Diaphorina citri psyllid: psy8981


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MEIAPVFRSLLHVLDTLKARDSFDDWRLKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGKGMWLLLK
cccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEECcccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccccc
****PVFRSLLHVLDTLKARDSFDDWRLKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKT***********WPGKGMWL*L*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIAPVFRSLLHVLDTLKARDSFDDWRLKESLDLSDLVQRRLEYLQNPPDCRTARKLVCELNKGCGYGCQLHHVVYCFIVAYATRRTLILDSKEWSYSRGGWEEVFQPVSKTCTSPEGVSNSGWPGKGMWLLLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-(1,6)-fucosyltransferase Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.confidentQ659X0
Alpha-(1,6)-fucosyltransferase Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.confidentQ9VYV5
Alpha-(1,6)-fucosyltransferase Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.confidentQ9WTS2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046921 [MF]alpha-(1->6)-fucosyltransferase activityprobableGO:0008417, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758
GO:0036065 [BP]fucosylationprobableGO:0044238, GO:0005975, GO:0070085, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DE0, chain X
Confidence level:very confident
Coverage over the Query: 3-127
View the alignment between query and template
View the model in PyMOL