Diaphorina citri psyllid: psy9027

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNWYGSITQSSTVRLGMDSSGKDVYVPMNSLLPMVDPDDIVLDGWDISSVNLADAMERSKVLDFNLQIQLRPYMEHMKPRPSIYFPEFIAANQAGRADNVLSGTKQEVLDQVRRDIRDFKQKNSLDQVIVLWTANTERFSDIVQGLNDTAENLLEGVAVNNICRGFYDQVIVLWTANTERFSDIVQGLNDTAENLLESIQKNAAEVSPSTIFAVASILEGNTFVPGAIDLAEKKKVFIAGDDFKSGQTKVKSVLVDFLVTAGIKPVSIVSYNHLGNNDGYNLSAPQQFRSKEISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISMHNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVPPETSI
ccccccccHHHHHHHHHHHHHcccccccccccccccccccEEEcccEEEccccccccccccccccccccccccEEEcccccccccHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccEEEccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHccccEEccccccccHHHHHHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccccccEEEEEEEEEEEccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccccccccccc
MLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNWYGSITQSSTVRLGMDSSGKDVYVPMNSLLPMVDPDDIVLDGWDISSVNLADAMERSKVLDFNLQIQLRPYMEHMKPRPSIYFPEFIAANQAGRADNVLSGTKQEVLDQVRRDIRDFKQKNSLDQVIVLWTANTERFSDIVQGLNDTAENLLEGVAVNNICRGFYDQVIVLWTANTERFSDIVQGLNDTAENLLESIQKNAAEVSPSTIFAVASILEGNTFVPGAIDLAEKKKVFIAGDDFKSGQTKVKSVLVDFLVTAGIKPVSIVSYNHLGNNDGYNLSAP*************VDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISMHNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIGWGGNNGSTVTGAILANKHNLCWQSKDGLKKPNWYGSITQSSTVRLGMDSSGKDVYVPMNSLLPMVDPDDIVLDGWDISSVNLADAMERSKVLDFNLQIQLRPYMEHMKPRPSIYFPEFIAANQAGRADNVLSGTKQEVLDQVRRDIRDFKQKNSLDQVIVLWTANTERFSDIVQGLNDTAENLLEGVAVNNICRGFYDQVIVLWTANTERFSDIVQGLNDTAENLLESIQKNAAEVSPSTIFAVASILEGNTFVPGAIDLAEKKKVFIAGDDFKSGQTKVKSVLVDFLVTAGIKPVSIVSYNHLGNNDGYNLSAPQQFRSKEISKSNVVDDMVASNSILYRPGEKPDHTVVIKYVPYVGDSKRALDEYTSEILLGGHNTISMHNTCEDSLLASPLILDLIILAELSSRIQFTSPTVAEYTYFHPVLSILSYLCKAPLVPPETSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inositol-3-phosphate synthase 1 Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.confidentQ6AYK3
Inositol-3-phosphate synthase 1 Key enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.confidentQ9JHU9
Inositol-3-phosphate synthase isozyme 2 confidentQ38862

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009793 [BP]embryo development ending in seed dormancyprobableGO:0032502, GO:0044767, GO:0032501, GO:0048316, GO:0010154, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0009791, GO:0003006, GO:0008150, GO:0048731, GO:0048608, GO:0009790, GO:0007275, GO:0044699, GO:0000003
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0050832 [BP]defense response to fungusprobableGO:0009607, GO:0009620, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0030446 [CC]hyphal cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0051607 [BP]defense response to virusprobableGO:0002376, GO:0009607, GO:0009615, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0002252, GO:0051707, GO:0051704
GO:0042742 [BP]defense response to bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0009644 [BP]response to high light intensityprobableGO:0009628, GO:0009314, GO:0050896, GO:0008150, GO:0009416, GO:0009642
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006659 [BP]phosphatidylserine biosynthetic processprobableGO:0044238, GO:0006650, GO:0042398, GO:0006658, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:0045017, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0006082, GO:0008610, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0046486, GO:0090407, GO:0052646, GO:0008652, GO:1901564, GO:0006575, GO:1901566, GO:0008654, GO:1901137, GO:1901135, GO:0016053, GO:0044237, GO:0046394, GO:0006796, GO:0006793, GO:0019637, GO:0046474
GO:0009733 [BP]response to auxin stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016036 [BP]cellular response to phosphate starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.5.-.-Intramolecular lyases.probable
5.5.1.-15-cis-phytoene desaturase.probable
5.5.1.4Inositol-3-phosphate synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VKO, chain A
Confidence level:very confident
Coverage over the Query: 1-175,218-448
View the alignment between query and template
View the model in PyMOL
Template: 1VJP, chain A
Confidence level:confident
Coverage over the Query: 135-299
View the alignment between query and template
View the model in PyMOL