Query         psy9084
Match_columns 103
No_of_seqs    119 out of 444
Neff          5.9 
Searched_HMMs 46136
Date          Fri Aug 16 18:27:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9084.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9084hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3586|consensus              100.0 3.8E-41 8.1E-46  268.4   9.1   99    4-103    97-252 (437)
  2 cd00182 TBOX T-box DNA binding 100.0 9.6E-39 2.1E-43  235.5   9.5   97    4-103    19-167 (188)
  3 smart00425 TBOX Domain first f 100.0 8.6E-37 1.9E-41  225.3   9.7   97    4-103    18-168 (190)
  4 KOG3585|consensus              100.0 5.1E-33 1.1E-37  219.1   8.5   96    5-103    43-191 (328)
  5 PF00907 T-box:  T-box;  InterP 100.0 1.2E-32 2.6E-37  200.3   8.1   96    5-102    18-165 (184)
  6 PF04775 Bile_Hydr_Trans:  Acyl  83.5     1.8 3.8E-05   29.8   3.5   30   21-50      5-34  (126)
  7 PF00041 fn3:  Fibronectin type  71.9     8.5 0.00019   22.6   3.8   24   21-44     56-79  (85)
  8 cd00169 Chemokine Chemokine: s  65.4     2.9 6.2E-05   24.8   0.7   15    3-17     28-42  (59)
  9 cd00273 Chemokine_CXC Chemokin  64.8     2.6 5.6E-05   25.5   0.4   15    3-17     32-46  (64)
 10 PF09294 Interfer-bind:  Interf  63.3      12 0.00027   23.7   3.4   21   22-42     68-88  (106)
 11 smart00199 SCY Intercrine alph  62.2     3.1 6.7E-05   24.8   0.4   15    3-17     29-43  (59)
 12 cd00272 Chemokine_CC Chemokine  60.7       4 8.6E-05   24.1   0.7   15    3-17     26-40  (57)
 13 cd01119 Chemokine_CC_DCCL Chem  57.0     4.7  0.0001   24.3   0.6   15    3-17     30-44  (61)
 14 smart00060 FN3 Fibronectin typ  55.4      21 0.00046   19.4   3.2   23   20-42     56-78  (83)
 15 cd00063 FN3 Fibronectin type 3  45.8      33 0.00073   19.2   3.1   24   19-42     55-78  (93)
 16 cd00271 Chemokine_C Chemokine_  44.7      11 0.00023   23.8   0.8   16    2-17     32-47  (72)
 17 PF00048 IL8:  Small cytokines   44.3      10 0.00022   22.6   0.6   14    4-17     35-48  (64)
 18 cd00274 Chemokine_CX3C Chemoki  29.7      26 0.00056   22.5   0.8   15    3-17     35-49  (76)
 19 PF10179 DUF2369:  Uncharacteri  28.3      63  0.0014   25.8   2.9   29   22-50    261-289 (300)
 20 PF07569 Hira:  TUP1-like enhan  25.3      40 0.00086   25.1   1.2   27   13-39      1-29  (219)
 21 PF12503 CMV_1a_C:  Cucumber mo  23.4      69  0.0015   21.1   1.9   26    7-32     30-61  (85)
 22 PF15417 DUF4624:  Domain of un  22.5 1.1E+02  0.0024   21.4   2.9   41    3-43     71-111 (132)
 23 PF02257 RFX_DNA_binding:  RFX   21.9      50  0.0011   21.5   1.0   22   15-36     55-76  (85)

No 1  
>KOG3586|consensus
Probab=100.00  E-value=3.8e-41  Score=268.44  Aligned_cols=99  Identities=55%  Similarity=0.860  Sum_probs=89.8

Q ss_pred             CceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEccCCceeeeecc-----------------------------
Q psy9084           4 DEALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPVDDKRYRYAFHR-----------------------------   54 (103)
Q Consensus         4 ~~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry~~~~-----------------------------   54 (103)
                      .||||+| |+||||||+++|+++||||.+.|.|+||++|+|++||||.+|+                             
T Consensus        97 GTEMIIT-KsGRRMFPTvrV~~~GldP~a~Y~vlmDvVPvD~KRYRYayH~S~WlvAGkADp~~p~R~yvHPDSP~sGe~  175 (437)
T KOG3586|consen   97 GTEMIIT-KSGRRMFPTVRVKFSGLDPMADYYVLMDVVPVDSKRYRYAYHSSSWLVAGKADPAPPPRVYVHPDSPASGEQ  175 (437)
T ss_pred             CceEEEe-cccccccceEEEEEecCCcccceEEEEeEEecccceeeeeecccceeeecCCCCCCCCceeeCCCCCCCHHH
Confidence            4789875 8999999999999999999999999999999999999999986                             


Q ss_pred             ---ceeEeec----------------------CCeeEEEEcCCCCCCC---CCCCCeEEEEcCCceEEEcCCCCCCC
Q psy9084          55 ---QIGSLVS----------------------LPRFHVVLLSPESNSA---SATSPFKTFLFPETMFTAVTAYQNHR  103 (103)
Q Consensus        55 ---~~vsF~k----------------------qPrlhiv~~~~~~~~~---~~~~~~~tf~FpeT~FiAVTAYQN~~  103 (103)
                         |+|||||                      |||+|||+.++..+..   ...+.++||+||||+|+|||||||++
T Consensus       176 wmkqiVSFdK~KLTNNelD~nGHIILNSMHkYQPRvHvV~~~~~~~s~~~~~~~e~~kTF~FpET~FtAVTAYQNq~  252 (437)
T KOG3586|consen  176 WMKQIVSFDKLKLTNNELDDNGHIILNSMHKYQPRVHVVYLDPGNDSNKYVEKNEGFKTFVFPETVFTAVTAYQNQR  252 (437)
T ss_pred             HHHhhhchheeeccccccccCCcEeeecccccCCceEEEEecCCCCccccccccccceeEeccceeEEEEeecccce
Confidence               8999999                      9999999998754322   34578999999999999999999986


No 2  
>cd00182 TBOX T-box DNA binding domain of the T-box family of transcriptional regulators. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family.  Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.
Probab=100.00  E-value=9.6e-39  Score=235.49  Aligned_cols=97  Identities=43%  Similarity=0.644  Sum_probs=87.2

Q ss_pred             CceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEccCCceeeeecc-----------------------------
Q psy9084           4 DEALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPVDDKRYRYAFHR-----------------------------   54 (103)
Q Consensus         4 ~~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry~~~~-----------------------------   54 (103)
                      .+|||+| |+||||||.++++|+||||++.|.|+||++++|++||||.+++                             
T Consensus        19 ~tEMIIT-k~GRrmFP~l~~~vsGLdp~~~Y~v~l~~~~~D~~Rykf~~~~W~~~g~~e~~~~~~~~~HPdsp~tG~~wM   97 (188)
T cd00182          19 GTEMIIT-KSGRRMFPTLKVKVSGLDPNALYSVLMDLVPVDDHRYKFSGGKWVVAGKAEPHLPPRVYVHPDSPATGAHWM   97 (188)
T ss_pred             CcEEEEe-cCCcccccceEEEEeCCCcccceEEEEEEEEcCCcEEEecCCcEeEcCCCCCCCCCceEECCCCCcCHHHHh
Confidence            5789988 6899999999999999999999999999999999999998754                             


Q ss_pred             -ceeEeec----------------------CCeeEEEEcCCCCCCCCCCCCeEEEEcCCceEEEcCCCCCCC
Q psy9084          55 -QIGSLVS----------------------LPRFHVVLLSPESNSASATSPFKTFLFPETMFTAVTAYQNHR  103 (103)
Q Consensus        55 -~~vsF~k----------------------qPrlhiv~~~~~~~~~~~~~~~~tf~FpeT~FiAVTAYQN~~  103 (103)
                       ++|||+|                      ||||||+++++....  .....++|+||||+|||||||||++
T Consensus        98 ~~~isF~kvKlTN~~~~~~~~i~L~SmhKY~Prl~I~~~~~~~~~--~~~~~~~f~F~eT~FiAVTaYqN~~  167 (188)
T cd00182          98 KQPVSFDKLKLTNNTLDNNGHIILNSMHKYQPRLHIVEVDDSSPF--SWRLVQTFSFPETEFIAVTAYQNQE  167 (188)
T ss_pred             hCccccchhhcccCCCCCCCEEEEeccceEEeEEEEEEcCCCccc--cccccEEEECCCeEEEEEEeecCHh
Confidence             6899998                      999999999765432  3567899999999999999999975


No 3  
>smart00425 TBOX Domain first found  in the mice T locus (Brachyury) protein.
Probab=100.00  E-value=8.6e-37  Score=225.30  Aligned_cols=97  Identities=46%  Similarity=0.731  Sum_probs=85.7

Q ss_pred             CceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEccCCceeeeecc-----------------------------
Q psy9084           4 DEALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPVDDKRYRYAFHR-----------------------------   54 (103)
Q Consensus         4 ~~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry~~~~-----------------------------   54 (103)
                      .+|||+|+ +||||||.++++|+||||++.|.|+|+++++|++||||.+++                             
T Consensus        18 ~tEMIVTk-~GRrmFP~l~~~vsGLdp~~~Y~v~l~~~~~d~~rykf~~~~W~~~g~~e~~~~~~~~~Hpdsp~tG~~wM   96 (190)
T smart00425       18 GTEMIVTK-SGRRMFPTLKYKVSGLDPNALYSVLMDLVPVDDKRYKFNNGKWVVAGKAEPHMPSRVYVHPDSPATGAHWM   96 (190)
T ss_pred             CcEEEEec-CCceeCCeeEEEEeCCCccCcEEEEEEEEEccCcEEEecCCcEEEcCCCCCCCCCceEECCCCccCHHHHh
Confidence            37898876 599999999999999999999999999999999999998764                             


Q ss_pred             -ceeEeec------------------------CCeeEEEEcCCCCCCCCCCCCeEEEEcCCceEEEcCCCCCCC
Q psy9084          55 -QIGSLVS------------------------LPRFHVVLLSPESNSASATSPFKTFLFPETMFTAVTAYQNHR  103 (103)
Q Consensus        55 -~~vsF~k------------------------qPrlhiv~~~~~~~~~~~~~~~~tf~FpeT~FiAVTAYQN~~  103 (103)
                       ++|+|+|                        ||||||+++++....  ....+++|+||||+|||||||||++
T Consensus        97 ~~~v~F~kvKlTN~~~~~~~~i~i~L~SmhkY~P~l~I~~~~~~~~~--~~~~~~~f~F~eT~FiaVTaYqN~~  168 (190)
T smart00425       97 KQPVSFDKVKLTNNQSDKNGHLQIILNSMHKYQPRLHIVEVDDISKE--ILSQFKTFVFPETQFIAVTAYQNQK  168 (190)
T ss_pred             hCcccccccceeccccccCCcEeeeeccCceEeeEEEEEEeCCcccc--cccceeEEECCceEEEEEeeecccc
Confidence             6788887                        899999999764433  3466789999999999999999985


No 4  
>KOG3585|consensus
Probab=99.98  E-value=5.1e-33  Score=219.09  Aligned_cols=96  Identities=36%  Similarity=0.647  Sum_probs=84.5

Q ss_pred             ceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEccCCceeeeecc------------------------------
Q psy9084           5 EALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPVDDKRYRYAFHR------------------------------   54 (103)
Q Consensus         5 ~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry~~~~------------------------------   54 (103)
                      +||| +||+||||||.++|+|+||||++.|+|+|+++++|++||||.+++                              
T Consensus        43 ~Emi-itK~GRrmFP~l~~~VsGLdp~s~Y~i~l~~~~~D~~rykf~ng~W~p~gk~e~~~~~~~~~Hpd~p~TG~~WM~  121 (328)
T KOG3585|consen   43 TEMI-VTKRGRRMFPALKFKVSGLDPNSLYSILLELVPIDDKRYKFNNGKWVPSGKAEPHVPSKVYVHPDGPATGAHWMS  121 (328)
T ss_pred             cEEE-EecCCceeccccceeeccCCcccceEEEEEEEEccCceeeecCCeeccCCCCCCCCCceEEEecCCccchHHHhc
Confidence            4554 569999999999999999999999999999999999999999864                              


Q ss_pred             ceeEeec-----------------------CCeeEEEEcCCCCCCCCCCCCeEEEEcCCceEEEcCCCCCCC
Q psy9084          55 QIGSLVS-----------------------LPRFHVVLLSPESNSASATSPFKTFLFPETMFTAVTAYQNHR  103 (103)
Q Consensus        55 ~~vsF~k-----------------------qPrlhiv~~~~~~~~~~~~~~~~tf~FpeT~FiAVTAYQN~~  103 (103)
                      ++|+|+|                       ||||||+++++.  .......+++|.||||+|||||||||++
T Consensus       122 ~~V~F~kvKITN~~~~~~~~~i~l~SmHKY~P~l~i~~~~~~--~~~~~~~~~~~~F~eT~FIaVTaYQn~~  191 (328)
T KOG3585|consen  122 EPVSFDKVKITNNKSDKKGKVIILNSMHKYQPVLHIVELDAS--LISPEISVQSFKFPETQFIAVTAYQNQE  191 (328)
T ss_pred             CCcccceeEeeccccccCCceEeeecccceeeeEEEEEcccc--cCCCccceeEEEcccceeEEeeeeecce
Confidence            6789988                       899999999722  1235688999999999999999999974


No 5  
>PF00907 T-box:  T-box;  InterPro: IPR001699 Transcription factors of the T-box family are required both for early cell-fate decisions, such as those necessary for formation of the basic vertebrate body plan, and for differentiation and organogenesis []. The T-box is defined as the minimal region within the T-box protein that is both necessary and sufficient for sequence-specific DNA binding, all members of the family so far examined bind to the DNA consensus sequence TCACACCT. The T-box is a relatively large DNA-binding domain, generally comprising about a third of the entire protein (17-26 kDa). These genes were uncovered on the basis of similarity to the DNA binding domain [] of Mus musculus (Mouse) Brachyury (T) gene product, which similarity is the defining feature of the family. The Brachyury gene is named for its phenotype, which was identified 70 years ago as a mutant mouse strain with a short blunted tail. The gene, and its paralogues, have become a well-studied model for the family, and hence much of what is known about the T-box family is derived from the murine Brachyury gene. Consistent with its nuclear location, Brachyury protein has a sequence-specific DNA-binding activity and can act as a transcriptional regulator []. Homozygous mutants for the gene undergo extensive developmental anomalies, thus rendering the mutation lethal []. The postulated role of Brachyury is as a transcription factor, regulating the specification and differentiation of posterior mesoderm during gastrulation in a dose-dependent manner []. T-box proteins tend to be expressed in specific organs or cell types, especially during development, and they are generally required for the development of those tissues, for example, Brachyury is expressed in posterior mesoderm and in the developing notochord, and it is required for the formation of these cells in mice []. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1H6F_B 4A04_A 1XBR_B 2X6V_B 2X6U_A.
Probab=99.98  E-value=1.2e-32  Score=200.33  Aligned_cols=96  Identities=35%  Similarity=0.593  Sum_probs=75.2

Q ss_pred             ceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEccCCceeeeecc------------------------------
Q psy9084           5 EALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPVDDKRYRYAFHR------------------------------   54 (103)
Q Consensus         5 ~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry~~~~------------------------------   54 (103)
                      .|||+ |++||+|||.|+|+|+||+|++.|.|.|+++++|+++|||.+++                              
T Consensus        18 ~EMiv-t~~GR~~FP~l~y~vsGL~p~~~Y~i~l~~~~~d~~~~k~~~~~W~~~~~~~~~~~~~~~~h~~~~~~G~~WM~   96 (184)
T PF00907_consen   18 NEMIV-TKNGRRMFPTLEYSVSGLDPDSLYSISLHFERVDNKRYKFSNGKWVPSGKAEPPMPPRVVIHPDGPQTGSEWMK   96 (184)
T ss_dssp             -EEE--BTT-EE-SS-EEEEEESS-TTSEEEEEEEEEESCSEEEEEETTEEEEEEE---B-----EE-TT-SEEHHHHHH
T ss_pred             CEEEE-eecccccccccEEEecCCCCCcceEEEEEEEEecCceeecccccccccccccccccceEEEEecCcCCHHHhCc
Confidence            57777 58999999999999999999999999999999999999998753                              


Q ss_pred             ceeEeec----------------------CCeeEEEEcCCCCCCCCCCCCeEEEEcCCceEEEcCCCCCC
Q psy9084          55 QIGSLVS----------------------LPRFHVVLLSPESNSASATSPFKTFLFPETMFTAVTAYQNH  102 (103)
Q Consensus        55 ~~vsF~k----------------------qPrlhiv~~~~~~~~~~~~~~~~tf~FpeT~FiAVTAYQN~  102 (103)
                      ++|+|++                      +|+|||+++++..... ......+|+||||+|||||||||+
T Consensus        97 ~~v~F~~vkitn~~~~~~~~I~L~s~hkY~Pvl~I~~~~~~~~~~-~~~~~~~f~f~~t~FIaVT~Yqn~  165 (184)
T PF00907_consen   97 NGVSFDKVKITNNKEDKKGNIFLNSMHKYQPVLHIYEVNSNGSPS-PNQPVHEFSFPETEFIAVTAYQNE  165 (184)
T ss_dssp             S-EEETT-EEESSTT-TST-EE--TTEEEEEEEEEEECTTTSCCC-SCSSEEEEE-GGG-EEEESS-SSH
T ss_pred             ccEEeehhhhhCCCCCcccceEEccccEEEEEEEEEEcCCccccc-cccceEEeecCcCeEEeecccchh
Confidence            5788887                      8999999997654321 246799999999999999999996


No 6  
>PF04775 Bile_Hydr_Trans:  Acyl-CoA thioester hydrolase/BAAT N-terminal region;  InterPro: IPR006862 This entry presents the N-termini of acyl-CoA thioester hydrolase and bile acid-CoA:amino acid N-acetyltransferase (BAAT) []. This region is not thought to contain the active site of either enzyme. Thioesterase isoforms have been identified in peroxisomes, cytoplasm and mitochondria, where they are thought to have distinct functions in lipid metabolism []. For example, in peroxisomes, the hydrolase acts on bile-CoA esters [].; GO: 0016290 palmitoyl-CoA hydrolase activity, 0006629 lipid metabolic process; PDB: 3HLK_B 3K2I_B.
Probab=83.47  E-value=1.8  Score=29.81  Aligned_cols=30  Identities=17%  Similarity=0.295  Sum_probs=20.0

Q ss_pred             ceEEEeCCCCCCCeeEEEEEEEccCCceee
Q psy9084          21 FQVRLFNLDPDAEYMLMMDFVPVDDKRYRY   50 (103)
Q Consensus        21 l~~~vsGL~p~~~Y~v~v~~~~~d~~ryry   50 (103)
                      ++++|+||.|.+.+.|.+.+.--....|+-
T Consensus         5 ~~I~v~GL~p~~~vtl~a~~~~~~g~~w~S   34 (126)
T PF04775_consen    5 VDIRVSGLPPGQEVTLRARLTDDNGVQWQS   34 (126)
T ss_dssp             -EEEEES--TT-EEEEEEEEE-TTS-EEEE
T ss_pred             eEEEEeCCCCCCEEEEEEEEEeCCCCEEEE
Confidence            689999999999999999998655556654


No 7  
>PF00041 fn3:  Fibronectin type III domain;  InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes []. They contain multiple copies of 3 repeat regions (types I, II and III), which bind to a variety of substances including heparin, collagen, DNA, actin, fibrin and fibronectin receptors on cell surfaces. The wide variety of these substances means that fibronectins are involved in a number of important functions: e.g., wound healing; cell adhesion; blood coagulation; cell differentiation and migration; maintenance of the cellular cytoskeleton; and tumour metastasis []. The role of fibronectin in cell differentiation is demonstrated by the marked reduction in the expression of its gene when neoplastic transformation occurs. Cell attachment has been found to be mediated by the binding of the tetrapeptide RGDS to integrins on the cell surface [], although related sequences can also display cell adhesion activity. Plasma fibronectin occurs as a dimer of 2 different subunits, linked together by 2 disulphide bonds near the C terminus. The difference in the 2 chains occurs in the type III repeat region and is caused by alternative splicing of the mRNA from one gene []. The observation that, in a given protein, an individual repeat of one of the 3 types (e.g., the first FnIII repeat) shows much less similarity to its subsequent tandem repeats within that protein than to its equivalent repeat between fibronectins from other species, has suggested that the repeating structure of fibronectin arose at an early stage of evolution. It also seems to suggest that the structure is subject to high selective pressure []. The fibronectin type III repeat region is an approximately 100 amino acid domain, different tandem repeats of which contain binding sites for DNA, heparin and the cell surface []. The superfamily of sequences believed to contain FnIII repeats represents 45 different families, the majority of which are involved in cell surface binding in some manner, or are receptor protein tyrosine kinases, or cytokine receptors.; GO: 0005515 protein binding; PDB: 1UEM_A 1TDQ_A 1X5I_A 2IC2_B 2IBG_C 2IBB_A 3R8Q_A 2FNB_A 1FNH_A 2EDB_A ....
Probab=71.91  E-value=8.5  Score=22.60  Aligned_cols=24  Identities=21%  Similarity=0.308  Sum_probs=20.3

Q ss_pred             ceEEEeCCCCCCCeeEEEEEEEcc
Q psy9084          21 FQVRLFNLDPDAEYMLMMDFVPVD   44 (103)
Q Consensus        21 l~~~vsGL~p~~~Y~v~v~~~~~d   44 (103)
                      ..+.+.||+|...|.+.|..+..+
T Consensus        56 ~~~~i~~L~p~t~Y~~~v~a~~~~   79 (85)
T PF00041_consen   56 TSYTITGLQPGTTYEFRVRAVNSD   79 (85)
T ss_dssp             SEEEEESCCTTSEEEEEEEEEETT
T ss_pred             eeeeeccCCCCCEEEEEEEEEeCC
Confidence            379999999999999999876543


No 8  
>cd00169 Chemokine Chemokine: small cytokines, including a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; distinguished from other cytokines by their receptors, which are G-protein coupled receptors; divided into 4 subfamilies based on the arrangement of the two N-terminal cysteines; some members can bind multiple receptors and many chemokine receptors can bind more than one chemokine; this redundancy allows precise control in stimulating the immune system and in contributing to the homeostasis of a cell; when expressed inappropriately, chemokines play a role in autoimmune diseases, vascular irregularities, graft rejection, neoplasia, and allergies; exist as monomers, dimers and multimers, but are believed to function as monomers; found only in vertebrates and a few viruses.  See CDs: Chemokine_CXC (cd00273), Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for chemokine subgroups.
Probab=65.43  E-value=2.9  Score=24.83  Aligned_cols=15  Identities=13%  Similarity=-0.121  Sum_probs=13.0

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      +..|+|.+|++||++
T Consensus        28 ~~~aIIf~tk~g~~i   42 (59)
T cd00169          28 SIPAVIFTTKKGRKV   42 (59)
T ss_pred             CCceEEEEEcCCCEE
Confidence            578999999999874


No 9  
>cd00273 Chemokine_CXC Chemokine_CXC:  1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses.  See CDs:  Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.
Probab=64.83  E-value=2.6  Score=25.53  Aligned_cols=15  Identities=13%  Similarity=0.207  Sum_probs=12.9

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      |..|+|.+||+||++
T Consensus        32 ~~~~VI~~tk~g~~i   46 (64)
T cd00273          32 PNTEIIATLKNGRKV   46 (64)
T ss_pred             CCceEEEEEecCCEE
Confidence            578999999999874


No 10 
>PF09294 Interfer-bind:  Interferon-alpha/beta receptor, fibronectin type III;  InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology. They are required for binding to interferon-alpha []. ; PDB: 1A21_A 3LQM_B 3ELA_T 1AHW_C 2A2Q_T 1TFH_B 1FAK_T 1WSS_T 1W2K_T 2FIR_T ....
Probab=63.32  E-value=12  Score=23.70  Aligned_cols=21  Identities=24%  Similarity=0.453  Sum_probs=16.5

Q ss_pred             eEEEeCCCCCCCeeEEEEEEE
Q psy9084          22 QVRLFNLDPDAEYMLMMDFVP   42 (103)
Q Consensus        22 ~~~vsGL~p~~~Y~v~v~~~~   42 (103)
                      .+.+.+|+|+..|++.+....
T Consensus        68 ~~~l~~L~p~t~YCv~V~~~~   88 (106)
T PF09294_consen   68 SVTLSDLKPGTNYCVSVQAFS   88 (106)
T ss_dssp             EEEEES--TTSEEEEEEEEEE
T ss_pred             EEEEeCCCCCCCEEEEEEEEe
Confidence            468999999999999999944


No 11 
>smart00199 SCY Intercrine alpha family (small cytokine C-X-C) (chemokine CXC). Family of cytokines involved in cell-specific chemotaxis,  mediation of cell growth, and the inflammatory response.
Probab=62.17  E-value=3.1  Score=24.78  Aligned_cols=15  Identities=20%  Similarity=0.133  Sum_probs=12.5

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      +..|+|.+|++||++
T Consensus        29 ~~~avIf~tk~g~~~   43 (59)
T smart00199       29 PKPAVIFTTKKGRKV   43 (59)
T ss_pred             CCccEEEEEeCCCEE
Confidence            567999999999853


No 12 
>cd00272 Chemokine_CC Chemokine_CC:  1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs:  Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_C
Probab=60.73  E-value=4  Score=24.14  Aligned_cols=15  Identities=13%  Similarity=-0.084  Sum_probs=12.7

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      +..|+|.+|++||++
T Consensus        26 ~~~aVIf~tk~g~~i   40 (57)
T cd00272          26 SKPAVIFKTKRGREV   40 (57)
T ss_pred             CCcEEEEEeCCCCEE
Confidence            467999999999874


No 13 
>cd01119 Chemokine_CC_DCCL Chemokine_CC_DCCL:  subgroup of the Chemokine_CC subgroup based on the presence of a DCCL motif involving the two N-terminal cysteine residues; includes a number of small inducible cytokines capable of reversibly inhibiting normal hematopoietic progenitor proliferation by blocking progression through the cell cycle; DCCL subgroup contains Exodus-1 (also known as CCL20, MIP-3alpha, LARC, ST38 (mouse)), Exodus-2 (also known as CCL21, SLC, 6-Ckine, TCA4, CKbeta9), and Exodus-3 (also known as CCL-19, ELC, MIP-3beta, CKbeta11).  Exodus-3 was shown to inhibit the growth of human breast cancer cells in vivo in a mouse model; Exodus-1, -2, and -3 were all shown to significantly inhibit chronic myelogenous leukemia progenitor cell proliferation; Exodus-2 and -3 show potent immunotherapeutic activity toward solid tumors; chemotatic for T cells, B cells, dendritic cells, macrophage progenitor cells, and NK cells; exist as monomers and dimers, but are believed to be funct
Probab=57.02  E-value=4.7  Score=24.29  Aligned_cols=15  Identities=13%  Similarity=-0.028  Sum_probs=12.7

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      |..|+|.+|++||+.
T Consensus        30 ~~~aVIf~tk~g~~i   44 (61)
T cd01119          30 DIPAIIFHTRRGRKV   44 (61)
T ss_pred             CCCEEEEEEcCCCEE
Confidence            578999999999874


No 14 
>smart00060 FN3 Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition  sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
Probab=55.44  E-value=21  Score=19.39  Aligned_cols=23  Identities=26%  Similarity=0.355  Sum_probs=19.3

Q ss_pred             cceEEEeCCCCCCCeeEEEEEEE
Q psy9084          20 TFQVRLFNLDPDAEYMLMMDFVP   42 (103)
Q Consensus        20 ~l~~~vsGL~p~~~Y~v~v~~~~   42 (103)
                      ..++.+.||.|...|.+.|....
T Consensus        56 ~~~~~i~~L~~~~~Y~v~v~a~~   78 (83)
T smart00060       56 STSYTLTGLKPGTEYEFRVRAVN   78 (83)
T ss_pred             ccEEEEeCcCCCCEEEEEEEEEc
Confidence            46788999999999999887665


No 15 
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
Probab=45.78  E-value=33  Score=19.25  Aligned_cols=24  Identities=25%  Similarity=0.324  Sum_probs=19.1

Q ss_pred             ccceEEEeCCCCCCCeeEEEEEEE
Q psy9084          19 PTFQVRLFNLDPDAEYMLMMDFVP   42 (103)
Q Consensus        19 P~l~~~vsGL~p~~~Y~v~v~~~~   42 (103)
                      ...++.+.||.|...|.+.|....
T Consensus        55 ~~~~~~i~~l~p~~~Y~~~v~a~~   78 (93)
T cd00063          55 SETSYTLTGLKPGTEYEFRVRAVN   78 (93)
T ss_pred             cccEEEEccccCCCEEEEEEEEEC
Confidence            346788999999999998876554


No 16 
>cd00271 Chemokine_C Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on the arrangement of two N-terminal, conserved cysteine residues. Most of the known chemokines (cd00169) belong to either the CC (cd00272) or CXC (cd00273) subclass. The two other subclasses each have a single known member: fractalkine for the CX3C (cd00274) class and lymphotactin for the C (cd00271) class. Chemokine_Cs differ structurally since they contain only one of the two disulfide bridges that are conserved in all other chemokines and they possess a unique C-terminal extension, which is required for biological activity and thought to play a role in receptor binding. Lymphotactin, a mediator of mucosal immunity, has been found to chemoattract neutrophils and B cells through the XCR1 receptor and thought to be a factor in acute allograft rejection and inflammatory bowel disease.
Probab=44.72  E-value=11  Score=23.76  Aligned_cols=16  Identities=13%  Similarity=-0.035  Sum_probs=13.4

Q ss_pred             CCCceeeecccCCcCC
Q psy9084           2 GPDEALCGWPWISRRM   17 (103)
Q Consensus         2 ~~~~~~~~~t~~GRrm   17 (103)
                      +|..|+|.+|+.||+.
T Consensus        32 ~~~~AVIF~Tkkgr~i   47 (72)
T cd00271          32 GSVRAVIFITKRGLKI   47 (72)
T ss_pred             CCCCeEEEEecCCCEE
Confidence            4678999999999874


No 17 
>PF00048 IL8:  Small cytokines (intecrine/chemokine), interleukin-8 like;  InterPro: IPR001811 Many low-molecular weight factors secreted by cells including fibroblasts, macrophages and endothelial cells, in response to a variety of stimuli such as growth factors, interferons, viral transformation and bacterial products, are structurally related [, , ]. Most members of this family of proteins seem to have mitogenic, chemotactic or inflammatory activities. These small cytokines are also called intercrines or chemokines. They are cationic proteins of 70 to 100 amino acid residues that share four conserved cysteine residues involved in two disulphide bonds, as shown in the following schematic representation:  +------------------------------------+ | | xxxxxxxxxxxxxxxxxxxxxxCxCxxxxxxxxxxxxxxxxxxxxxxxCxxxxxxxxxxxxCxxxxx | | +-------------------------+ 'C': conserved cysteine involved in a disulphide bond.   Chemokines can be sorted into main groups based on the spacing of the two amino-terminal cysteines. In the first group (see IPR001089 from INTERPRO), the two cysteines are separated by a single residue (C-x-C), while in the second group (see IPR000827 from INTERPRO), they are adjacent (C-C).; GO: 0008009 chemokine activity, 0006955 immune response, 0005576 extracellular region; PDB: 3HP3_B 2K01_A 2KEE_A 2K04_C 2J7Z_A 1QG7_A 2KED_A 2NWG_B 2KEC_A 1VMC_A ....
Probab=44.33  E-value=10  Score=22.62  Aligned_cols=14  Identities=14%  Similarity=-0.111  Sum_probs=11.7

Q ss_pred             CceeeecccCCcCC
Q psy9084           4 DEALCGWPWISRRM   17 (103)
Q Consensus         4 ~~~~~~~t~~GRrm   17 (103)
                      ..|+|.+|+.||+.
T Consensus        35 ~~avI~~~k~g~~~   48 (64)
T PF00048_consen   35 RPAVIFTTKKGREV   48 (64)
T ss_dssp             SCEEEEEETTSEEE
T ss_pred             CceEEEEecCCCcE
Confidence            57999999999863


No 18 
>cd00274 Chemokine_CX3C Chemokine_CX3C:  1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteines; differ structurally from the other subgroups in that they are attached to a membrane-spanning domain via a mucin-like stalk and can be proteolytically cleaved to a freely diffusible form; chemotatic for T cells, monocytes, and natural killer cells; function as monomers and are found only in vertebrates and a few viruses; currently only fractalkine (sometimes called neurotactin) has been identified as a member of this subfamily; the primary source of fractalkine is neurons, and they exhibit cell adhesion and chemoattractive properties in the central nervous system. See CDs:  Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_CC (cd00272), and Chemokine_C (cd00271) for the additional chemokine subgroups.
Probab=29.72  E-value=26  Score=22.51  Aligned_cols=15  Identities=13%  Similarity=-0.103  Sum_probs=12.6

Q ss_pred             CCceeeecccCCcCC
Q psy9084           3 PDEALCGWPWISRRM   17 (103)
Q Consensus         3 ~~~~~~~~t~~GRrm   17 (103)
                      |..|+|.+|+.||++
T Consensus        35 ~~~AVIF~Tkkgr~i   49 (76)
T cd00274          35 GKRAIILETRQHRLF   49 (76)
T ss_pred             CCCeEEEEECCCCEE
Confidence            567999999999964


No 19 
>PF10179 DUF2369:  Uncharacterised conserved protein (DUF2369);  InterPro: IPR019326  This is a proline-rich region of a group of proteins found from plants to fungi. The function is largely unknown, although the entry contains Fibronectin type-III domain-containing protein C4orf31, which promotes matrix assembly and cell adhesiveness.
Probab=28.27  E-value=63  Score=25.76  Aligned_cols=29  Identities=14%  Similarity=0.257  Sum_probs=22.7

Q ss_pred             eEEEeCCCCCCCeeEEEEEEEccCCceee
Q psy9084          22 QVRLFNLDPDAEYMLMMDFVPVDDKRYRY   50 (103)
Q Consensus        22 ~~~vsGL~p~~~Y~v~v~~~~~d~~ryry   50 (103)
                      --+|+||+|...|.+-+-+......-.+|
T Consensus       261 tetI~~L~PG~~Yl~dV~~~~~~G~sl~Y  289 (300)
T PF10179_consen  261 TETIKGLKPGTTYLFDVYVNGPSGQSLPY  289 (300)
T ss_pred             eeecccCCCCcEEEEEEEEecCCCceeec
Confidence            34799999999998888887766555555


No 20 
>PF07569 Hira:  TUP1-like enhancer of split;  InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin. These proteins also contain IPR001680 from INTERPRO.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=25.32  E-value=40  Score=25.08  Aligned_cols=27  Identities=22%  Similarity=0.491  Sum_probs=19.1

Q ss_pred             CCcCCCccceE--EEeCCCCCCCeeEEEE
Q psy9084          13 ISRRMFPTFQV--RLFNLDPDAEYMLMMD   39 (103)
Q Consensus        13 ~GRrmFP~l~~--~vsGL~p~~~Y~v~v~   39 (103)
                      +|||++|.+..  .+.=|+....|.+.+.
T Consensus         1 sGrrl~P~i~Lgs~~~~l~~~~~~Ll~iT   29 (219)
T PF07569_consen    1 SGRRLLPPIVLGSPVSFLECNGSYLLAIT   29 (219)
T ss_pred             CCccccCcEecCCceEEEEeCCCEEEEEe
Confidence            69999998654  3444788889955544


No 21 
>PF12503 CMV_1a_C:  Cucumber mosaic virus 1a protein C terminal ;  InterPro: IPR022184  This domain family is found in viruses, and is approximately 90 amino acids in length. The family is found in association with PF01443 from PFAM, PF01660 from PFAM. There is a conserved GLG sequence motif. 1a protein is the major virulence factor of the (Cucumber mosaic virus. The Ns strain of CMV causes necrotic lesions to Nicotiana spp. while other strains cause systemic mosaic. The determinant of the pathogenesis of these different strains is the specific amino acid residue at the 461 residue of the 1a protein. ; GO: 0008168 methyltransferase activity, 0016817 hydrolase activity, acting on acid anhydrides
Probab=23.42  E-value=69  Score=21.07  Aligned_cols=26  Identities=23%  Similarity=0.176  Sum_probs=17.2

Q ss_pred             eeec-ccCCcCCCcc-----ceEEEeCCCCCC
Q psy9084           7 LCGW-PWISRRMFPT-----FQVRLFNLDPDA   32 (103)
Q Consensus         7 ~~~~-t~~GRrmFP~-----l~~~vsGL~p~~   32 (103)
                      |+|+ -.+||.|+|.     +-|+=+||-|+.
T Consensus        30 lVNvHf~~GrWm~P~~~~Y~VGyNe~GLGpK~   61 (85)
T PF12503_consen   30 LVNVHFPNGRWMYPEGYEYMVGYNESGLGPKF   61 (85)
T ss_pred             cEEEEecCCceecCCCeEEEeeecCCCCCcCc
Confidence            4444 3579999995     445557777754


No 22 
>PF15417 DUF4624:  Domain of unknown function (DUF4624)
Probab=22.51  E-value=1.1e+02  Score=21.44  Aligned_cols=41  Identities=27%  Similarity=0.408  Sum_probs=33.9

Q ss_pred             CCceeeecccCCcCCCccceEEEeCCCCCCCeeEEEEEEEc
Q psy9084           3 PDEALCGWPWISRRMFPTFQVRLFNLDPDAEYMLMMDFVPV   43 (103)
Q Consensus         3 ~~~~~~~~t~~GRrmFP~l~~~vsGL~p~~~Y~v~v~~~~~   43 (103)
                      .||-|-.-|..|.-+--.+.++++.|.....|.+.+.=..+
T Consensus        71 ~devLWsn~~~~~V~~dt~tisL~nlqk~kEY~V~ftGtkI  111 (132)
T PF15417_consen   71 TDEVLWSNTWNGKVSGDTFTISLNNLQKEKEYVVCFTGTKI  111 (132)
T ss_pred             ccceeeccccccccccceEEEEhhhcccCceEEEEEeccEe
Confidence            35667777889999999999999999999999987654443


No 23 
>PF02257 RFX_DNA_binding:  RFX DNA-binding domain;  InterPro: IPR003150 RFX is a regulatory factor which binds to the X box of MHC class II genes and is essential for their expression. The DNA-binding domain of RFX is the central domain of the protein and binds ssDNA as either a monomer or homodimer [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1DP7_P 2KW3_A.
Probab=21.90  E-value=50  Score=21.52  Aligned_cols=22  Identities=23%  Similarity=0.573  Sum_probs=16.2

Q ss_pred             cCCCccceEEEeCCCCCCCeeE
Q psy9084          15 RRMFPTFQVRLFNLDPDAEYML   36 (103)
Q Consensus        15 RrmFP~l~~~vsGL~p~~~Y~v   36 (103)
                      |..||.++.+-.|.--+++|..
T Consensus        55 r~vFP~l~~RRLG~RG~SkYhY   76 (85)
T PF02257_consen   55 RQVFPNLKTRRLGTRGQSKYHY   76 (85)
T ss_dssp             HHHSTT-EEEEESSTT--EEEE
T ss_pred             HHHcCCCcccccccCCCcceEE
Confidence            3469999999999999999974


Done!