Diaphorina citri psyllid: psy8988


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MNKSKAILECLFNGRLSGHGGSSTGTNGGHTKKTRRRVATLAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYISFMSELLHGTPNGSTSGSPIYQMSQREYIPYTALVPTYPAIN
cccccHHHHHcccccccccccccccccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc
*********CLFN************************************RERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYISFMSELLHG***********YQ***REYIPYTALVPTY****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKSKAILECLFNGRLSGHGGSSTGTNGGHTKKTRRRVATLAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYISFMSELLHGTPNGSTSGSPIYQMSQREYIPYTALVPTYPAIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fer3-like protein Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins.confidentQ923Z4
Fer3-like protein Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins.confidentQ96RJ6
Protein Fer3 Transcription factor that binds to the E-box and functions as inhibitor of transcription. DNA binding requires dimerization with an E protein. Inhibits transcription activation by ASCL1/MASH1 by sequestering E proteins.confidentQ9VGJ5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0048384 [BP]retinoic acid receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0070888 [MF]E-box bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0031017 [BP]exocrine pancreas developmentprobableGO:0032502, GO:0055123, GO:0048856, GO:0044707, GO:0048513, GO:0032501, GO:0031016, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030902 [BP]hindbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0048663 [BP]neuron fate commitmentprobableGO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QL2, chain B
Confidence level:very confident
Coverage over the Query: 43-100
View the alignment between query and template
View the model in PyMOL