Diaphorina citri psyllid: psy9026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MKNSQNLNVLVESPNCKPTSSVLNIRTQRKVSKVGVMLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNCPVTYIKTS
cccCEEEEEEccccEEEEEEEEEEEEEECccccEEEEEEECccccccEEEEEEEEcccccCEEEccccccccccEEEEECc
******L**LVESPNCKPTSSVLNIRTQRKVSKVGVMLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNCPVTYIKT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNSQNLNVLVESPNCKPTSSVLNIRTQRKVSKVGVMLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNCPVTYIKTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inositol-3-phosphate synthase 1 Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.confidentQ6AYK3
Inositol-3-phosphate synthase 1 Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.confidentQ2NL29
Inositol-3-phosphate synthase confidentO97477

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030446 [CC]hyphal cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P1J, chain A
Confidence level:very confident
Coverage over the Query: 14-81
View the alignment between query and template
View the model in PyMOL