes the NADP-dependent  reduction of
          ethyl 4-chloro-3-oxobutanoate to ethyl
          (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 301

 Score = 26.8 bits (60), Expect = 3.0
 Identities = 7/22 (31%), Positives = 15/22 (68%)

Query: 15 VIFLTGGTGFMGKVLLDTLLRR 36
          ++ +TG TGF+   +++ LL+ 
Sbjct: 1  LVLVTGATGFIASHIVEQLLKA 22


>gnl|CDD|201603 pfam01118, Semialdhyde_dh, Semialdehyde dehydrogenase, NAD
          binding domain.  This Pfam entry contains the following
          members: N-acetyl-glutamine semialdehyde dehydrogenase
          (AgrC) Aspartate-semialdehyde dehydrogenase.
          Length = 121

 Score = 26.4 bits (59), Expect = 3.1
 Identities = 10/37 (27%), Positives = 19/37 (51%), Gaps = 4/37 (10%)

Query: 14 GVIFLTGGTGFMGKVLLDTLLRRFPSIHSIYILVRER 50
           ++   G TG++G+ LL  LL   P +  + ++   R
Sbjct: 3  AIV---GATGYVGQELL-RLLAEHPPLELVALVASSR 35


>gnl|CDD|221420 pfam12099, DUF3575, Protein of unknown function (DUF3575).  This
           family of proteins are functionally uncharacterized.
           This family is only found in bacteria. Proteins in this
           family are typically between 187 to 236 amino acids in
           length.
          Length = 186

 Score = 26.4 bits (59), Expect = 3.3
 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 5/29 (17%)

Query: 83  RIRFIFLATLRFDEEL-----KIAIRTNI 106
           +IR++ L  L F          +A++TN+
Sbjct: 3   KIRYLLLFLLLFCSLSPARAQVVAVKTNL 31


>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. 
          GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase)
          acts in the NADP-dependent synthesis of GDP-fucose from
          GDP-mannose. Two activities have been proposed for the
          same active site: epimerization and reduction. Proteins
          in this subgroup are extended SDRs, which have a
          characteristic active site tetrad and an NADP-binding
          motif, [AT]GXXGXXG, that is a close match to the
          archetypical form. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 300

 Score = 26.8 bits (60), Expect = 3.8
 Identities = 8/21 (38%), Positives = 12/21 (57%)

Query: 16 IFLTGGTGFMGKVLLDTLLRR 36
          I +TG  G +G  ++  L RR
Sbjct: 2  ILVTGHRGLVGSAIVRVLARR 22


>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase.
          Length = 436

 Score = 26.5 bits (58), Expect = 4.6
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 16  IFLTGGTGFMGKVLLDTLLRR 36
           I +TGG GF+G  L+D L+ R
Sbjct: 123 IVVTGGAGFVGSHLVDKLIGR 143


>gnl|CDD|218047 pfam04367, DUF502, Protein of unknown function (DUF502).
          Predicted to be an integral membrane protein.
          Length = 108

 Score = 25.5 bits (57), Expect = 4.7
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%)

Query: 15 VIFLTG--GTGFMGKVLL---DTLLRRFPSIHSIYILVR 48
          +IFL G     F+G+ LL   + LL R P + SIY  V+
Sbjct: 7  LIFLVGLLARNFIGRWLLSLGERLLNRIPLVRSIYSSVK 45


>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase.  Members
          of this protein family are CDP-glucose 4,6-dehydratase
          from a variety of Gram-negative and Gram-positive
          bacteria. Members typically are encoded next to a gene
          that encodes a glucose-1-phosphate
          cytidylyltransferase, which produces the substrate,
          CDP-D-glucose, used by this enzyme to produce
          CDP-4-keto-6-deoxyglucose [Cell envelope, Biosynthesis
          and degradation of surface polysaccharides and
          lipopolysaccharides].
          Length = 349

 Score = 26.5 bits (59), Expect = 4.7
 Identities = 7/17 (41%), Positives = 11/17 (64%)

Query: 10 FYKDGVIFLTGGTGFMG 26
          F++   + +TG TGF G
Sbjct: 1  FWQGKKVLVTGHTGFKG 17


>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase,
          extended (e) SDRs.  This subgroup contains
          UDP-N-acetylglucosamine 4-epimerase of Pseudomonas
          aeruginosa, WbpP,  an extended SDR, that catalyzes the
          NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to
          UDP-Glc and UDP-Gal.  This subgroup has the
          characteristic active site tetrad and NAD-binding motif
          of the extended SDRs. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 304

 Score = 26.4 bits (59), Expect = 4.8
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 19 TGGTGFMGKVLLDTLLRR 36
          TGG GF+G  L++ LL R
Sbjct: 5  TGGAGFIGSHLVERLLER 22


>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit;
           Reviewed.
          Length = 616

 Score = 26.6 bits (59), Expect = 4.8
 Identities = 7/29 (24%), Positives = 15/29 (51%), Gaps = 2/29 (6%)

Query: 45  ILVRERKGVSPQERIEKMLDNEGPIFKDF 73
           +++ ER  +     I + L ++GP+  D 
Sbjct: 530 MVISERDQLKDA--IAEALAHDGPVLIDV 556


>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase.
          Length = 353

 Score = 26.3 bits (58), Expect = 4.9
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 18 LTGGTGFMGKVLLDTLLRRFPSIHS 42
          +TG TG++G  L+  LL+R  ++H+
Sbjct: 15 VTGATGYIGSWLVKLLLQRGYTVHA 39


>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase.
          Length = 367

 Score = 26.3 bits (58), Expect = 5.3
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 9/44 (20%)

Query: 19 TGGTGFMGKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKM 62
          TGG  F+G  ++D LLR   S+         R  V  QE  EK+
Sbjct: 59 TGGVSFLGLAIVDRLLRHGYSV---------RIAVDTQEDKEKL 93


>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH
          and WbmG-like, extended (e) SDRs.  Bordetella
          bronchiseptica enzymes WbmH and WbmG, and related
          proteins. This subgroup exhibits the active site tetrad
          and NAD-binding motif of the extended SDR family. It
          has been proposed that the active site in Bordetella
          WbmG and WbmH cannot function as an epimerase, and that
          it plays a role in O-antigen synthesis pathway from
          UDP-2,3-diacetamido-2,3-dideoxy-l-galacturonic acid.
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 307

 Score = 26.3 bits (58), Expect = 5.5
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 16 IFLTGGTGFMGKVLLDTLLRR 36
          + +TGG G +G  L++ LL R
Sbjct: 3  VLITGGAGQIGSHLIEHLLER 23


>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases
          (3b-HSD)-like, extended (e) SDRs.  Extended SDR family
          domains belonging to this subgroup have the
          characteristic active site tetrad and a fairly
          well-conserved NAD(P)-binding motif. 3b-HSD catalyzes
          the NAD-dependent conversion of various steroids, such
          as pregnenolone to progesterone, or androstenediol to
          testosterone. This subgroup includes an unusual
          bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis
          thaliana, and Saccharomyces cerevisiae ERG26, a
          3b-HSD/C-4 decarboxylase, involved in the synthesis of
          ergosterol, the major sterol of yeast. It also includes
          human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/
          [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase;
          HSD3B7].  C(27) 3beta-HSD/HSD3B7 is a membrane-bound
          enzyme of the endoplasmic reticulum, that catalyzes the
          isomerization and oxidation of 7alpha-hydroxylated
          sterol intermediates, an early step in bile acid
          biosynthesis. Mutations in the human NSDHL (NAD(P)H
          steroid dehydrogenase-like protein) cause CHILD
          syndrome (congenital hemidysplasia with ichthyosiform
          nevus and limb defects), an X-linked dominant,
          male-lethal trait. Mutations in the human gene encoding
          C(27) 3beta-HSD underlie a rare autosomal recessive
          form of neonatal cholestasis. Extended SDRs are
          distinct from classical SDRs. In addition to the
          Rossmann fold (alpha/beta folding pattern with a
          central beta-sheet) core region typical of all SDRs,
          extended SDRs have a less conserved C-terminal
          extension of approximately 100 amino acids. Extended
          SDRs are a diverse collection of proteins, and include
          isomerases, epimerases, oxidoreductases, and lyases;
          they typically have a TGXXGXXG cofactor binding motif.
          SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid sythase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 331

 Score = 26.2 bits (58), Expect = 5.7
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 19 TGGTGFMGKVLLDTLLRR 36
          TGG+GF G+ L+  LL R
Sbjct: 5  TGGSGFFGERLVKQLLER 22


>gnl|CDD|131703 TIGR02655, circ_KaiC, circadian clock protein KaiC.  Members of
           this family are the circadian clock protein KaiC, part
           of the kaiABC operon that controls circadian rhythm. It
           may be universal in Cyanobacteria. Each member has two
           copies of the KaiC domain (pfam06745), which is also
           found in other proteins. KaiC performs
           autophosphorylation and acts as its own transcriptional
           repressor [Cellular processes, Other].
          Length = 484

 Score = 26.1 bits (57), Expect = 5.7
 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 10  FYKDGVIFLTGGTGFMGKVLL 30
           F+KD +I  TG TG  GK LL
Sbjct: 260 FFKDSIILATGATG-TGKTLL 279


>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated.
          Length = 238

 Score = 25.6 bits (57), Expect = 6.8
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 12 KDGVIFLTGGTGFMGKVLLDTLLRR 36
          K  V+ +TG    +G+  ++ LL R
Sbjct: 5  KGKVVLVTGANRGIGRAFVEQLLAR 29


>gnl|CDD|223640 COG0566, SpoU, rRNA methylases [Translation, ribosomal structure
          and biogenesis].
          Length = 260

 Score = 25.7 bits (57), Expect = 7.3
 Identities = 7/46 (15%), Positives = 14/46 (30%), Gaps = 2/46 (4%)

Query: 26 GKVLLDTLLRRFPSIHSIYILVRERKGVSPQERIEKMLDNEGPIFK 71
          G+  +   L   P I  I +          +E +        P++ 
Sbjct: 26 GEHAVLEALASGPKIVRILVTEGRLPRF--EELLALAAAKGIPVYV 69


>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended
          (e) SDRs.  This subgroup contains dTDP-D-glucose
          4,6-dehydratase and related proteins, members of the
          extended-SDR family, with the characteristic Rossmann
          fold core region, active site tetrad and NAD(P)-binding
          motif. dTDP-D-glucose 4,6-dehydratase is closely
          related to other sugar epimerases of the SDR family.
          dTDP-D-dlucose 4,6,-dehydratase catalyzes the second of
          four steps in the dTDP-L-rhamnose pathway (the
          dehydration of dTDP-D-glucose to
          dTDP-4-keto-6-deoxy-D-glucose) in the synthesis of
          L-rhamnose, a cell wall component of some pathogenic
          bacteria. In many gram negative bacteria, L-rhamnose is
          an important constituent of lipopoylsaccharide
          O-antigen. The larger N-terminal portion of
          dTDP-D-Glucose 4,6-dehydratase forms a Rossmann fold
          NAD-binding domain, while the C-terminus binds the
          sugar substrate. Extended SDRs are distinct from
          classical SDRs. In addition to the Rossmann fold
          (alpha/beta folding pattern with a central beta-sheet)
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids. Extended SDRs are a diverse collection
          of proteins, and include isomerases, epimerases,
          oxidoreductases, and lyases; they typically have a
          TGXXGXXG cofactor binding motif. SDRs are a
          functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. Atypical SDRs generally lack the
          catalytic residues characteristic of the SDRs, and
          their glycine-rich NAD(P)-binding motif is often
          different from the forms normally seen in classical or
          extended SDRs. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 315

 Score = 25.6 bits (57), Expect = 7.6
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 16 IFLTGGTGFMGKVLLDTLLRRFPSIHSI 43
          I +TGG GF+G   +  LL ++P    I
Sbjct: 3  ILVTGGAGFIGSNFVRYLLNKYPDYKII 30


>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin
           oxidoreductases use flavin as a substrate in mediating
           electron transfer from iron complexes or iron proteins.
           Structurally similar to ferredoxin reductases, but with
           only 15% sequence identity, flavin reductases reduce
           FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a
           substrate, rather than a tightly bound prosthetic group
           as in flavoenzymes; weaker binding is due to the absence
           of a binding site for the AMP moeity of FAD.
          Length = 224

 Score = 25.6 bits (57), Expect = 8.5
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query: 15  VIFLTGGTGFMG-KVLLDTLLRRFPS--IHSIYILVRER 50
           +I + GGTGF   K +L+ LL +     IH +Y   R  
Sbjct: 101 LILIAGGTGFAPIKSILEHLLAQGSKRPIH-LYWGARTE 138


>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and
          related proteins, extended (e) SDRs.  UGD catalyzes the
          formation of UDP-xylose from UDP-glucuronate; it is an
          extended-SDR, and has the characteristic glycine-rich
          NAD-binding pattern, TGXXGXXG, and active site tetrad. 
          Extended SDRs are distinct from classical SDRs. In
          addition to the Rossmann fold (alpha/beta folding
          pattern with a central beta-sheet) core region typical
          of all SDRs, extended SDRs have a less conserved
          C-terminal extension of approximately 100 amino acids.
          Extended SDRs are a diverse collection of proteins, and
          include isomerases, epimerases, oxidoreductases, and
          lyases; they typically have a TGXXGXXG cofactor binding
          motif. SDRs are a functionally diverse family of
          oxidoreductases that have a single domain with a
          structurally conserved Rossmann fold, an
          NAD(P)(H)-binding region, and a structurally diverse
          C-terminal region. Sequence identity between different
          SDR enzymes is typically in the 15-30% range; they
          catalyze a wide range of activities including the
          metabolism of steroids, cofactors, carbohydrates,
          lipids, aromatic compounds, and amino acids, and act in
          redox sensing. Classical SDRs have an TGXXX[AG]XG
          cofactor binding motif and a YXXXK active site motif,
          with the Tyr residue of the active site motif serving
          as a critical catalytic residue (Tyr-151, human
          15-hydroxyprostaglandin dehydrogenase numbering). In
          addition to the Tyr and Lys, there is often an upstream
          Ser and/or an Asn, contributing to the active site;
          while substrate binding is in the C-terminal region,
          which determines specificity. The standard reaction
          mechanism is a 4-pro-S hydride transfer and proton
          relay involving the conserved Tyr and Lys, a water
          molecule stabilized by Asn, and nicotinamide. Atypical
          SDRs generally lack the catalytic residues
          characteristic of the SDRs, and their glycine-rich
          NAD(P)-binding motif is often different from the forms
          normally seen in classical or extended SDRs. Complex
          (multidomain) SDRs such as ketoreductase domains of
          fatty acid synthase have a GGXGXXG NAD(P)-binding motif
          and an altered active site motif (YXXXN). Fungal type
          ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding
          motif.
          Length = 305

 Score = 25.7 bits (57), Expect = 8.6
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 16 IFLTGGTGFMGKVLLDTLLRR 36
          I +TGG GF+G  L D LL  
Sbjct: 3  ILITGGAGFLGSHLCDRLLED 23


>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1
          alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like,
          atypical (a) SDRs.  This subgroup of extended SDR-like
          proteins are atypical SDRs. They have a glycine-rich
          NAD(P)-binding motif similar to the typical SDRs,
          GXXGXXG, and have the YXXXK active site motif (though
          not the other residues of the SDR tetrad). Members
          identified include NDUFA9 (mitochondrial) and putative
          nucleoside-diphosphate-sugar epimerase. Atypical SDRs
          generally lack the catalytic residues characteristic of
          the SDRs, and their glycine-rich NAD(P)-binding motif
          is often different from the forms normally seen in
          classical or extended SDRs. Atypical SDRs include
          biliverdin IX beta reductase (BVR-B,aka flavin
          reductase), NMRa (a negative transcriptional regulator
          of various fungi), progesterone 5-beta-reductase like
          proteins, phenylcoumaran benzylic ether and
          pinoresinol-lariciresinol reductases, phenylpropene
          synthases, eugenol synthase, triphenylmethane
          reductase, isoflavone reductases, and others. SDRs are
          a functionally diverse family of oxidoreductases that
          have a single domain with a structurally conserved
          Rossmann fold, an NAD(P)(H)-binding region, and a
          structurally diverse C-terminal region. Sequence
          identity between different SDR enzymes is typically in
          the 15-30% range; they catalyze a wide range of
          activities including the metabolism of steroids,
          cofactors, carbohydrates, lipids, aromatic compounds,
          and amino acids, and act in redox sensing. Classical
          SDRs have an TGXXX[AG]XG cofactor binding motif and a
          YXXXK active site motif, with the Tyr residue of the
          active site motif serving as a critical catalytic
          residue (Tyr-151, human 15-hydroxyprostaglandin
          dehydrogenase numbering). In addition to the Tyr and
          Lys, there is often an upstream Ser and/or an Asn,
          contributing to the active site; while substrate
          binding is in the C-terminal region, which determines
          specificity. The standard reaction mechanism is a
          4-pro-S hydride transfer and proton relay involving the
          conserved Tyr and Lys, a water molecule stabilized by
          Asn, and nicotinamide. In addition to the Rossmann fold
          core region typical of all SDRs, extended SDRs have a
          less conserved C-terminal extension of approximately
          100 amino acids, and typically have a TGXXGXXG cofactor
          binding motif. Complex (multidomain) SDRs such as
          ketoreductase domains of fatty acid synthase have a
          GGXGXXG NAD(P)-binding motif and an altered active site
          motif (YXXXN). Fungal type ketoacyl reductases have a
          TGXXXGX(1-2)G NAD(P)-binding motif.
          Length = 273

 Score = 25.3 bits (56), Expect = 9.0
 Identities = 8/22 (36%), Positives = 16/22 (72%)

Query: 15 VIFLTGGTGFMGKVLLDTLLRR 36
          V+ + G TGF+G+ +++ L +R
Sbjct: 2  VVTVFGATGFIGRYVVNRLAKR 23


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.330    0.146    0.429 

Gapped
Lambda     K      H
   0.267   0.0788    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,729,405
Number of extensions: 625694
Number of successful extensions: 949
Number of sequences better than 10.0: 1
Number of HSP's gapped: 942
Number of HSP's successfully gapped: 97
Length of query: 125
Length of database: 10,937,602
Length adjustment: 85
Effective length of query: 40
Effective length of database: 7,167,512
Effective search space: 286700480
Effective search space used: 286700480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (24.1 bits)