Query         psy9050
Match_columns 73
No_of_seqs    162 out of 1136
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:41:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9050.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9050hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4220|consensus               99.3 1.7E-12 3.8E-17   83.7   2.7   57    1-59    435-491 (503)
  2 PHA03234 DNA packaging protein  99.1 1.8E-10 3.9E-15   72.9   5.5   39   18-56    279-317 (338)
  3 PHA02834 chemokine receptor-li  98.8   5E-09 1.1E-13   65.8   4.5   36   20-55    274-309 (323)
  4 KOG4219|consensus               98.8   9E-09 1.9E-13   66.5   3.9   37   20-56    300-336 (423)
  5 PHA03235 DNA packaging protein  98.8 2.1E-08 4.5E-13   65.1   5.5   38   18-55    286-323 (409)
  6 PHA02638 CC chemokine receptor  98.8 2.4E-08 5.2E-13   64.9   5.7   39   19-57    361-399 (417)
  7 PHA03087 G protein-coupled che  98.7 6.3E-08 1.4E-12   60.7   5.3   39   19-57    287-325 (335)
  8 KOG2087|consensus               98.0 3.1E-06 6.6E-11   54.3   1.9   30   27-56    278-307 (363)
  9 PF10324 7TM_GPCR_Srw:  Serpent  97.5 0.00025 5.5E-09   44.3   4.9   39   18-56    280-318 (318)
 10 PF00001 7tm_1:  7 transmembran  96.7  0.0025 5.4E-08   37.4   3.3   24   15-38    234-257 (257)
 11 PF10320 7TM_GPCR_Srsx:  Serpen  95.7  0.0087 1.9E-07   36.8   2.2   35   19-53    223-257 (257)
 12 PF10321 7TM_GPCR_Srt:  Serpent  95.1   0.019 4.1E-07   36.6   2.2   42   15-56    267-308 (313)
 13 PF10323 7TM_GPCR_Srv:  Serpent  90.6    0.44 9.4E-06   29.8   3.4   34   22-55    250-283 (283)
 14 KOG4564|consensus               84.2     2.4 5.2E-05   28.9   4.1   35   20-54    384-418 (473)
 15 PF05296 TAS2R:  Mammalian tast  83.6     4.1 8.8E-05   25.8   4.8   37   19-55    265-301 (303)
 16 PF10317 7TM_GPCR_Srd:  Serpent  68.8     5.6 0.00012   24.9   2.4   32   20-51    261-292 (292)
 17 PF10328 7TM_GPCR_Srx:  Serpent  66.6     4.8 0.00011   24.8   1.8   25   29-53    249-273 (274)
 18 PF10318 7TM_GPCR_Srh:  Serpent  60.1      18 0.00039   22.5   3.5   38   18-55    265-302 (302)
 19 KOG4193|consensus               57.5      54  0.0012   23.4   5.6   32   25-56    548-582 (610)
 20 PF10326 7TM_GPCR_Str:  Serpent  38.9     8.3 0.00018   24.1  -0.4   28   23-50    280-307 (307)
 21 PF11970 Git3_C:  G protein-cou  35.8      21 0.00046   18.2   0.9   29   17-45     46-74  (76)
 22 PF02295 z-alpha:  Adenosine de  35.3      15 0.00032   18.2   0.3   13   31-43     35-47  (66)
 23 PF04628 Sedlin_N:  Sedlin, N-t  33.8      35 0.00077   18.9   1.7   27   27-53    101-130 (132)
 24 PF10842 DUF2642:  Protein of u  22.1      41 0.00089   16.8   0.5   15   29-43      4-18  (66)
 25 PF07746 LigA:  Aromatic-ring-o  21.9 1.3E+02  0.0029   15.7   2.4   19   33-51      1-19  (88)
 26 PF02101 Ocular_alb:  Ocular al  21.0 1.7E+02  0.0037   20.0   3.2   21   31-51    206-226 (405)

No 1  
>KOG4220|consensus
Probab=99.29  E-value=1.7e-12  Score=83.74  Aligned_cols=57  Identities=39%  Similarity=0.734  Sum_probs=50.9

Q ss_pred             CeeeeccccCCCCCCcHHHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhcccCc
Q psy9050           1 MGYLISTLCGPPCDCPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVFPW   59 (73)
Q Consensus         1 v~~~~~~~~~~~c~~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~~~~   59 (73)
                      |+.++..|| ++| +|.+++.+..||.|+||.+||++|++-|+.||+.+++++.|+...
T Consensus       435 ImVlv~tFC-~~C-iP~tlW~~gYwLCYINSTiNP~CYALCNatFrkTfk~lL~Cr~~~  491 (503)
T KOG4220|consen  435 IMVLVNTFC-KNC-IPETLWTFGYWLCYINSTINPLCYALCNATFRKTFKRLLLCRWKK  491 (503)
T ss_pred             eeeehHhhc-ccc-cchhHhhhhhheeeecccccHHHHHHHhHHHHHHHHHhheeeecc
Confidence            456677899 577 699999999999999999999999999999999999999887653


No 2  
>PHA03234 DNA packaging protein UL33; Provisional
Probab=99.11  E-value=1.8e-10  Score=72.94  Aligned_cols=39  Identities=26%  Similarity=0.411  Sum_probs=34.3

Q ss_pred             HHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          18 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        18 ~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      ..+.++.+++++|||+||+||++.+++||+++++.++..
T Consensus       279 ~~~~v~~~La~~nsclNPiIY~f~~~~FR~~~~~~~~~~  317 (338)
T PHA03234        279 ILQIIIRLMPEIHCFSNPLVYAFTGGDFRLRFTACFQDF  317 (338)
T ss_pred             HHHHHHHHHHHhhhhhhHHHHHHhhHHHHHHHHHHHHHH
Confidence            446788899999999999999999999999999877543


No 3  
>PHA02834 chemokine receptor-like protein; Provisional
Probab=98.84  E-value=5e-09  Score=65.77  Aligned_cols=36  Identities=28%  Similarity=0.692  Sum_probs=32.5

Q ss_pred             HHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhc
Q psy9050          20 VTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF   55 (73)
Q Consensus        20 ~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~   55 (73)
                      ..++.+++++|||+||+||++.+++||+++++++++
T Consensus       274 ~~i~~~l~~~ns~iNPiIY~~~~~~fR~~~~~~~~~  309 (323)
T PHA02834        274 IDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFCR  309 (323)
T ss_pred             HHHHHHHHHhhccccHHHHHHhcHHHHHHHHHHHHh
Confidence            457788999999999999999999999999998854


No 4  
>KOG4219|consensus
Probab=98.77  E-value=9e-09  Score=66.45  Aligned_cols=37  Identities=22%  Similarity=0.786  Sum_probs=34.0

Q ss_pred             HHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          20 VTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        20 ~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      +....||+..|+|+||+||++.|++||.++++.++++
T Consensus       300 yl~~~WLaMSst~yNPiIY~~lN~Rfr~gf~~~fr~c  336 (423)
T KOG4219|consen  300 YLAIYWLAMSSTCYNPIIYCFLNKRFRGGFRRAFRWC  336 (423)
T ss_pred             HHHHHHHHHHHhhhccHhhhhhHHHHHHHHhhhhhee
Confidence            5567799999999999999999999999999999875


No 5  
>PHA03235 DNA packaging protein UL33; Provisional
Probab=98.76  E-value=2.1e-08  Score=65.11  Aligned_cols=38  Identities=24%  Similarity=0.527  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhc
Q psy9050          18 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF   55 (73)
Q Consensus        18 ~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~   55 (73)
                      .+..++.+++++|||+||+||++.+++||+++++.++.
T Consensus       286 ~~~~i~~~La~~ns~lNPiIY~~~~~~FRk~~~~~l~~  323 (409)
T PHA03235        286 AVSTLSRLVPNLHCLLNPILYAFLGNDFLKRFRQCFRG  323 (409)
T ss_pred             HHHHHHHHHHHHHHhHhHHHHHHhhHHHHHHHHHHHhh
Confidence            45567888999999999999999999999999987754


No 6  
>PHA02638 CC chemokine receptor-like protein; Provisional
Probab=98.76  E-value=2.4e-08  Score=64.92  Aligned_cols=39  Identities=21%  Similarity=0.392  Sum_probs=34.1

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhccc
Q psy9050          19 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVF   57 (73)
Q Consensus        19 ~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~~   57 (73)
                      ...++..++++|||+||++|++.+++||+++++.+++..
T Consensus       361 ~~~vt~~la~~~sclNPiIY~f~~~~FR~~l~~~~~~~~  399 (417)
T PHA02638        361 AMMLAEAISLTHCCINPLIYTLIGENFRMHLLMIFRNIF  399 (417)
T ss_pred             HHHHHHHHHHHHHhhhHHHHHHhCHHHHHHHHHHHHHhc
Confidence            456778899999999999999999999999999886443


No 7  
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional
Probab=98.66  E-value=6.3e-08  Score=60.66  Aligned_cols=39  Identities=26%  Similarity=0.490  Sum_probs=33.6

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhccc
Q psy9050          19 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFVF   57 (73)
Q Consensus        19 ~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~~   57 (73)
                      ...++.+++.+|+++||+||++++++||+++++.++...
T Consensus       287 ~~~i~~~l~~~ns~~NPiIY~~~~~~fr~~~~~~~~~~~  325 (335)
T PHA03087        287 ALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKSLKLMF  325 (335)
T ss_pred             HHHHHHHHHHHHHhhhhhHHHHcCHHHHHHHHHHHHHHh
Confidence            345777889999999999999999999999999886443


No 8  
>KOG2087|consensus
Probab=98.01  E-value=3.1e-06  Score=54.27  Aligned_cols=30  Identities=43%  Similarity=0.594  Sum_probs=25.9

Q ss_pred             HHHhhhhhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          27 GYFNSVLNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        27 ~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      --+|||+||++|++.++.||+.++.+....
T Consensus       278 lPlns~~NP~LYa~fT~~fk~d~~~l~~k~  307 (363)
T KOG2087|consen  278 LPLNSCLNPFLYAFFTPVFKEDLFLLLSKV  307 (363)
T ss_pred             EEcccccCchhHHHcCHHHHHHHHHHHhhc
Confidence            347999999999999999999999877543


No 9  
>PF10324 7TM_GPCR_Srw:  Serpentine type 7TM GPCR chemoreceptor Srw;  InterPro: IPR019427 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz []. 
Probab=97.52  E-value=0.00025  Score=44.32  Aligned_cols=39  Identities=13%  Similarity=0.261  Sum_probs=34.6

Q ss_pred             HHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          18 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        18 ~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      ....+...+..+|+..|++||.+++.+||++++++++++
T Consensus       280 ~~~~~~~~l~~~ns~~h~~ic~~mSsqYR~t~~~~f~~k  318 (318)
T PF10324_consen  280 QLSIIFNILITINSSIHFFICCFMSSQYRKTVKKLFGCK  318 (318)
T ss_pred             HHHHHHHHHHHHHhhhHHHhhhhhhHHHHHHHHHHhccC
Confidence            445677889999999999999999999999999999753


No 10 
>PF00001 7tm_1:  7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature;  InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The rhodopsin-like GPCRs themselves represent a widespread protein family that includes hormone, neurotransmitter and light receptors, all of which transduce extracellular signals through interaction with guanine nucleotide-binding (G) proteins. Although their activating ligands vary widely in structure and character, the amino acid sequences of the receptors are very similar and are believed to adopt a common structural framework comprising 7 transmembrane (TM) helices [, , ].; GO: 0007186 G-protein coupled receptor protein signaling pathway, 0016021 integral to membrane; PDB: 2KI9_A 3QAK_A 2YDV_A 3VGA_A 3PWH_A 3RFM_A 3EML_A 3VG9_A 3REY_A 3UZA_A ....
Probab=96.69  E-value=0.0025  Score=37.39  Aligned_cols=24  Identities=29%  Similarity=0.768  Sum_probs=21.6

Q ss_pred             CcHHHHHHHHHHHHHhhhhhHHHH
Q psy9050          15 CPEYIVTILFWIGYFNSVLNPLMY   38 (73)
Q Consensus        15 ~~~~~~~~~~~l~~~ns~~NPiiY   38 (73)
                      .......++.+++++||++||++|
T Consensus       234 ~~~~~~~~~~~l~~~~s~~nP~iY  257 (257)
T PF00001_consen  234 ISSILFYISYFLAFLNSCLNPIIY  257 (257)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHhhCcEEC
Confidence            467778899999999999999998


No 11 
>PF10320 7TM_GPCR_Srsx:  Serpentine type 7TM GPCR chemoreceptor Srsx;  InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class sx (Srsx), which is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=95.71  E-value=0.0087  Score=36.82  Aligned_cols=35  Identities=17%  Similarity=0.239  Sum_probs=30.2

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHh
Q psy9050          19 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTL   53 (73)
Q Consensus        19 ~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~   53 (73)
                      +.....+++.++.+.|-++|.++++|||+++++++
T Consensus       223 i~~~~~i~v~~~~s~~ffV~~~~S~EYR~af~~~~  257 (257)
T PF10320_consen  223 IQMYAGIFVNISYSQNFFVYYWRSSEYRKAFRELF  257 (257)
T ss_pred             HHHHHHHHHHHHHHHHheEEEEcCHHHHHHHHHhC
Confidence            44556678899999999999999999999999863


No 12 
>PF10321 7TM_GPCR_Srt:  Serpentine type 7TM GPCR chemoreceptor Srt;  InterPro: IPR019425  Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type []. Srt is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. 
Probab=95.06  E-value=0.019  Score=36.62  Aligned_cols=42  Identities=19%  Similarity=0.248  Sum_probs=35.6

Q ss_pred             CcHHHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          15 CPEYIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        15 ~~~~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      .+.++..++...--+++..+|+||-..|+..|++++++++.+
T Consensus       267 ~p~~~i~~~~~~Wql~~g~~~iIYl~lNrtIR~~~~k~~~~k  308 (313)
T PF10321_consen  267 PPPWLIIIGQISWQLSHGCPPIIYLTLNRTIRNSVLKMLGPK  308 (313)
T ss_pred             ccHHHHHHHHHHHhccCCccceEEEEECHHHHHHHHHHHccc
Confidence            356667777777788999999999999999999999998643


No 13 
>PF10323 7TM_GPCR_Srv:  Serpentine type 7TM GPCR chemoreceptor Srv;  InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class v (Srv) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=90.64  E-value=0.44  Score=29.82  Aligned_cols=34  Identities=26%  Similarity=0.427  Sum_probs=28.3

Q ss_pred             HHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhc
Q psy9050          22 ILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF   55 (73)
Q Consensus        22 ~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~   55 (73)
                      +.-.+..+.|.+||+.--+.|++.|+++++.++|
T Consensus       250 ~y~~~~~~~s~inP~~LLi~n~~lr~~~~~~~~~  283 (283)
T PF10323_consen  250 FYPILNGLLSFINPWMLLIFNKDLRKQVRRMLKC  283 (283)
T ss_pred             HHHHHHHHHHhhhhHHhhhccHHHHHHHHHHcCC
Confidence            3344566778999999999999999999998865


No 14 
>KOG4564|consensus
Probab=84.18  E-value=2.4  Score=28.89  Aligned_cols=35  Identities=14%  Similarity=0.507  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhh
Q psy9050          20 VTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLS   54 (73)
Q Consensus        20 ~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~   54 (73)
                      ..+...|..+.-.+=-++|+|.|++.|.++|+...
T Consensus       384 ~~~~~~L~SfQGf~VAvlYCFlN~EVq~elrr~W~  418 (473)
T KOG4564|consen  384 LYFELFLGSFQGFFVAVLYCFLNGEVQAELRRKWS  418 (473)
T ss_pred             HHHHHHHHhccchheehheeecCHHHHHHHHHHHH
Confidence            34555566666667789999999999999999654


No 15 
>PF05296 TAS2R:  Mammalian taste receptor protein (TAS2R);  InterPro: IPR007960 This family consists of several forms of mammalian taste receptor proteins (TAS2Rs). TAS2Rs are G protein-coupled receptors expressed in subsets of taste receptor cells of the tongue and palate epithelia and are organised in the genome in clusters. The proteins are genetically linked to loci that influence bitter perception in mice and humans [].; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway, 0050909 sensory perception of taste, 0016021 integral to membrane
Probab=83.58  E-value=4.1  Score=25.85  Aligned_cols=37  Identities=14%  Similarity=-0.009  Sum_probs=31.1

Q ss_pred             HHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhc
Q psy9050          19 IVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF   55 (73)
Q Consensus        19 ~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~   55 (73)
                      ...+......+.+...|++-.+.|++.|+++++.+.+
T Consensus       265 ~~~~~~~i~~~yps~hs~iLIlgn~KLr~~~~~il~~  301 (303)
T PF05296_consen  265 WFWVCEIIIALYPSGHSIILILGNPKLRQALLKILWC  301 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCchHHHHHHHHHHhh
Confidence            3455666778888999999999999999999998864


No 16 
>PF10317 7TM_GPCR_Srd:  Serpentine type 7TM GPCR chemoreceptor Srd;  InterPro: IPR019421 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents the chemoreceptor Srd []. 
Probab=68.78  E-value=5.6  Score=24.86  Aligned_cols=32  Identities=25%  Similarity=0.601  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHH
Q psy9050          20 VTILFWIGYFNSVLNPLMYAYFNRDFREAFKN   51 (73)
Q Consensus        20 ~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~   51 (73)
                      ......+..+.+.+||++.-..=+.||+.++|
T Consensus       261 e~~~~~~~~~~~~~~P~itl~fv~PYR~~i~r  292 (292)
T PF10317_consen  261 EYLIFMLASLPPLIDPLITLYFVRPYRKAILR  292 (292)
T ss_pred             HHHHHHHHHHHHHhchHhheeeeHhHHHHhcC
Confidence            44555567788899999999999999998764


No 17 
>PF10328 7TM_GPCR_Srx:  Serpentine type 7TM GPCR chemoreceptor Srx;  InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class x (Srx) from the Srg superfamily [, ]. Srg receptors contain seven hydrophobic, putative transmembrane, regions and can be distinguished from other 7TM GPCR receptors by their own characteristic TM signatures. 
Probab=66.63  E-value=4.8  Score=24.78  Aligned_cols=25  Identities=20%  Similarity=0.404  Sum_probs=20.8

Q ss_pred             HhhhhhHHHHHhhcHHHHHHHHHHh
Q psy9050          29 FNSVLNPLMYAYFNRDFREAFKNTL   53 (73)
Q Consensus        29 ~ns~~NPiiY~~~~~~fr~~~~~~~   53 (73)
                      +.-++|++++...|+++|+..++..
T Consensus       249 ~~h~~DG~i~l~fN~~~r~~~~~~~  273 (274)
T PF10328_consen  249 LVHALDGLIMLIFNSEIRRKIRKKK  273 (274)
T ss_pred             HHHHhcceeEeEEcHHHHHHHHhcc
Confidence            3446899999999999999988753


No 18 
>PF10318 7TM_GPCR_Srh:  Serpentine type 7TM GPCR chemoreceptor Srh;  InterPro: IPR019422 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  Srh is part of the Str superfamily of chemoreceptors []. 
Probab=60.12  E-value=18  Score=22.52  Aligned_cols=38  Identities=11%  Similarity=0.230  Sum_probs=31.1

Q ss_pred             HHHHHHHHHHHHhhhhhHHHHHhhcHHHHHHHHHHhhc
Q psy9050          18 YIVTILFWIGYFNSVLNPLMYAYFNRDFREAFKNTLSF   55 (73)
Q Consensus        18 ~~~~~~~~l~~~ns~~NPiiY~~~~~~fr~~~~~~~~~   55 (73)
                      ....++..+...+..+.-+..-+.++.+|+.++++++|
T Consensus       265 ~~~n~~~~~~~~HG~~sti~mi~~~~pYR~~~~~~~~~  302 (302)
T PF10318_consen  265 ALNNISFIIISLHGIASTIVMILVHKPYRKFLLSLFRC  302 (302)
T ss_pred             ccchHHHHHHHhccHHHHHHHhhccHHHHHHHHHHhcC
Confidence            34456666777888888999999999999999998864


No 19 
>KOG4193|consensus
Probab=57.51  E-value=54  Score=23.35  Aligned_cols=32  Identities=13%  Similarity=0.282  Sum_probs=22.9

Q ss_pred             HHHHHhhh---hhHHHHHhhcHHHHHHHHHHhhcc
Q psy9050          25 WIGYFNSV---LNPLMYAYFNRDFREAFKNTLSFV   56 (73)
Q Consensus        25 ~l~~~ns~---~NPiiY~~~~~~fr~~~~~~~~~~   56 (73)
                      ++..+|+.   .=-+.|++++++.|++.++.+++.
T Consensus       548 lFti~NalQG~fIFi~~cll~~kvr~~~~k~~~~~  582 (610)
T KOG4193|consen  548 LFTIFNALQGVFIFIFHCLLRKKVRKEYRKWLCCG  582 (610)
T ss_pred             HHHHHHHhhhhHhhHhhhhhhHHHHHHHHHHhccc
Confidence            34444443   335688999999999999988743


No 20 
>PF10326 7TM_GPCR_Str:  Serpentine type 7TM GPCR chemoreceptor Str;  InterPro: IPR019428 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae. This entry represents serpentine receptor class r (Str) from the Str superfamily [, ]. Almost a quarter (22.5%) of str and srj family genes and pseudogenes in C. elegans appear to have been newly formed by gene duplications since the species split []. 
Probab=38.94  E-value=8.3  Score=24.06  Aligned_cols=28  Identities=21%  Similarity=0.433  Sum_probs=21.8

Q ss_pred             HHHHHHHhhhhhHHHHHhhcHHHHHHHH
Q psy9050          23 LFWIGYFNSVLNPLMYAYFNRDFREAFK   50 (73)
Q Consensus        23 ~~~l~~~ns~~NPiiY~~~~~~fr~~~~   50 (73)
                      ...+..+-+++||++--+.-++||++++
T Consensus       280 ~~~~~~~yP~iDpl~~i~~ik~yR~~i~  307 (307)
T PF10326_consen  280 ISILISLYPAIDPLPVIFIIKDYRKAIK  307 (307)
T ss_pred             hhhhEEEEeehhhheeeEeeHHHHHhhC
Confidence            3334556678999999999999999864


No 21 
>PF11970 Git3_C:  G protein-coupled glucose receptor regulating Gpa2 C-term;  InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This family is the conserved C-terminal domain of the member proteins. 
Probab=35.76  E-value=21  Score=18.17  Aligned_cols=29  Identities=10%  Similarity=0.210  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHhhhhhHHHHHhhcHHH
Q psy9050          17 EYIVTILFWIGYFNSVLNPLMYAYFNRDF   45 (73)
Q Consensus        17 ~~~~~~~~~l~~~ns~~NPiiY~~~~~~f   45 (73)
                      .+...++..+..+|..+|-++|+++.+..
T Consensus        46 ~~l~~i~~~~~~~~G~VD~lvf~~~erpw   74 (76)
T PF11970_consen   46 FWLFCIAGFMQPSQGFVDCLVFTLRERPW   74 (76)
T ss_pred             hHHHHHHHHHHHccCHHHhhheeeecccC
Confidence            45566777777788888988888876543


No 22 
>PF02295 z-alpha:  Adenosine deaminase z-alpha domain;  InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3.5 from EC) converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. DRADA has been found to modify adenosines in AU-rich regions more frequently, probably due to the relative ease of melting A/U base pairs compared to G/C base pairs. The protein functions to modify viral RNA genomes, and may be responsible for hypermutation of certain negative-stranded viruses. DRADA edits the mRNAs for the glutamate receptor subunits by site-selective adenosine deamination. The DRADA repeat is also found in viral E3 proteins, which contain a double-stranded RNA-binding domain.; GO: 0003723 RNA binding, 0003726 double-stranded RNA adenosine deaminase activity; PDB: 1OYI_A 3EYI_A 2L4M_A 2HEO_D 1J75_A 1SFU_B 3IRR_B 2ACJ_C 3F22_B 2L54_A ....
Probab=35.32  E-value=15  Score=18.16  Aligned_cols=13  Identities=15%  Similarity=0.337  Sum_probs=10.2

Q ss_pred             hhhhHHHHHhhcH
Q psy9050          31 SVLNPLMYAYFNR   43 (73)
Q Consensus        31 s~~NPiiY~~~~~   43 (73)
                      .-+|+++|.+..+
T Consensus        35 k~VN~~LY~L~k~   47 (66)
T PF02295_consen   35 KEVNRVLYRLEKQ   47 (66)
T ss_dssp             HHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHC
Confidence            5689999987654


No 23 
>PF04628 Sedlin_N:  Sedlin, N-terminal conserved region;  InterPro: IPR006722  Sedlin is a 140 amino-acid protein with a putative role in endoplasmic reticulum-to-Golgi transport. Several missense mutations and deletion mutations in the SEDL gene, which result in protein truncation by frame shift, are responsible for spondyloepiphyseal dysplasia tarda, a progressive skeletal disorder (OMIM:313400). [].; GO: 0006888 ER to Golgi vesicle-mediated transport, 0005622 intracellular; PDB: 3PR6_A 2J3W_A 1H3Q_A.
Probab=33.76  E-value=35  Score=18.91  Aligned_cols=27  Identities=15%  Similarity=0.250  Sum_probs=19.1

Q ss_pred             HHHhhhhhHHH---HHhhcHHHHHHHHHHh
Q psy9050          27 GYFNSVLNPLM---YAYFNRDFREAFKNTL   53 (73)
Q Consensus        27 ~~~ns~~NPii---Y~~~~~~fr~~~~~~~   53 (73)
                      .|+....||+.   =-+.++.|.+.++++.
T Consensus       101 ~Y~~~~~NPF~~~~~~I~S~~Fd~~v~~l~  130 (132)
T PF04628_consen  101 LYVKALCNPFYQPGTPIKSPKFDSRVRALA  130 (132)
T ss_dssp             HHHHHHTSTTCGCT-HHHHHHHHHHHHHHH
T ss_pred             HHHHHccCCCCCCCCCcCCHHHHHHHHHHh
Confidence            56677788885   3566778888887765


No 24 
>PF10842 DUF2642:  Protein of unknown function (DUF2642);  InterPro: IPR020139 This entry contains proteins with no known function.
Probab=22.06  E-value=41  Score=16.76  Aligned_cols=15  Identities=20%  Similarity=0.552  Sum_probs=10.4

Q ss_pred             HhhhhhHHHHHhhcH
Q psy9050          29 FNSVLNPLMYAYFNR   43 (73)
Q Consensus        29 ~ns~~NPiiY~~~~~   43 (73)
                      +.|.+||.+|-...+
T Consensus         4 ~vs~vdpyvyq~lq~   18 (66)
T PF10842_consen    4 MVSLVDPYVYQTLQS   18 (66)
T ss_pred             ceeccCHHHHHHHHH
Confidence            356789998865544


No 25 
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=21.93  E-value=1.3e+02  Score=15.73  Aligned_cols=19  Identities=26%  Similarity=0.415  Sum_probs=15.0

Q ss_pred             hhHHHHHhhcHHHHHHHHH
Q psy9050          33 LNPLMYAYFNRDFREAFKN   51 (73)
Q Consensus        33 ~NPiiY~~~~~~fr~~~~~   51 (73)
                      +|=+++.+..+..|..+++
T Consensus         1 lNkf~~~L~~~~~r~~F~~   19 (88)
T PF07746_consen    1 LNKFCWSLNDPENRERFLA   19 (88)
T ss_dssp             HHHHHHGGGSHHHHHHHHH
T ss_pred             ChHHHHHHcCHHHHHHHHH
Confidence            4677888888888888876


No 26 
>PF02101 Ocular_alb:  Ocular albinism type 1 protein;  InterPro: IPR001414 Ocular albinism type 1 (OA1) is an X-linked disorder characterised by severe impairment of visual acuity, retinal hypopigmentation and the presence of macromelanosomes. A novel transcript from the OA1 critical region is expressed in high levels in RNA samples from retina and from melanoma and encodes a potential integral membrane protein []. This protein is of unknown function but is known to bind heterotrimeric G proteins.; GO: 0016020 membrane
Probab=21.05  E-value=1.7e+02  Score=19.95  Aligned_cols=21  Identities=29%  Similarity=0.414  Sum_probs=15.1

Q ss_pred             hhhhHHHHHhhcHHHHHHHHH
Q psy9050          31 SVLNPLMYAYFNRDFREAFKN   51 (73)
Q Consensus        31 s~~NPiiY~~~~~~fr~~~~~   51 (73)
                      -..||++|.-..++....++.
T Consensus       206 lvaNPiLy~~a~~~V~~~lk~  226 (405)
T PF02101_consen  206 LVANPILYIKAVRAVASLLKG  226 (405)
T ss_pred             HHhccHHHHHHHHHHHHHHhh
Confidence            368999998776666555554


Done!