Diaphorina citri psyllid: psy8984


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MDTEEGVEVVWNEVQFSERKNFKAQEEKIQQVFENLTQLEHPNIVKFHRYWTDTHNDKPRARFLGEYEETPT
ccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEEEECccccccEEEEEEEEECccc
MDTEEGVEVVWNEVQFSERKNFKAQEEKIQQVFENLTQLEHPNIVKFHRYWTDTHNDKPRARFLGEYEETP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTEEGVEVVWNEVQFSERKNFKAQEEKIQQVFENLTQLEHPNIVKFHRYWTDTHNDKPRARFLGEYEETPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear receptor-binding protein May play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases.confidentQ99J45
Nuclear receptor-binding protein May play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases.confidentQ5RBH9
Nuclear receptor-binding protein May play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.confidentQ9UHY1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008361 [BP]regulation of cell sizeprobableGO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0065007, GO:0044763, GO:0032535, GO:0008150, GO:0065008, GO:0044699
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006367 [BP]transcription initiation from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006352, GO:0019438
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0007254 [BP]JNK cascadeprobableGO:0065007, GO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0051403, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0018991 [BP]ovipositionprobableGO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0031324 [BP]negative regulation of cellular metabolic processprobableGO:0009892, GO:0019222, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T4H, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL