Diaphorina citri psyllid: psy8978

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--

CGRNGKQTAKIDKGQASEVNDWPWLVALKRQYERDNFCGGVLINERWVLTAAHCIKQKIDNALVLRRTSDLIVRLGEYDFSKVNETKVTDIPAAAMKVYPRFSEQNYENDIALVQLSKKAQYNSFVRPVCLPQAGDFYEDQIGIVTGWGTLSYGGPRSDVLMEVPIPVWRLTECRKQFSQNIFDSNLCAGGYKGGTDSCQGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKVI

ccccccccccEEccccccccccccEEEEEEccccCEEEEEEEEcccEEEEccccccccccHHHHHcccccEEEEEccEEccccccccCEEEcEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccEEEEEEEccHHHHHHHccccccccEEEEccccccccccccccccEEEEEcccccEEEEEEEEccccccccccEEEEccccHHHHHHHHccc

C*****QTAKIDKGQASEVNDWPWLVALKRQYERDNFCGGVLINERWVLTAAHCIKQKIDNALVLRRTSDLIVRLGEYDFSKVNETKVTDIPAAAMKVYPRFSEQNYENDIALVQLSKKAQYNSFVRPVCLPQAGDFYEDQIGIVTGWGTLSYGGPRSDVLMEVPIPVWRLTECRKQFSQNIFDSNLCAGGYKGGTDSCQGDSGGPLLLQRPDKQWTIIGVVSWGIGCGKTPGVYVQVNKYLRWIYNTAKVI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0019538 [BP]	protein metabolic process	confident	GO:0071704, GO:0044238, GO:0008150, GO:0008152, GO:0043170
GO:0008233 [MF]	peptidase activity	confident	GO:0016787, GO:0003674, GO:0003824
GO:0004252 [MF]	serine-type endopeptidase activity	probable	GO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005764 [CC]	lysosome	probable	GO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031000 [BP]	response to caffeine	probable	GO:0009719, GO:0050896, GO:1901698, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:0014074, GO:0010243, GO:0014070
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0034097 [BP]	response to cytokine stimulus	probable	GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0035094 [BP]	response to nicotine	probable	GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0007586 [BP]	digestion	probable	GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0007584 [BP]	response to nutrient	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0030163 [BP]	protein catabolic process	probable	GO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0022617 [BP]	extracellular matrix disassembly	probable	GO:0009987, GO:0016043, GO:0008150, GO:0030198, GO:0044763, GO:0071840, GO:0043062, GO:0022411, GO:0044699
GO:0032094 [BP]	response to food	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0009636 [BP]	response to toxic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0043065 [BP]	positive regulation of apoptotic process	probable	GO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0045087 [BP]	innate immune response	probable	GO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0045785 [BP]	positive regulation of cell adhesion	probable	GO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0017080 [MF]	sodium channel regulator activity	probable	GO:0016247, GO:0003674
GO:0043434 [BP]	response to peptide hormone stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0006814 [BP]	sodium ion transport	probable	GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0031012 [CC]	extracellular matrix	probable	GO:0005575
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0031638 [BP]	zymogen activation	probable	GO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485
GO:0030195 [BP]	negative regulation of blood coagulation	probable	GO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0030307 [BP]	positive regulation of cell growth	probable	GO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9L, chain A
Confidence level:very confident
Coverage over the Query: 1-250
View the alignment between query and template
View the model in PyMOL