BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy9036
(143 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme
From Clostridium Thermocellum
pdb|3GED|B Chain B, Fingerprint And Structural Analysis Of A Apo Scor Enzyme
From Clostridium Thermocellum
pdb|3GEG|A Chain A, Fingerprint And Structural Analysis Of A Scor Enzyme With
Its Bound Cofactor From Clostridium Thermocellum
pdb|3GEG|B Chain B, Fingerprint And Structural Analysis Of A Scor Enzyme With
Its Bound Cofactor From Clostridium Thermocellum
Length = 247
Score = 33.5 bits (75), Expect = 0.040, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 24/48 (50%)
Query: 1 DILSNRAIQRAPDGTSIADATGGAGSNTHGVKLGWIVGVLIPCLLNIW 48
+I S RA Q PD + A A GG + TH + + VL+ C+ W
Sbjct: 130 NIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGW 177
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.141 0.446
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,028,961
Number of Sequences: 62578
Number of extensions: 137282
Number of successful extensions: 189
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 187
Number of HSP's gapped (non-prelim): 2
length of query: 143
length of database: 14,973,337
effective HSP length: 89
effective length of query: 54
effective length of database: 9,403,895
effective search space: 507810330
effective search space used: 507810330
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)