Query         psy9108
Match_columns 98
No_of_seqs    101 out of 143
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:10:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9108.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9108hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0585|consensus               99.8 1.4E-19   3E-24  154.4   2.2   84   14-97    337-432 (576)
  2 cd07873 STKc_PCTAIRE1 Catalyti  97.2 0.00018 3.9E-09   53.0   2.1   33   19-51    256-295 (301)
  3 cd07871 STKc_PCTAIRE3 Catalyti  96.9 0.00043 9.4E-09   51.0   1.7   28   18-45    254-288 (288)
  4 cd07872 STKc_PCTAIRE2 Catalyti  96.7  0.0009   2E-08   49.6   2.0   33   17-49    254-293 (309)
  5 cd05601 STKc_CRIK Catalytic do  96.7 0.00098 2.1E-08   50.0   2.0   35   14-48    229-269 (330)
  6 cd07862 STKc_CDK6 Catalytic do  96.6 0.00097 2.1E-08   48.4   1.6   27   19-45    257-290 (290)
  7 cd07863 STKc_CDK4 Catalytic do  96.6  0.0011 2.4E-08   48.0   1.6   27   19-45    255-288 (288)
  8 cd07848 STKc_CDKL5 Catalytic d  96.6  0.0011 2.5E-08   48.0   1.5   26   20-45    255-287 (287)
  9 cd07859 STKc_TDY_MAPK_plant Ca  96.5  0.0018   4E-08   48.0   2.4   31   19-49    260-297 (338)
 10 cd07857 STKc_MPK1 Catalytic do  96.5  0.0014 3.1E-08   49.3   1.8   49   18-69    261-319 (332)
 11 cd07832 STKc_CCRK Catalytic do  96.5  0.0014   3E-08   47.1   1.6   28   19-46    252-286 (286)
 12 cd07839 STKc_CDK5 Catalytic do  96.4  0.0015 3.3E-08   47.1   1.6   27   19-45    251-284 (284)
 13 KOG0583|consensus               96.4  0.0016 3.6E-08   52.7   2.0   40    8-48    235-281 (370)
 14 KOG0588|consensus               96.4  0.0012 2.7E-08   59.3   1.3   35   12-48    228-269 (786)
 15 KOG0604|consensus               96.4  0.0014   3E-08   55.1   1.2   31   20-50    293-330 (400)
 16 cd07868 STKc_CDK8 Catalytic do  96.3  0.0021 4.6E-08   47.5   1.7   26   20-45    285-317 (317)
 17 cd07861 STKc_CDK1_euk Catalyti  96.3  0.0023 5.1E-08   46.1   1.7   27   19-45    252-285 (285)
 18 cd07869 STKc_PFTAIRE1 Catalyti  96.2  0.0024 5.3E-08   47.2   1.6   28   21-48    260-294 (303)
 19 cd07860 STKc_CDK2_3 Catalytic   96.2  0.0025 5.4E-08   46.0   1.6   27   19-45    251-284 (284)
 20 cd07845 STKc_CDK10 Catalytic d  96.1  0.0035 7.5E-08   46.4   2.1   28   21-48    262-296 (309)
 21 cd07867 STKc_CDC2L6 Catalytic   96.1  0.0034 7.4E-08   46.2   1.7   26   20-45    285-317 (317)
 22 PHA03209 serine/threonine kina  96.0  0.0035 7.6E-08   48.3   1.5   30   18-47    320-356 (357)
 23 cd07831 STKc_MOK Catalytic dom  95.9  0.0039 8.4E-08   44.7   1.4   27   19-45    249-282 (282)
 24 KOG0580|consensus               95.9  0.0023 4.9E-08   52.0   0.1   41    9-49    233-280 (281)
 25 cd07876 STKc_JNK2 Catalytic do  95.9  0.0058 1.3E-07   46.6   2.3   27   21-47    287-320 (359)
 26 PTZ00284 protein kinase; Provi  95.9  0.0058 1.3E-07   49.0   2.4   27   22-48    411-444 (467)
 27 cd06643 STKc_SLK Catalytic dom  95.8  0.0062 1.3E-07   44.2   2.1   34   19-52    232-272 (282)
 28 cd07846 STKc_CDKL2_3 Catalytic  95.8  0.0046   1E-07   44.5   1.5   28   18-45    252-286 (286)
 29 KOG0032|consensus               95.7  0.0068 1.5E-07   49.7   2.3   35   19-53    263-304 (382)
 30 cd07879 STKc_p38delta_MAPK13 C  95.7  0.0066 1.4E-07   46.2   2.0   30   19-48    267-303 (342)
 31 cd07847 STKc_CDKL1_4 Catalytic  95.7  0.0058 1.3E-07   43.9   1.6   27   19-45    253-286 (286)
 32 KOG0033|consensus               95.6  0.0056 1.2E-07   50.7   1.5   30   19-48    237-273 (355)
 33 cd07835 STKc_CDK1_like Catalyt  95.6   0.007 1.5E-07   43.7   1.7   28   18-45    249-283 (283)
 34 cd06617 PKc_MKK3_6 Catalytic d  95.6  0.0055 1.2E-07   44.1   1.1   33   20-52    232-271 (283)
 35 cd06637 STKc_TNIK Catalytic do  95.6  0.0073 1.6E-07   43.2   1.7   27   19-45    239-272 (272)
 36 KOG0603|consensus               95.5  0.0082 1.8E-07   53.1   2.1   35   19-53    533-574 (612)
 37 cd07858 STKc_TEY_MAPK_plant Ca  95.5  0.0067 1.4E-07   45.9   1.4   30   18-47    260-296 (337)
 38 PLN00034 mitogen-activated pro  95.5   0.008 1.7E-07   45.9   1.8   31   18-48    297-334 (353)
 39 cd06610 STKc_OSR1_SPAK Catalyt  95.4  0.0079 1.7E-07   42.5   1.5   26   20-45    235-267 (267)
 40 cd07853 STKc_NLK Catalytic dom  95.4   0.008 1.7E-07   46.2   1.6   30   19-48    258-294 (372)
 41 cd07836 STKc_Pho85 Catalytic d  95.4  0.0075 1.6E-07   43.4   1.3   27   19-45    251-284 (284)
 42 cd06629 STKc_MAPKKK_Bck1_like   95.3  0.0093   2E-07   42.8   1.7   27   19-45    239-272 (272)
 43 PHA03212 serine/threonine kina  95.3  0.0088 1.9E-07   47.5   1.7   35   20-55    347-388 (391)
 44 cd08225 STKc_Nek5 Catalytic do  95.3   0.011 2.3E-07   41.8   1.9   29   17-45    222-257 (257)
 45 cd06651 STKc_MEKK3 Catalytic d  95.3  0.0079 1.7E-07   43.3   1.2   27   20-46    233-265 (266)
 46 cd05596 STKc_ROCK Catalytic do  95.3   0.011 2.5E-07   45.9   2.1   34   15-48    268-310 (370)
 47 cd06605 PKc_MAPKK Catalytic do  95.3  0.0081 1.8E-07   42.7   1.2   28   21-48    229-263 (265)
 48 cd07851 STKc_p38 Catalytic dom  95.2   0.017 3.6E-07   44.0   2.8   32   19-50    268-306 (343)
 49 cd07878 STKc_p38beta_MAPK11 Ca  95.2   0.014 3.1E-07   44.0   2.4   28   21-48    270-304 (343)
 50 cd07854 STKc_MAPK4_6 Catalytic  95.2   0.011 2.4E-07   44.9   1.8   30   19-48    270-306 (342)
 51 cd07866 STKc_BUR1 Catalytic do  95.2   0.011 2.3E-07   43.1   1.6   26   20-45    279-311 (311)
 52 PLN00009 cyclin-dependent kina  95.2  0.0085 1.9E-07   43.7   1.1   35   18-52    253-294 (294)
 53 cd07874 STKc_JNK3 Catalytic do  95.2    0.01 2.2E-07   45.2   1.5   28   21-48    283-317 (355)
 54 cd07841 STKc_CDK7 Catalytic do  95.1   0.016 3.4E-07   42.3   2.4   32   19-50    252-290 (298)
 55 cd06609 STKc_MST3_like Catalyt  95.1   0.011 2.5E-07   42.5   1.6   30   21-50    223-259 (274)
 56 cd07837 STKc_CdkB_plant Cataly  95.1   0.011 2.4E-07   42.9   1.6   27   19-45    261-294 (295)
 57 PHA03390 pk1 serine/threonine-  95.1   0.012 2.6E-07   43.0   1.7   27   20-46    232-266 (267)
 58 cd06622 PKc_MAPKK_PBS2_like Ca  95.1    0.01 2.2E-07   43.0   1.3   32   19-50    232-270 (286)
 59 cd07829 STKc_CDK_like Catalyti  95.1   0.011 2.5E-07   42.1   1.5   27   19-45    249-282 (282)
 60 cd06626 STKc_MEKK4 Catalytic d  95.1   0.014 2.9E-07   41.4   1.8   30   16-45    228-264 (264)
 61 cd07865 STKc_CDK9 Catalytic do  95.1   0.011 2.5E-07   42.9   1.5   24   22-45    280-310 (310)
 62 cd05576 STKc_RPK118_like Catal  95.0   0.012 2.7E-07   42.1   1.5   27   19-45    199-237 (237)
 63 PTZ00024 cyclin-dependent prot  95.0   0.019 4.2E-07   43.0   2.6   32   19-50    283-321 (335)
 64 cd06631 STKc_YSK4 Catalytic do  95.0   0.015 3.1E-07   41.6   1.8   27   19-45    232-265 (265)
 65 cd07849 STKc_ERK1_2_like Catal  94.9   0.021 4.6E-07   43.1   2.6   31   19-49    262-299 (336)
 66 PTZ00036 glycogen synthase kin  94.9   0.022 4.8E-07   45.9   2.8   51   20-70    322-382 (440)
 67 cd05627 STKc_NDR2 Catalytic do  94.9    0.02 4.3E-07   43.9   2.4   33   15-47    257-298 (360)
 68 cd07843 STKc_CDC2L1 Catalytic   94.9   0.014   3E-07   42.6   1.4   25   21-45    262-293 (293)
 69 cd06612 STKc_MST1_2 Catalytic   94.9   0.014 3.1E-07   41.1   1.4   27   19-45    223-256 (256)
 70 cd08223 STKc_Nek4 Catalytic do  94.8   0.015 3.3E-07   41.1   1.6   27   19-45    224-257 (257)
 71 cd05621 STKc_ROCK2 Catalytic d  94.8   0.018 3.9E-07   45.1   1.9   36   13-48    266-310 (370)
 72 cd05626 STKc_LATS2 Catalytic d  94.7   0.019 4.1E-07   44.6   2.0   34   14-47    268-310 (381)
 73 PF00069 Pkinase:  Protein kina  94.7   0.016 3.5E-07   40.7   1.4   23   23-45    231-260 (260)
 74 cd06649 PKc_MEK2 Catalytic dom  94.7   0.014 3.1E-07   44.1   1.1   29   20-48    272-307 (331)
 75 cd07842 STKc_CDK8_like Catalyt  94.7   0.018 3.8E-07   42.1   1.6   26   20-45    284-316 (316)
 76 cd05573 STKc_ROCK_NDR_like Cat  94.7   0.022 4.7E-07   42.8   2.1   35   13-47    249-290 (350)
 77 cd06624 STKc_ASK Catalytic dom  94.6   0.018 3.9E-07   41.3   1.6   26   20-45    236-268 (268)
 78 cd06608 STKc_myosinIII_like Ca  94.6   0.018 3.8E-07   40.7   1.4   25   21-45    244-275 (275)
 79 cd06636 STKc_MAP4K4_6 Catalyti  94.6   0.021 4.5E-07   41.3   1.8   26   20-45    250-282 (282)
 80 PHA03207 serine/threonine kina  94.6   0.016 3.5E-07   45.3   1.2   33   21-53    347-386 (392)
 81 KOG0612|consensus               94.5   0.017 3.6E-07   54.7   1.5   36   13-48    300-344 (1317)
 82 cd06639 STKc_myosinIIIB Cataly  94.5   0.021 4.5E-07   41.7   1.7   27   19-45    257-290 (291)
 83 cd07838 STKc_CDK4_6_like Catal  94.5   0.016 3.4E-07   41.6   1.0   27   19-45    254-287 (287)
 84 cd05630 STKc_GRK6 Catalytic do  94.5   0.019 4.1E-07   42.4   1.4   29   19-47    226-266 (285)
 85 cd05608 STKc_GRK1 Catalytic do  94.5   0.017 3.8E-07   42.3   1.2   31   18-48    221-263 (280)
 86 KOG0610|consensus               94.4    0.02 4.4E-07   49.2   1.6   32   15-46    354-396 (459)
 87 cd06628 STKc_MAPKKK_Byr2_like   94.4   0.022 4.9E-07   40.6   1.6   27   19-45    234-267 (267)
 88 cd07830 STKc_MAK_like Catalyti  94.4   0.023 4.9E-07   40.9   1.6   25   21-45    252-283 (283)
 89 cd05118 STKc_CMGC Catalytic do  94.4   0.019 4.1E-07   41.0   1.1   27   19-45    250-283 (283)
 90 cd05590 STKc_nPKC_eta Catalyti  94.3    0.03 6.4E-07   42.4   2.1   29   19-47    217-258 (320)
 91 cd06616 PKc_MKK4 Catalytic dom  94.3   0.022 4.8E-07   41.3   1.4   29   20-48    238-273 (288)
 92 cd07875 STKc_JNK1 Catalytic do  94.3   0.035 7.5E-07   42.5   2.5   26   22-47    291-323 (364)
 93 cd06611 STKc_SLK_like Catalyti  94.3   0.028   6E-07   40.7   1.8   31   18-48    231-268 (280)
 94 cd05631 STKc_GRK4 Catalytic do  94.3    0.02 4.4E-07   42.1   1.1   32   19-50    226-269 (285)
 95 cd08226 PK_STRAD_beta Pseudoki  94.2   0.014   3E-07   44.0   0.2   30   20-49    279-315 (328)
 96 cd07834 STKc_MAPK Catalytic do  94.2   0.034 7.5E-07   41.3   2.3   31   18-48    258-295 (330)
 97 PLN03225 Serine/threonine-prot  94.2    0.03 6.6E-07   47.5   2.2   30   24-53    425-461 (566)
 98 cd05572 STKc_cGK_PKG Catalytic  94.2   0.025 5.4E-07   40.3   1.4   28   20-47    218-257 (262)
 99 cd05628 STKc_NDR1 Catalytic do  94.2   0.029 6.3E-07   43.1   1.9   32   16-47    258-298 (363)
100 cd06618 PKc_MKK7 Catalytic dom  94.2   0.029 6.3E-07   41.2   1.8   33   16-48    240-279 (296)
101 cd08227 PK_STRAD_alpha Pseudok  94.1   0.023 5.1E-07   42.7   1.3   28   20-47    278-312 (327)
102 PLN03224 probable serine/threo  94.1   0.026 5.7E-07   48.0   1.7   33   15-47    463-505 (507)
103 cd06625 STKc_MEKK3_like Cataly  94.1   0.029 6.4E-07   39.8   1.7   26   20-45    231-263 (263)
104 cd07880 STKc_p38gamma_MAPK12 C  94.1   0.038 8.2E-07   42.2   2.4   30   19-48    268-304 (343)
105 cd05625 STKc_LATS1 Catalytic d  94.1   0.031 6.7E-07   43.2   1.9   34   14-47    268-310 (382)
106 cd08218 STKc_Nek1 Catalytic do  94.1   0.028 6.1E-07   39.8   1.5   27   19-45    223-256 (256)
107 cd05612 STKc_PRKX_like Catalyt  94.1   0.031 6.7E-07   41.4   1.8   36   19-54    219-266 (291)
108 PTZ00426 cAMP-dependent protei  94.1    0.03 6.4E-07   43.3   1.7   29   19-47    249-289 (340)
109 cd07844 STKc_PCTAIRE_like Cata  94.0    0.03 6.6E-07   40.7   1.6   26   20-45    257-291 (291)
110 PTZ00263 protein kinase A cata  94.0   0.029 6.3E-07   42.6   1.5   28   20-47    237-276 (329)
111 cd05123 STKc_AGC Catalytic dom  94.0   0.035 7.6E-07   39.0   1.8   26   20-45    215-250 (250)
112 cd08222 STKc_Nek11 Catalytic d  93.9   0.029 6.3E-07   40.0   1.4   26   20-45    228-260 (260)
113 cd05581 STKc_PDK1 Catalytic do  93.9   0.033 7.2E-07   39.6   1.7   27   19-45    243-280 (280)
114 cd05633 STKc_GRK3 Catalytic do  93.9   0.028   6E-07   41.4   1.3   29   19-47    220-260 (279)
115 cd07855 STKc_ERK5 Catalytic do  93.8   0.039 8.4E-07   41.6   1.9   39   19-60    264-309 (334)
116 cd05578 STKc_Yank1 Catalytic d  93.8   0.036 7.9E-07   39.4   1.7   27   19-45    223-258 (258)
117 cd06621 PKc_MAPKK_Pek1_like Ca  93.8   0.028   6E-07   41.1   1.1   30   21-50    238-274 (287)
118 cd05611 STKc_Rim15_like Cataly  93.8   0.029 6.3E-07   40.0   1.1   30   19-48    218-257 (260)
119 cd05588 STKc_aPKC Catalytic do  93.8   0.036 7.8E-07   42.1   1.7   29   19-47    226-267 (329)
120 cd06632 STKc_MEKK1_plant Catal  93.7   0.041 8.8E-07   38.7   1.8   27   19-45    225-258 (258)
121 cd06650 PKc_MEK1 Catalytic dom  93.7   0.026 5.7E-07   43.0   0.8   28   21-48    271-305 (333)
122 cd08217 STKc_Nek2 Catalytic do  93.7   0.036 7.8E-07   38.8   1.4   26   20-45    233-265 (265)
123 cd05600 STKc_Sid2p_Dbf2p Catal  93.7   0.038 8.2E-07   41.7   1.6   29   20-48    228-263 (333)
124 cd06654 STKc_PAK1 Catalytic do  93.7   0.036 7.8E-07   41.1   1.5   32   17-48    238-276 (296)
125 cd07864 STKc_CDK12 Catalytic d  93.6   0.041 8.8E-07   40.1   1.7   27   19-45    269-302 (302)
126 cd05579 STKc_MAST_like Catalyt  93.6    0.04 8.6E-07   38.6   1.6   27   21-47    226-262 (265)
127 cd06614 STKc_PAK Catalytic dom  93.6   0.034 7.4E-07   40.4   1.3   31   20-50    241-278 (286)
128 cd06615 PKc_MEK Catalytic doma  93.6   0.042 9.1E-07   41.0   1.8   28   21-48    259-293 (308)
129 cd05571 STKc_PKB Catalytic dom  93.6   0.042   9E-07   41.5   1.7   29   19-47    216-256 (323)
130 cd05598 STKc_LATS Catalytic do  93.6   0.049 1.1E-06   41.8   2.1   33   15-47    265-306 (376)
131 cd06644 STKc_STK10_LOK Catalyt  93.6   0.048   1E-06   39.9   2.0   29   19-47    239-274 (292)
132 cd05577 STKc_GRK Catalytic dom  93.6   0.035 7.5E-07   40.3   1.2   30   19-48    219-260 (277)
133 cd07833 STKc_CDKL Catalytic do  93.5   0.043 9.3E-07   39.4   1.7   25   21-45    257-288 (288)
134 cd05597 STKc_DMPK_like Catalyt  93.5    0.05 1.1E-06   41.3   2.1   29   19-47    234-271 (331)
135 cd05619 STKc_nPKC_theta Cataly  93.5   0.046 9.9E-07   41.4   1.9   29   20-48    218-254 (316)
136 cd05585 STKc_YPK1_like Catalyt  93.5   0.043 9.4E-07   41.1   1.7   30   19-48    214-253 (312)
137 cd05593 STKc_PKB_gamma Catalyt  93.5   0.045 9.8E-07   41.6   1.8   29   19-47    216-256 (328)
138 cd06917 STKc_NAK1_like Catalyt  93.4   0.043 9.4E-07   39.4   1.5   32   21-52    227-265 (277)
139 cd05614 STKc_MSK2_N N-terminal  93.4   0.049 1.1E-06   40.9   1.8   30   19-48    232-273 (332)
140 cd06645 STKc_MAP4K3 Catalytic   93.3   0.052 1.1E-06   38.8   1.8   26   19-44    235-267 (267)
141 cd06630 STKc_MEKK1 Catalytic d  93.3   0.045 9.8E-07   38.9   1.5   27   20-46    235-268 (268)
142 cd05599 STKc_NDR_like Catalyti  93.3   0.057 1.2E-06   41.1   2.0   34   14-47    259-301 (364)
143 KOG0605|consensus               93.3   0.045 9.8E-07   48.0   1.6   33   15-47    409-450 (550)
144 cd08215 STKc_Nek Catalytic dom  93.3   0.055 1.2E-06   37.6   1.8   26   20-45    226-258 (258)
145 cd05622 STKc_ROCK1 Catalytic d  93.2    0.06 1.3E-06   42.1   2.1   34   15-48    268-310 (371)
146 cd05623 STKc_MRCK_alpha Cataly  93.2   0.054 1.2E-06   41.0   1.8   29   19-47    234-271 (332)
147 cd06657 STKc_PAK4 Catalytic do  93.2   0.047   1E-06   40.6   1.5   30   20-49    241-277 (292)
148 cd06658 STKc_PAK5 Catalytic do  93.2   0.062 1.3E-06   39.9   2.0   36   16-51    239-281 (292)
149 cd05620 STKc_nPKC_delta Cataly  93.2   0.057 1.2E-06   40.7   1.9   29   20-48    218-254 (316)
150 KOG0592|consensus               93.1   0.048   1E-06   48.3   1.6   30   18-47    307-343 (604)
151 cd05629 STKc_NDR_like_fungal C  93.0    0.06 1.3E-06   41.5   1.9   35   13-47    267-310 (377)
152 cd08216 PK_STRAD Pseudokinase   93.0   0.028 6.1E-07   41.4  -0.0   28   21-48    267-301 (314)
153 cd05591 STKc_nPKC_epsilon Cata  93.0    0.06 1.3E-06   40.5   1.8   28   20-47    218-259 (321)
154 cd06648 STKc_PAK_II Catalytic   93.0   0.078 1.7E-06   39.0   2.3   31   19-49    239-276 (285)
155 cd07870 STKc_PFTAIRE2 Catalyti  92.9   0.052 1.1E-06   39.6   1.3   24   22-45    261-291 (291)
156 cd05607 STKc_GRK7 Catalytic do  92.9   0.063 1.4E-06   39.3   1.8   29   19-47    220-259 (277)
157 cd05618 STKc_aPKC_iota Catalyt  92.9   0.063 1.4E-06   40.8   1.8   29   19-47    226-267 (329)
158 cd05584 STKc_p70S6K Catalytic   92.9   0.064 1.4E-06   40.5   1.8   31   18-48    220-262 (323)
159 cd08220 STKc_Nek8 Catalytic do  92.9   0.064 1.4E-06   37.8   1.7   26   20-45    224-256 (256)
160 cd06619 PKc_MKK5 Catalytic dom  92.8    0.08 1.7E-06   38.6   2.2   31   20-50    224-261 (279)
161 cd07850 STKc_JNK Catalytic dom  92.8   0.062 1.4E-06   40.9   1.7   28   21-48    283-317 (353)
162 cd05594 STKc_PKB_alpha Catalyt  92.7   0.065 1.4E-06   40.4   1.7   28   20-47    218-257 (325)
163 cd05122 PKc_STE Catalytic doma  92.7   0.071 1.5E-06   36.7   1.7   24   21-44    223-253 (253)
164 cd05609 STKc_MAST Catalytic do  92.7    0.07 1.5E-06   39.5   1.8   33   17-49    238-280 (305)
165 cd06659 STKc_PAK6 Catalytic do  92.7   0.068 1.5E-06   39.8   1.7   31   19-49    241-278 (297)
166 cd06606 STKc_MAPKKK Catalytic   92.6   0.068 1.5E-06   37.0   1.5   26   20-45    228-260 (260)
167 cd06633 STKc_TAO3 Catalytic do  92.5   0.078 1.7E-06   39.7   1.8   30   19-48    243-279 (313)
168 cd05606 STKc_beta_ARK Catalyti  92.4   0.071 1.5E-06   39.1   1.5   29   20-48    221-261 (278)
169 cd06627 STKc_Cdc7_like Catalyt  92.4   0.087 1.9E-06   36.8   1.8   27   19-45    221-254 (254)
170 PHA03211 serine/threonine kina  92.4    0.07 1.5E-06   44.2   1.5   28   20-47    426-460 (461)
171 cd06647 STKc_PAK_I Catalytic d  92.3   0.063 1.4E-06   39.8   1.1   29   20-48    240-275 (293)
172 cd07856 STKc_Sty1_Hog1 Catalyt  92.3    0.11 2.4E-06   39.5   2.4   36   19-55    258-300 (328)
173 PHA03210 serine/threonine kina  92.3   0.062 1.3E-06   44.2   1.1   30   20-49    425-461 (501)
174 cd06655 STKc_PAK2 Catalytic do  92.2   0.075 1.6E-06   39.5   1.4   30   19-48    239-275 (296)
175 cd05595 STKc_PKB_beta Catalyti  92.2    0.08 1.7E-06   40.1   1.6   30   19-48    216-257 (323)
176 KOG0599|consensus               92.2   0.051 1.1E-06   45.8   0.5   29   19-47    253-288 (411)
177 cd05587 STKc_cPKC Catalytic do  92.1   0.095 2.1E-06   39.5   1.9   29   19-47    222-262 (324)
178 cd05582 STKc_RSK_N N-terminal   92.1   0.092   2E-06   39.3   1.8   29   19-47    219-259 (318)
179 cd05574 STKc_phototropin_like   91.8     0.1 2.3E-06   38.5   1.8   38   18-56    254-302 (316)
180 cd06607 STKc_TAO Catalytic dom  91.8   0.083 1.8E-06   39.2   1.2   28   21-48    239-273 (307)
181 cd05605 STKc_GRK4_like Catalyt  91.7   0.087 1.9E-06   38.7   1.3   30   19-48    226-267 (285)
182 cd07877 STKc_p38alpha_MAPK14 C  91.7   0.085 1.8E-06   40.3   1.2   29   21-49    272-307 (345)
183 cd05586 STKc_Sck1_like Catalyt  91.7    0.11 2.4E-06   39.1   1.8   30   20-49    220-260 (330)
184 cd06656 STKc_PAK3 Catalytic do  91.6    0.11 2.3E-06   38.6   1.7   29   20-48    240-275 (297)
185 cd06652 STKc_MEKK2 Catalytic d  91.5   0.091   2E-06   37.7   1.1   26   20-45    233-264 (265)
186 KOG0575|consensus               91.4     0.1 2.2E-06   46.3   1.5   40    8-49    230-276 (592)
187 cd05570 STKc_PKC Catalytic dom  91.3    0.13 2.7E-06   38.8   1.8   30   19-48    217-258 (318)
188 cd06638 STKc_myosinIIIA Cataly  91.3    0.13 2.8E-06   37.2   1.8   25   21-45    255-286 (286)
189 KOG0671|consensus               91.2   0.049 1.1E-06   46.5  -0.6   39    9-48    367-412 (415)
190 cd06620 PKc_MAPKK_Byr1_like Ca  91.1    0.14   3E-06   37.3   1.8   28   21-48    238-272 (284)
191 cd05604 STKc_SGK3 Catalytic do  91.0    0.16 3.4E-06   38.3   2.0   30   18-47    216-256 (325)
192 cd05580 STKc_PKA Catalytic dom  91.0    0.13 2.7E-06   37.8   1.5   30   19-48    219-260 (290)
193 cd07840 STKc_CDK9_like Catalyt  91.0    0.13 2.7E-06   36.8   1.4   24   22-45    257-287 (287)
194 cd07852 STKc_MAPK15 Catalytic   90.9    0.11 2.5E-06   39.0   1.2   31   18-48    264-301 (337)
195 cd06653 STKc_MEKK3_like_1 Cata  90.7    0.15 3.2E-06   36.7   1.6   26   20-45    233-264 (264)
196 cd05575 STKc_SGK Catalytic dom  90.7    0.16 3.6E-06   38.2   1.9   31   18-48    216-257 (323)
197 cd06623 PKc_MAPKK_plant_like C  90.5    0.12 2.6E-06   36.4   1.0   26   21-46    228-260 (264)
198 cd05602 STKc_SGK1 Catalytic do  90.4     0.2 4.3E-06   37.8   2.1   30   18-47    216-256 (325)
199 cd05617 STKc_aPKC_zeta Catalyt  90.1    0.19 4.1E-06   38.1   1.8   28   20-47    225-265 (327)
200 KOG0615|consensus               90.0    0.11 2.4E-06   44.9   0.5   33   16-48    404-443 (475)
201 cd06640 STKc_MST4 Catalytic do  89.8    0.12 2.5E-06   37.5   0.5   31   20-50    224-261 (277)
202 cd05589 STKc_PKN Catalytic dom  89.8     0.2 4.3E-06   37.7   1.7   29   19-47    222-262 (324)
203 cd06634 STKc_TAO2 Catalytic do  89.4    0.23 4.9E-06   37.0   1.7   30   19-48    237-273 (308)
204 cd06613 STKc_MAP4K3_like Catal  89.2    0.16 3.4E-06   35.9   0.7   28   17-44    228-262 (262)
205 cd05592 STKc_nPKC_theta_delta   89.0    0.25 5.3E-06   37.3   1.7   30   19-48    217-254 (316)
206 cd06635 STKc_TAO1 Catalytic do  89.0    0.21 4.6E-06   37.3   1.3   35   19-53    247-288 (317)
207 KOG0616|consensus               88.9    0.25 5.3E-06   41.5   1.7   29   19-47    262-302 (355)
208 cd06642 STKc_STK25-YSK1 Cataly  88.6    0.15 3.2E-06   36.9   0.3   29   20-48    224-259 (277)
209 cd06641 STKc_MST3 Catalytic do  88.4    0.23 4.9E-06   36.0   1.1   30   19-48    223-259 (277)
210 cd05632 STKc_GRK5 Catalytic do  88.2    0.25 5.5E-06   36.3   1.3   32   19-50    226-269 (285)
211 cd06646 STKc_MAP4K5 Catalytic   88.0    0.34 7.3E-06   34.6   1.7   26   19-44    235-267 (267)
212 KOG0659|consensus               87.9    0.33 7.2E-06   40.3   1.9   30   19-48    251-287 (318)
213 cd05616 STKc_cPKC_beta Catalyt  87.7    0.34 7.3E-06   36.5   1.7   29   19-47    222-262 (323)
214 smart00220 S_TKc Serine/Threon  87.2    0.35 7.5E-06   32.8   1.4   25   21-45    213-244 (244)
215 cd05615 STKc_cPKC_alpha Cataly  86.4    0.46 9.9E-06   36.0   1.8   29   19-47    222-262 (323)
216 cd05624 STKc_MRCK_beta Catalyt  85.8    0.51 1.1E-05   35.8   1.8   29   19-47    234-271 (331)
217 cd05583 STKc_MSK_N N-terminal   84.9    0.58 1.3E-05   34.0   1.7   29   20-48    234-272 (288)
218 cd08221 STKc_Nek9 Catalytic do  84.0    0.63 1.4E-05   32.9   1.5   27   19-45    223-256 (256)
219 cd08529 STKc_FA2-like Catalyti  84.0    0.59 1.3E-05   32.8   1.4   26   20-45    224-256 (256)
220 KOG0670|consensus               83.8    0.32 6.9E-06   43.9  -0.1   34   14-47    711-751 (752)
221 cd05613 STKc_MSK1_N N-terminal  83.7    0.74 1.6E-05   33.5   1.8   30   20-49    234-275 (290)
222 cd05603 STKc_SGK2 Catalytic do  83.5    0.83 1.8E-05   34.2   2.0   29   19-47    217-256 (321)
223 KOG0666|consensus               83.1    0.82 1.8E-05   39.2   2.0   27   31-57    326-352 (438)
224 cd08530 STKc_CNK2-like Catalyt  82.3    0.76 1.6E-05   32.2   1.3   27   19-45    223-256 (256)
225 KOG0198|consensus               81.8    0.81 1.8E-05   37.1   1.5   28   21-48    248-282 (313)
226 KOG0667|consensus               81.3    0.92   2E-05   40.3   1.7   24   23-46    476-506 (586)
227 KOG0581|consensus               80.1    0.79 1.7E-05   38.6   0.9   28   21-48    307-341 (364)
228 cd05610 STKc_MASTL Catalytic d  79.4    0.93   2E-05   39.1   1.2   30   19-48    604-640 (669)
229 PTZ00283 serine/threonine prot  78.1     1.2 2.5E-05   36.9   1.3   31   17-47    265-302 (496)
230 KOG0596|consensus               77.0     1.5 3.3E-05   39.6   1.8   30   25-57    603-639 (677)
231 KOG0660|consensus               76.5     1.4 3.1E-05   37.0   1.5   41   19-62    280-327 (359)
232 KOG0663|consensus               71.5     2.6 5.7E-05   36.2   1.8   28   21-48    333-367 (419)
233 smart00750 KIND kinase non-cat  70.2     1.2 2.6E-05   30.1  -0.4   24   24-47    140-170 (176)
234 KOG0598|consensus               69.9     2.7 5.8E-05   35.4   1.5   32   16-47    243-286 (357)
235 COG1731 Archaeal riboflavin sy  69.1     1.1 2.3E-05   33.9  -0.8   60   24-92     23-92  (154)
236 KOG0607|consensus               66.8     2.6 5.7E-05   36.3   0.9   30   19-48    331-367 (463)
237 cd05061 PTKc_InsR Catalytic do  64.5     4.4 9.5E-05   29.6   1.6   27   20-46    245-284 (288)
238 KOG0594|consensus               64.3     3.5 7.7E-05   34.1   1.2   37   13-49    266-309 (323)
239 KOG0665|consensus               64.2     3.5 7.5E-05   35.0   1.1   24   23-46    284-314 (369)
240 KOG4717|consensus               62.5     4.3 9.2E-05   37.1   1.4   35   12-48    235-276 (864)
241 KOG1290|consensus               57.2     5.3 0.00012   35.7   1.1   26   24-49    525-557 (590)
242 KOG0579|consensus               56.2     5.8 0.00012   37.3   1.2   27   22-48    262-295 (1187)
243 PLN00181 protein SPA1-RELATED;  55.9     5.7 0.00012   34.6   1.1   18   31-48    254-271 (793)
244 KOG0586|consensus               55.3     5.3 0.00012   35.7   0.8   28   21-48    278-312 (596)
245 PTZ00267 NIMA-related protein   54.9     5.9 0.00013   32.3   0.9   29   19-47    293-328 (478)
246 PRK14380 hypothetical protein;  53.6     9.2  0.0002   26.0   1.6   22   31-57     58-79  (81)
247 PF05931 AgrD:  Staphylococcal   53.4     8.1 0.00018   23.7   1.2   14   15-28     30-43  (45)
248 KOG0662|consensus               52.6       7 0.00015   31.7   1.0   30   19-48    253-289 (292)
249 PF04823 Herpes_UL49_2:  Herpes  49.7      10 0.00022   26.8   1.3   22   17-38     64-87  (96)
250 cd05051 PTKc_DDR Catalytic dom  48.8     9.1  0.0002   27.7   1.0   24   17-40    261-291 (296)
251 KOG0590|consensus               48.5     7.4 0.00016   34.0   0.6   18   31-48    574-591 (601)
252 PF13170 DUF4003:  Protein of u  47.6     2.3   5E-05   34.0  -2.4   27   40-72    131-157 (297)
253 PF05250 UPF0193:  Uncharacteri  47.0      14  0.0003   29.0   1.9   56    1-57      3-62  (212)
254 KOG0669|consensus               46.7      11 0.00025   31.7   1.4   29   23-54    289-324 (376)
255 KOG0578|consensus               45.9      11 0.00023   33.6   1.2   27   19-45    493-526 (550)
256 smart00794 AgrD Staphylococcal  44.6      14  0.0003   22.8   1.2   15   15-29     30-44  (45)
257 cd05075 PTKc_Axl Catalytic dom  43.9      12 0.00026   26.6   1.1   27   16-42    234-267 (272)
258 KOG0661|consensus               43.5      14 0.00031   32.8   1.6   29   20-48    262-297 (538)
259 PF04558 tRNA_synt_1c_R1:  Glut  41.7     8.5 0.00018   28.6  -0.0   32   44-75     93-127 (164)
260 cd05097 PTKc_DDR_like Catalyti  41.5      17 0.00036   26.7   1.5   29   13-41    256-291 (295)
261 KOG0668|consensus               40.9      15 0.00032   30.7   1.2   17   31-47    311-327 (338)
262 PRK14371 hypothetical protein;  39.8      19 0.00042   24.4   1.5   22   31-57     51-72  (81)
263 KOG0590|consensus               39.5      18 0.00038   31.7   1.5   29   19-47    256-291 (601)
264 PF15142 INCA1:  INCA1           37.8      18 0.00038   27.9   1.2   41   23-64    106-147 (178)
265 PTZ00266 NIMA-related protein   36.9      18  0.0004   34.1   1.3   30   20-49    266-302 (1021)
266 PRK14391 hypothetical protein;  36.9      20 0.00044   24.5   1.2   21   31-56     51-71  (84)
267 KOG0593|consensus               34.7      19  0.0004   30.9   0.9   27   19-45    254-287 (396)
268 cd05036 PTKc_ALK_LTK Catalytic  34.5      20 0.00043   25.9   0.9   24   19-42    244-274 (277)
269 PRK14379 hypothetical protein;  34.4      25 0.00053   24.6   1.3   22   31-57     51-72  (95)
270 cd05035 PTKc_Axl_like Catalyti  34.3      19  0.0004   25.5   0.8   24   19-42    238-268 (273)
271 cd05049 PTKc_Trk Catalytic dom  32.6      28  0.0006   24.9   1.4   23   19-41    247-276 (280)
272 cd00192 PTKc Catalytic domain   31.8      26 0.00056   24.3   1.1   27   16-42    227-260 (262)
273 KOG1167|consensus               31.7      27 0.00059   30.2   1.4   23   24-46    356-385 (418)
274 TIGR00278 conserved hypothetic  31.6      34 0.00074   22.8   1.6   22   31-57     47-68  (75)
275 cd05096 PTKc_DDR1 Catalytic do  31.4      34 0.00073   25.2   1.7   27   14-40    266-299 (304)
276 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  31.3      30 0.00066   24.9   1.5   25   17-41    247-278 (284)
277 PRK14375 hypothetical protein;  30.8      31 0.00067   22.9   1.3   22   31-56     45-66  (70)
278 PLN02859 glutamine-tRNA ligase  29.8      16 0.00034   33.7  -0.3   33   43-75     94-129 (788)
279 cd05039 PTKc_Csk_like Catalyti  28.9      32 0.00069   24.3   1.2   23   19-41    222-251 (256)
280 PF07563 DUF1541:  Protein of u  28.8      16 0.00034   23.3  -0.4   11   37-47     43-53  (53)
281 cd06553 ASCH_Ef3133_like ASC-1  28.5      23 0.00051   25.4   0.5   27   12-38      3-31  (127)
282 KOG1151|consensus               27.7      40 0.00087   30.7   1.8   40    9-48    701-747 (775)
283 cd08229 STKc_Nek7 Catalytic do  27.6      29 0.00063   24.6   0.8   22   20-41    232-260 (267)
284 cd05148 PTKc_Srm_Brk Catalytic  26.9      41 0.00088   23.7   1.5   26   16-41    224-256 (261)
285 cd05116 PTKc_Syk Catalytic dom  26.5      34 0.00073   24.3   1.0   23   19-41    221-250 (257)
286 PF05920 Homeobox_KN:  Homeobox  26.3      16 0.00036   21.2  -0.5   19   44-62      1-19  (40)
287 PF07157 DNA_circ_N:  DNA circu  25.6      71  0.0015   21.9   2.4   39    5-45     48-86  (93)
288 PHA02988 hypothetical protein;  25.3      37 0.00081   25.1   1.1   23   19-41    245-274 (283)
289 cd05085 PTKc_Fer Catalytic dom  24.7      44 0.00094   23.4   1.3   26   16-41    214-246 (250)
290 PHA03381 tegument protein VP22  24.4      41 0.00088   27.7   1.2   22   17-38    221-244 (290)
291 cd05044 PTKc_c-ros Catalytic d  23.9      39 0.00084   24.0   0.9   24   18-41    235-265 (269)
292 cd05038 PTKc_Jak_rpt2 Catalyti  23.2      50  0.0011   23.4   1.3   24   18-41    248-278 (284)
293 KOG0658|consensus               23.0      46   0.001   28.3   1.3   28   19-46    276-310 (364)
294 cd05115 PTKc_Zap-70 Catalytic   22.9      45 0.00097   23.9   1.1   23   19-41    221-250 (257)
295 cd05033 PTKc_EphR Catalytic do  22.6      46   0.001   23.7   1.1   25   18-42    230-261 (266)
296 PHA03120 tegument protein VP22  22.1      46 0.00099   27.5   1.1   22   17-38    212-235 (310)
297 cd05089 PTKc_Tie1 Catalytic do  22.1      59  0.0013   23.8   1.6   23   20-42    242-271 (297)
298 cd05095 PTKc_DDR2 Catalytic do  21.8      63  0.0014   23.6   1.7   28   14-41    258-292 (296)
299 cd05077 PTK_Jak1_rpt1 Pseudoki  21.4      46 0.00099   24.0   0.9   22   21-42    232-260 (262)
300 KOG0600|consensus               21.4      74  0.0016   28.6   2.3   18   31-48    389-406 (560)
301 cd05053 PTKc_FGFR Catalytic do  21.0      46   0.001   24.1   0.8   24   19-42    257-287 (293)
302 cd05048 PTKc_Ror Catalytic Dom  20.2      47   0.001   23.8   0.7   24   19-42    249-279 (283)

No 1  
>KOG0585|consensus
Probab=99.76  E-value=1.4e-19  Score=154.39  Aligned_cols=84  Identities=33%  Similarity=0.529  Sum_probs=81.1

Q ss_pred             eecCCCCCChhHHHhhh-------hccccccccccCccccCCCCCcCCCcccCccceeeChhhhhcccccCCCh-----h
Q psy9108          14 YVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPTEEENCQLVTVSEDDVRNVIKNFPKL-----D   81 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~Eeenc~~vevteEEv~~avqsIp~L-----~   81 (98)
                      -.++.|++.+++||||.       ++|||+++||.|||+|++|..|++++.++|..|+|++||++++|..+|++     +
T Consensus       337 ~fP~~pe~~e~~kDli~~lL~KdP~~Ri~l~~ik~Hpwvt~~g~~~~~s~~~~c~~v~v~eeev~~sv~~i~~~~k~~~~  416 (576)
T KOG0585|consen  337 EFPENPEINEDLKDLIKRLLEKDPEQRITLPDIKLHPWVTRDGDSPQSSEPSSCSRVEVTEEEVNNSVSGIPSLKKEKSD  416 (576)
T ss_pred             cCCCcccccHHHHHHHHHHhhcChhheeehhhheecceeccCCCCCccCCcccceeeeeeccccccceeccchhhccccc
Confidence            35788999999999987       99999999999999999999999999999999999999999999999999     9


Q ss_pred             HHHHHHHHhhhcCCCC
Q psy9108          82 TLILIKTMLKNHSFQN   97 (98)
Q Consensus        82 tliliK~Mlk~~sf~n   97 (98)
                      |.+++++|.++.+|+|
T Consensus       417 t~~lvps~~r~~s~gn  432 (576)
T KOG0585|consen  417 TSILVPSMIRKESFGN  432 (576)
T ss_pred             cceeecccccccccCc
Confidence            9999999999999998


No 2  
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=97.24  E-value=0.00018  Score=53.04  Aligned_cols=33  Identities=21%  Similarity=0.220  Sum_probs=29.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAY   51 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~d   51 (98)
                      +.++++++|||+       .+|+|+.|+.+||||.+-|.+
T Consensus       256 ~~~~~~~~~li~~ml~~dp~~R~t~~eil~h~~f~~~~~~  295 (301)
T cd07873         256 PRLDSDGAELLSKLLQFEGRKRISAEEAMKHPYFHCLGER  295 (301)
T ss_pred             CCCCHHHHHHHHHHhcCCcccCcCHHHHhcCcccccccch
Confidence            568889999988       899999999999999888643


No 3  
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=96.94  E-value=0.00043  Score=50.99  Aligned_cols=28  Identities=25%  Similarity=0.291  Sum_probs=25.6

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .|.++++++|||+       .+|+|+.|+.+||||
T Consensus       254 ~~~~~~~~~dll~~mL~~dp~~R~t~~~~l~hp~f  288 (288)
T cd07871         254 APRLDTDGIDLLSSLLLYETKSRISAEAALRHSYF  288 (288)
T ss_pred             CCCCCHHHHHHHHHhcCcCcccCCCHHHHhcCCCC
Confidence            4678899999998       999999999999997


No 4  
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=96.73  E-value=0.0009  Score=49.64  Aligned_cols=33  Identities=21%  Similarity=0.259  Sum_probs=28.9

Q ss_pred             CCCCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      ..|.++++++|||+       ++|+|+.|++.||||..-+
T Consensus       254 ~~~~~~~~~~~li~~~L~~dp~~R~t~~e~l~h~~~~~~~  293 (309)
T cd07872         254 HAPRLDTEGIELLTKFLQYESKKRISAEEAMKHAYFRSLG  293 (309)
T ss_pred             hccCCCHHHHHHHHHhccCChhhCCCHHHHhcChhhhhcc
Confidence            44678999999988       8999999999999998754


No 5  
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=96.69  E-value=0.00098  Score=50.03  Aligned_cols=35  Identities=11%  Similarity=-0.039  Sum_probs=30.9

Q ss_pred             eecCCCCCChhHHHhhh------hccccccccccCccccCC
Q psy9108          14 YVTTQPANENRGKFLVR------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~------~kRITi~EIK~HPWVTkn   48 (98)
                      ..+++|.++++++||++      ++|||+.+|+.||||.+-
T Consensus       229 ~~~~~~~~~~~~~~li~~ll~~p~~R~t~~~l~~h~~~~~~  269 (330)
T cd05601         229 KFPEDPKVSSDFLDLIQSLLCGQKERLGYEGLCCHPFFSKI  269 (330)
T ss_pred             CCCCCCCCCHHHHHHHHHHccChhhCCCHHHHhCCCCcCCC
Confidence            45778889999999988      899999999999999863


No 6  
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=96.64  E-value=0.00097  Score=48.45  Aligned_cols=27  Identities=22%  Similarity=0.170  Sum_probs=24.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |++++.++||++       ++|+|+.|+.+||||
T Consensus       257 ~~~~~~~~~li~~~l~~~P~~R~s~~~~l~hp~f  290 (290)
T cd07862         257 TDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF  290 (290)
T ss_pred             cCCCHHHHHHHHHHhccCchhcCCHHHHhcCCCC
Confidence            568889999988       999999999999997


No 7  
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=96.59  E-value=0.0011  Score=47.97  Aligned_cols=27  Identities=26%  Similarity=0.249  Sum_probs=24.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.+++.++||+.       ++|+|+.|+..||||
T Consensus       255 ~~~~~~~~~li~~~L~~dP~~R~t~~~~l~hp~f  288 (288)
T cd07863         255 PEIEESGAQLLLEMLTFNPHKRISAFRALQHPFF  288 (288)
T ss_pred             cCcCHHHHHHHHHHhccCcccCCCHHHHhcCCCC
Confidence            578889999987       999999999999997


No 8  
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=96.55  E-value=0.0011  Score=48.01  Aligned_cols=26  Identities=8%  Similarity=-0.203  Sum_probs=23.9

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++++++|||+       ++|+|+.|+.+||||
T Consensus       255 ~~s~~~~dll~~~L~~~P~~R~s~~~~l~hp~f  287 (287)
T cd07848         255 ILSGVLLDLMKNLLKLNPTDRYLTEQCLNHPAF  287 (287)
T ss_pred             ccCHHHHHHHHHHccCCcccCCCHHHHhcCCCC
Confidence            37788999988       999999999999997


No 9  
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=96.50  E-value=0.0018  Score=48.02  Aligned_cols=31  Identities=10%  Similarity=-0.027  Sum_probs=26.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      |.++++++|||+       ++|+|+.|+..||||..-.
T Consensus       260 ~~~~~~~~~li~~~l~~~P~~Rpt~~e~l~hp~f~~~~  297 (338)
T cd07859         260 PNADPLALRLLERLLAFDPKDRPTAEEALADPYFKGLA  297 (338)
T ss_pred             CCCChHHHHHHHHHcCcCcccCCCHHHHhcCchhhhcC
Confidence            567888899988       9999999999999997643


No 10 
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=96.49  E-value=0.0014  Score=49.32  Aligned_cols=49  Identities=20%  Similarity=0.241  Sum_probs=36.6

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCCCCCcCCCcccCccc---eeeChhh
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPTEEENCQL---VTVSEDD   69 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~Eeenc~~---vevteEE   69 (98)
                      .|.++.++++|++       ++|+|+.|+..|||+.+-   -.|.+...|+.   +.+++||
T Consensus       261 ~~~~~~~~~~li~~~l~~~P~~R~t~~~ll~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~  319 (332)
T cd07857         261 FPNANPLALDLLEKLLAFDPTKRISVEEALEHPYLAIW---HDPDDEPVCQKPFDFSFESED  319 (332)
T ss_pred             CCCCCHHHHHHHHHHccCCcccCCCHHHHhcChhhhhh---cCccccccccccccCCccccc
Confidence            3556788999988       899999999999999654   24667777885   3344444


No 11 
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=96.49  E-value=0.0014  Score=47.11  Aligned_cols=28  Identities=18%  Similarity=0.234  Sum_probs=24.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCcccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      |.+++.+.||++       ++|+|+.++..||||+
T Consensus       252 ~~~~~~~~~li~~~l~~~p~~R~~~~~~l~h~~~~  286 (286)
T cd07832         252 PDASPEALDLLKGLLVYDPSKRLSAAEALRHPYFT  286 (286)
T ss_pred             CCccHHHHHHHHHHhccChhhCCCHHHHhhCcCcC
Confidence            456788899988       9999999999999996


No 12 
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=96.45  E-value=0.0015  Score=47.14  Aligned_cols=27  Identities=22%  Similarity=0.397  Sum_probs=24.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.++++++|||+       ++|+|+.||..||||
T Consensus       251 ~~~~~~~~~li~~~l~~~P~~R~t~~~il~h~~f  284 (284)
T cd07839         251 PKLNSTGRDLLQNLLVCNPVQRISAEEALQHPYF  284 (284)
T ss_pred             ccCCHHHHHHHHHHhcCChhhcCCHHHHhcCCCC
Confidence            457889999988       999999999999997


No 13 
>KOG0583|consensus
Probab=96.44  E-value=0.0016  Score=52.69  Aligned_cols=40  Identities=23%  Similarity=0.326  Sum_probs=31.2

Q ss_pred             eeeeeeeecCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108           8 IRLRKFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus         8 ~~~~~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |+-..|.+++.-. +.+.++|++       .+|||++||+.||||.+.
T Consensus       235 i~~~~~~~p~~~~-S~~~~~Li~~mL~~~P~~R~t~~~i~~h~w~~~~  281 (370)
T KOG0583|consen  235 IRKGEFKIPSYLL-SPEARSLIEKMLVPDPSTRITLLEILEHPWFQKE  281 (370)
T ss_pred             HhcCCccCCCCcC-CHHHHHHHHHHcCCCcccCCCHHHHhhChhhccC
Confidence            3334455554433 889999998       889999999999999994


No 14 
>KOG0588|consensus
Probab=96.44  E-value=0.0012  Score=59.32  Aligned_cols=35  Identities=14%  Similarity=0.164  Sum_probs=30.5

Q ss_pred             eeeecCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          12 KFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        12 ~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .|-.+  ..|+.+.+||||       ++|||++||.+|||+-+-
T Consensus       228 ~f~MP--s~Is~eaQdLLr~ml~VDp~~RiT~~eI~kHP~l~g~  269 (786)
T KOG0588|consen  228 VFEMP--SNISSEAQDLLRRMLDVDPSTRITTEEILKHPFLSGY  269 (786)
T ss_pred             cccCC--CcCCHHHHHHHHHHhccCccccccHHHHhhCchhhcC
Confidence            45555  578999999999       999999999999999876


No 15 
>KOG0604|consensus
Probab=96.36  E-value=0.0014  Score=55.09  Aligned_cols=31  Identities=19%  Similarity=0.323  Sum_probs=27.9

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      .|+++.|||||       ..|+||.|.+.|||++.-..
T Consensus       293 ~VSe~aKdlIR~LLkt~PteRlTI~~~m~hpwi~~~~~  330 (400)
T KOG0604|consen  293 CVSEAAKDLIRKLLKTEPTERLTIEEVMDHPWINQYEA  330 (400)
T ss_pred             HHHHHHHHHHHHHhcCCchhheeHHHhhcCchhccccc
Confidence            57889999999       99999999999999987754


No 16 
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=96.29  E-value=0.0021  Score=47.52  Aligned_cols=26  Identities=12%  Similarity=0.239  Sum_probs=22.6

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..++++.|||+       ++|+|+.|+.+||||
T Consensus       285 ~~~~~~~dli~~mL~~dP~~R~t~~e~l~hp~f  317 (317)
T cd07868         285 KPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYF  317 (317)
T ss_pred             CCChHHHHHHHHHhccCcccCCCHHHHhcCCCC
Confidence            34567888888       999999999999997


No 17 
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=96.26  E-value=0.0023  Score=46.06  Aligned_cols=27  Identities=19%  Similarity=0.185  Sum_probs=24.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.++++++|||+       ++|+|+.||++||||
T Consensus       252 ~~~~~~~~~li~~~l~~dP~~Rpt~~~ll~~~~~  285 (285)
T cd07861         252 KNLDEDGLDLLEKMLIYDPAKRISAKKALNHPYF  285 (285)
T ss_pred             CCCCHHHHHHHHHHhcCChhhCCCHHHHhcCCCC
Confidence            458889999998       999999999999997


No 18 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=96.21  E-value=0.0024  Score=47.21  Aligned_cols=28  Identities=14%  Similarity=0.090  Sum_probs=24.5

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++++||++       ++|+|+.|+.+||||..-
T Consensus       260 ~~~~~~dli~~mL~~dp~~R~s~~~~l~h~~f~~~  294 (303)
T cd07869         260 YVNHAEDLASKLLQCFPKNRLSAQAALSHEYFSDL  294 (303)
T ss_pred             CChHHHHHHHHHhccCchhccCHHHHhcCcccccC
Confidence            4577889988       999999999999999764


No 19 
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=96.21  E-value=0.0025  Score=46.04  Aligned_cols=27  Identities=22%  Similarity=0.325  Sum_probs=24.5

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.++++++|||+       ++|+|+.|+..||||
T Consensus       251 ~~~~~~~~~li~~~l~~~P~~Rpt~~~~l~~~~f  284 (284)
T cd07860         251 PPLDEDGRDLLSQMLHYDPNKRISAKAALAHPFF  284 (284)
T ss_pred             ccCCHHHHHHHHHhcCCCcccCCCHHHHhcCCCC
Confidence            568889999988       999999999999997


No 20 
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=96.13  E-value=0.0035  Score=46.39  Aligned_cols=28  Identities=18%  Similarity=0.100  Sum_probs=25.4

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +++.++|||+       ++|+|+.|+..||||.+.
T Consensus       262 ~~~~~~~li~~ml~~dp~~R~t~~~il~h~~f~~~  296 (309)
T cd07845         262 LSEAGLRLLNFLLMYDPKKRATAEEALESSYFKEK  296 (309)
T ss_pred             cCHHHHHHHHHHhcCChhhCcCHHHHhcChhhccC
Confidence            5788899987       899999999999999866


No 21 
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=96.05  E-value=0.0034  Score=46.15  Aligned_cols=26  Identities=8%  Similarity=0.149  Sum_probs=22.3

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..+..++|||+       .+|+|+.|+..||||
T Consensus       285 ~~~~~~~~ll~~~l~~dP~~R~t~~e~l~hp~f  317 (317)
T cd07867         285 KPDSKVFLLLQKLLTMDPTKRITSEQALQDPYF  317 (317)
T ss_pred             CCChHHHHHHHHHhccCcccccCHHHHhcCCCC
Confidence            34567888877       999999999999997


No 22 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=95.96  E-value=0.0035  Score=48.34  Aligned_cols=30  Identities=17%  Similarity=0.102  Sum_probs=25.8

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      ...++.++++||+       ++|+|+.|+.+||||++
T Consensus       320 ~~~~~~~~~~li~~mL~~dP~~Rpta~e~l~hp~f~~  356 (357)
T PHA03209        320 RVNLPIDGEFLVHKMLTFDAAMRPSAEEILNYPMFAQ  356 (357)
T ss_pred             ccCCCchHHHHHHHHHcCCcccCcCHHHHhcCchhcc
Confidence            3466778889987       99999999999999975


No 23 
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=95.90  E-value=0.0039  Score=44.71  Aligned_cols=27  Identities=22%  Similarity=0.267  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++++++||.       ++|+|+.||..||||
T Consensus       249 ~~~~~~~~~li~~~l~~~P~~R~~~~~~l~~~~~  282 (282)
T cd07831         249 PNASAEGLDLLKKLLAYDPDERITAKQALRHPYF  282 (282)
T ss_pred             ccccHHHHHHHHHHhccCcccccCHHHHhhCCCC
Confidence            456889999988       999999999999997


No 24 
>KOG0580|consensus
Probab=95.87  E-value=0.0023  Score=52.02  Aligned_cols=41  Identities=20%  Similarity=0.356  Sum_probs=35.3

Q ss_pred             eeeeeeecCCCCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108           9 RLRKFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus         9 ~~~~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      |++|.-.++-+.|+.+.+|||+       ..|.++.|++.|||+.+++
T Consensus       233 rI~k~~~~~p~~is~~a~dlI~~ll~~~p~~r~~l~~v~~hpwI~a~~  280 (281)
T KOG0580|consen  233 RIRKVDLKFPSTISGGAADLISRLLVKNPIERLALTEVMDHPWIVANG  280 (281)
T ss_pred             HHHHccccCCcccChhHHHHHHHHhccCccccccHHHHhhhHHHHhcC
Confidence            4555556666999999999988       8999999999999999885


No 25 
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=95.87  E-value=0.0058  Score=46.65  Aligned_cols=27  Identities=15%  Similarity=0.194  Sum_probs=24.0

Q ss_pred             CChhHHHhhh-------hccccccccccCccccC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      .+++++|||+       ++|+|+.|+..||||+.
T Consensus       287 ~~~~~~~li~~mL~~dP~~R~t~~e~l~hp~~~~  320 (359)
T cd07876         287 KTSQARDLLSKMLVIDPDKRISVDEALRHPYITV  320 (359)
T ss_pred             cchhHHHHHHHHhccCcccCCCHHHHhcCchhhh
Confidence            4578899988       99999999999999985


No 26 
>PTZ00284 protein kinase; Provisional
Probab=95.86  E-value=0.0058  Score=49.01  Aligned_cols=27  Identities=19%  Similarity=0.092  Sum_probs=24.0

Q ss_pred             ChhHHHhhh-------hccccccccccCccccCC
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ++.|.|||+       ++|+|+.|+..||||.+.
T Consensus       411 ~~~~~dli~~mL~~dP~~R~ta~e~L~Hp~~~~~  444 (467)
T PTZ00284        411 DDLLCDLIYGLLHYDRQKRLNARQMTTHPYVLKY  444 (467)
T ss_pred             hHHHHHHHHHhCCcChhhCCCHHHHhcCcccccc
Confidence            467889988       999999999999999874


No 27 
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=95.81  E-value=0.0062  Score=44.22  Aligned_cols=34  Identities=12%  Similarity=0.023  Sum_probs=29.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYA   52 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dp   52 (98)
                      ..++++++|||+       ++|.|+.+|..|||+..+...|
T Consensus       232 ~~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~~~~~~~~  272 (282)
T cd06643         232 SRWSSEFKDFLKKCLEKNVDARWTTTQLLQHPFVTVNSNKP  272 (282)
T ss_pred             cccCHHHHHHHHHHccCChhhCcCHHHHhcCCCEeccCCCC
Confidence            357889999988       9999999999999999985543


No 28 
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=95.80  E-value=0.0046  Score=44.55  Aligned_cols=28  Identities=11%  Similarity=-0.076  Sum_probs=25.5

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .|.++++++||++       ++|+|+.||..||||
T Consensus       252 ~~~~~~~~~~li~~~l~~~P~~Rp~~~~il~~~~~  286 (286)
T cd07846         252 FPKLSGLVLDLAKQCLRIDPDDRPSSSQLLHHEFF  286 (286)
T ss_pred             CCCcCHHHHHHHHHHhcCCcccchhHHHHhcCCCC
Confidence            3578899999988       999999999999997


No 29 
>KOG0032|consensus
Probab=95.73  E-value=0.0068  Score=49.67  Aligned_cols=35  Identities=17%  Similarity=0.255  Sum_probs=31.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYAL   53 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpL   53 (98)
                      +++++.+||+++       .+|+|..+...|||+...+..+.
T Consensus       263 ~~is~~akd~i~~ll~~dp~~R~ta~~~L~HpWi~~~~~~~~  304 (382)
T KOG0032|consen  263 DDISESAKDFIRKLLEFDPRKRLTAAQALQHPWIKSIGEATN  304 (382)
T ss_pred             cccCHHHHHHHHHhcccCcccCCCHHHHhcCccccCCccccc
Confidence            578899999999       99999999999999999876654


No 30 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=95.69  E-value=0.0066  Score=46.18  Aligned_cols=30  Identities=17%  Similarity=0.128  Sum_probs=26.7

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |.++++++|||+       ++|+|+.|+..||||..-
T Consensus       267 ~~~~~~~~~li~~~l~~dP~~R~~~~e~l~h~~f~~~  303 (342)
T cd07879         267 PKASPQAVDLLEKMLELDVDKRLTATEALEHPYFDSF  303 (342)
T ss_pred             cCCCHHHHHHHHHHcCCChhhCcCHHHHhcCcchhhc
Confidence            567888999988       899999999999999776


No 31 
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=95.69  E-value=0.0058  Score=43.89  Aligned_cols=27  Identities=11%  Similarity=0.182  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++.+.||+.       ++|+|+.||..||||
T Consensus       253 ~~~~~~~~~li~~~l~~~p~~Rp~~~eil~~~~f  286 (286)
T cd07847         253 PNISSPALSFLKGCLQMDPTERLSCEELLEHPYF  286 (286)
T ss_pred             ccCCHHHHHHHHHHhcCCccccCCHHHHhcCCCC
Confidence            457788999987       999999999999997


No 32 
>KOG0033|consensus
Probab=95.62  E-value=0.0056  Score=50.70  Aligned_cols=30  Identities=23%  Similarity=0.358  Sum_probs=27.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |-|+++.|||+|       .+|||..|-.+|||+-..
T Consensus       237 ~~is~~Ak~LvrrML~~dP~kRIta~EAL~HpWi~~r  273 (355)
T KOG0033|consen  237 DTVTPEAKSLIRRMLTVNPKKRITADEALKHPWICNR  273 (355)
T ss_pred             CcCCHHHHHHHHHHhccChhhhccHHHHhCCchhcch
Confidence            568999999999       999999999999999776


No 33 
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=95.58  E-value=0.007  Score=43.68  Aligned_cols=28  Identities=21%  Similarity=0.281  Sum_probs=25.1

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .|.+++++.||++       ++|+|+.||..||||
T Consensus       249 ~~~~~~~~~~li~~~l~~~P~~Rpt~~~il~~~~~  283 (283)
T cd07835         249 VPNLDEDGLDLLSKMLVYDPAKRISAKAALQHPYF  283 (283)
T ss_pred             cCCCCHHHHHHHHHHhcCChhhCcCHHHHhcCCCC
Confidence            4677889999988       999999999999997


No 34 
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=95.57  E-value=0.0055  Score=44.09  Aligned_cols=33  Identities=6%  Similarity=-0.180  Sum_probs=28.9

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCCCc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYA   52 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dp   52 (98)
                      .+++++++|++       +.|+|+.+|.+||||.+.+...
T Consensus       232 ~~~~~l~~li~~~l~~~p~~Rp~~~~il~~~~~~~~~~~~  271 (283)
T cd06617         232 KFSPEFQDFVNKCLKKNYKERPNYPELLQHPFFELHLSKN  271 (283)
T ss_pred             ccCHHHHHHHHHHccCChhhCcCHHHHhcCchhhhccccc
Confidence            46789999987       9999999999999999986553


No 35 
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=95.55  E-value=0.0073  Score=43.19  Aligned_cols=27  Identities=4%  Similarity=0.015  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.++.+++|||+       .+|.|+.||..||||
T Consensus       239 ~~~~~~~~~li~~~l~~~p~~Rpt~~~il~~~~~  272 (272)
T cd06637         239 KKWSKKFQSFIESCLVKNHSQRPTTEQLMKHPFI  272 (272)
T ss_pred             CCcCHHHHHHHHHHcCCChhhCCCHHHHhhCCCC
Confidence            356789999988       899999999999997


No 36 
>KOG0603|consensus
Probab=95.50  E-value=0.0082  Score=53.08  Aligned_cols=35  Identities=14%  Similarity=0.273  Sum_probs=31.7

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYAL   53 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpL   53 (98)
                      -.|++..|||++       .+|.|+.||..|||++.+++.|.
T Consensus       533 ~~vS~~AKdLl~~LL~~dP~~Rl~~~~i~~h~w~~~~~t~p~  574 (612)
T KOG0603|consen  533 ECVSDEAKDLLQQLLQVDPALRLGADEIGAHPWFLSHPTFPP  574 (612)
T ss_pred             cccCHHHHHHHHHhccCChhhCcChhhhccCcchhcCCCCCc
Confidence            568999999999       99999999999999988888665


No 37 
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=95.49  E-value=0.0067  Score=45.93  Aligned_cols=30  Identities=13%  Similarity=0.106  Sum_probs=26.7

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      .|.++++++|||+       ++|+|+.|+..||||-.
T Consensus       260 ~~~~~~~~~~li~~~l~~~P~~Rps~~ell~h~~~~~  296 (337)
T cd07858         260 FPHANPLAIDLLEKMLVFDPSKRITVEEALAHPYLAS  296 (337)
T ss_pred             cccCCHHHHHHHHHHhcCChhhccCHHHHHcCcchhh
Confidence            4678899999988       89999999999999964


No 38 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=95.48  E-value=0.008  Score=45.93  Aligned_cols=31  Identities=6%  Similarity=0.089  Sum_probs=27.7

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+.+++++++||+       ++|+|+.||..||||.+.
T Consensus       297 ~~~~~~~l~~li~~~l~~~P~~Rpt~~ell~hp~~~~~  334 (353)
T PLN00034        297 PATASREFRHFISCCLQREPAKRWSAMQLLQHPFILRA  334 (353)
T ss_pred             CCccCHHHHHHHHHHccCChhhCcCHHHHhcCcccccC
Confidence            3467789999988       999999999999999997


No 39 
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=95.42  E-value=0.0079  Score=42.50  Aligned_cols=26  Identities=8%  Similarity=-0.010  Sum_probs=24.0

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++.++||++       ++|.|+.||..||||
T Consensus       235 ~~~~~~~~li~~~l~~~p~~Rp~~~~ll~~p~~  267 (267)
T cd06610         235 KYSKSFRKMISLCLQKDPSKRPTAEELLKHKFF  267 (267)
T ss_pred             cccHHHHHHHHHHcCCChhhCcCHHHHhhCCCC
Confidence            67788999988       999999999999997


No 40 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=95.42  E-value=0.008  Score=46.25  Aligned_cols=30  Identities=13%  Similarity=0.140  Sum_probs=26.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +..++++.|||+       ++|+|+.|+..||||...
T Consensus       258 ~~~~~~~~~li~~mL~~dP~~R~t~~e~l~hp~~~~~  294 (372)
T cd07853         258 SQATHEAVHLLCRMLVFDPDKRISAADALAHPYLDEG  294 (372)
T ss_pred             CCCCHHHHHHHHHhCCCChhhCcCHHHHhcCHhhCCC
Confidence            346788999988       999999999999999874


No 41 
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=95.40  E-value=0.0075  Score=43.42  Aligned_cols=27  Identities=26%  Similarity=0.405  Sum_probs=23.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.++.+++++++       ++|+|+.||.+||||
T Consensus       251 ~~~~~~~~~~i~~~l~~~p~~R~~~~~~l~~~~f  284 (284)
T cd07836         251 PHADPLGIDLLHRLLQLNPELRISAHDALQHPWF  284 (284)
T ss_pred             hhcCcHHHHHHHHHhcCCcccCCCHHHHhcCCCC
Confidence            456788888887       999999999999997


No 42 
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=95.35  E-value=0.0093  Score=42.80  Aligned_cols=27  Identities=7%  Similarity=-0.111  Sum_probs=24.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++.++||+.       +.|+|+.+|..|||+
T Consensus       239 ~~~~~~~~~li~~~l~~~p~~Rps~~~il~~~~~  272 (272)
T cd06629         239 MNLSPVALDFLNACFTINPDNRPTARELLQHPFI  272 (272)
T ss_pred             ccCCHHHHHHHHHHhcCChhhCCCHHHHhhCCCC
Confidence            567889999988       999999999999997


No 43 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=95.34  E-value=0.0088  Score=47.47  Aligned_cols=35  Identities=9%  Similarity=-0.060  Sum_probs=27.4

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCCCcCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPT   55 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~   55 (98)
                      .++.++++||+       ++|+|..|+..||||..- .+|.|+
T Consensus       347 ~~~~~l~~Li~~mL~~dP~~Rpta~elL~hp~f~~~-~~~~~~  388 (391)
T PHA03212        347 ELPIDLEYLICKMLAFDAHHRPSAEALLDFAAFQDI-PDPYPN  388 (391)
T ss_pred             hhhhhHHHHHHHHhcCChhhCCCHHHHhcChhhccC-CCCCCC
Confidence            45678889888       999999999999999653 444443


No 44 
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=95.33  E-value=0.011  Score=41.76  Aligned_cols=29  Identities=7%  Similarity=-0.016  Sum_probs=25.8

Q ss_pred             CCCCCChhHHHhhh-------hccccccccccCccc
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..|.++++++++++       ++|+|+.||..||||
T Consensus       222 ~~~~~~~~~~~~i~~~l~~~p~~Rpt~~~ll~~~~~  257 (257)
T cd08225         222 ISPNFSRDLRSLISQLFKVSPRDRPSITSILKRPFL  257 (257)
T ss_pred             CCCCCCHHHHHHHHHHhccChhhCcCHHHHhhCCCC
Confidence            45678889999988       899999999999997


No 45 
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=95.32  E-value=0.0079  Score=43.30  Aligned_cols=27  Identities=7%  Similarity=-0.018  Sum_probs=24.0

Q ss_pred             CCChhHHHhhh------hccccccccccCcccc
Q psy9108          20 ANENRGKFLVR------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        20 ~i~~~~kdL~~------~kRITi~EIK~HPWVT   46 (98)
                      .+++.+++|++      ++|+|+.||..||||-
T Consensus       233 ~~~~~~~~li~~~~~~p~~Rp~~~eil~hp~~~  265 (266)
T cd06651         233 HISEHARDFLGCIFVEARHRPSAEELLRHPFAQ  265 (266)
T ss_pred             hcCHHHHHHHHHhcCChhhCcCHHHHhcCcccc
Confidence            45778899988      9999999999999984


No 46 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=95.29  E-value=0.011  Score=45.94  Aligned_cols=34  Identities=15%  Similarity=0.140  Sum_probs=28.5

Q ss_pred             ecCCCCCChhHHHhhh-------hc--cccccccccCccccCC
Q psy9108          15 VTTQPANENRGKFLVR-------IV--AIKAGVHKEHSWVTKD   48 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~-------~k--RITi~EIK~HPWVTkn   48 (98)
                      .++.+.++++++|||+       ++  |.|+.||+.||||...
T Consensus       268 ~~~~~~~s~~~~~li~~~L~~~p~r~~R~s~~ell~h~~~~~~  310 (370)
T cd05596         268 FPDDIEISKQAKDLICAFLTDREVRLGRNGVDEIKSHPFFKND  310 (370)
T ss_pred             CCCcCCCCHHHHHHHHHHccChhhccCCCCHHHHhcCcccCCC
Confidence            4566778999999988       33  9999999999999763


No 47 
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.28  E-value=0.0081  Score=42.66  Aligned_cols=28  Identities=14%  Similarity=-0.069  Sum_probs=25.1

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ++++++++|+       ++|.|+.||..||||++-
T Consensus       229 ~~~~~~~li~~~l~~~p~~Rpt~~~ll~~~~~~~~  263 (265)
T cd06605         229 FSPDFQDFVNLCLIKDPRERPSYKELLEHPFIKKY  263 (265)
T ss_pred             cCHHHHHHHHHHcCCCchhCcCHHHHhhCchhhcc
Confidence            6778999988       999999999999999764


No 48 
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=95.22  E-value=0.017  Score=44.02  Aligned_cols=32  Identities=13%  Similarity=0.046  Sum_probs=27.4

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      +.++++++|||+       ++|+|+.||+.||||-+-+.
T Consensus       268 ~~~s~~l~dli~~~l~~~P~~Rpt~~ell~h~~~~~~~~  306 (343)
T cd07851         268 SGANPLAIDLLEKMLVLDPDKRITAAEALAHPYLAEYHD  306 (343)
T ss_pred             ccCCHHHHHHHHHhCCCChhhCCCHHHHhcCCCccccCC
Confidence            345888999988       89999999999999987643


No 49 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=95.22  E-value=0.014  Score=44.01  Aligned_cols=28  Identities=14%  Similarity=0.055  Sum_probs=24.2

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .++.+.||+.       ++|+|+.|+..||||.+-
T Consensus       270 ~~~~~~~li~~mL~~dp~~R~s~~ell~hp~~~~~  304 (343)
T cd07878         270 ANPLAIDLLEKMLVLDSDKRISASEALAHPYFSQY  304 (343)
T ss_pred             CCHHHHHHHHHHcCCChhhCCCHHHHhcCcchhcc
Confidence            4567788877       899999999999999875


No 50 
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=95.20  E-value=0.011  Score=44.95  Aligned_cols=30  Identities=10%  Similarity=0.103  Sum_probs=26.5

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |.++.+++||++       ++|+|+.|+..||||.+-
T Consensus       270 ~~~~~~~~~li~~~L~~dP~~R~t~~ell~h~~~~~~  306 (342)
T cd07854         270 PGVNPEALDFLEQILTFNPMDRLTAEEALMHPYMSCY  306 (342)
T ss_pred             cCCCHHHHHHHHHHhCCCchhccCHHHHhCCCccccc
Confidence            468889999988       899999999999999753


No 51 
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=95.20  E-value=0.011  Score=43.06  Aligned_cols=26  Identities=19%  Similarity=0.156  Sum_probs=22.1

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++++.|+++       ++|+|+.|+..||||
T Consensus       279 ~~~~~~~~~i~~~l~~~p~~R~t~~ell~~~~f  311 (311)
T cd07866         279 KLGPEGLDLLSKLLSLDPYKRLTASDALEHPYF  311 (311)
T ss_pred             cCChhHHHHHHHHcccCcccCcCHHHHhcCCCC
Confidence            34467788877       899999999999997


No 52 
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=95.20  E-value=0.0085  Score=43.74  Aligned_cols=35  Identities=26%  Similarity=0.244  Sum_probs=29.6

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCCCCCc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYA   52 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dp   52 (98)
                      .|.++++++++++       ++|.++.|+.+||||..-|..|
T Consensus       253 ~~~~~~~~~~~i~~~l~~~P~~Rps~~~~l~~~~~~~~~~~~  294 (294)
T PLN00009        253 VPTLEPAGVDLLSKMLRLDPSKRITARAALEHEYFKDLGDAP  294 (294)
T ss_pred             CcCCChHHHHHHHHHccCChhhCcCHHHHhcCchHhHHhcCC
Confidence            3678889999987       8999999999999998876543


No 53 
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=95.18  E-value=0.01  Score=45.17  Aligned_cols=28  Identities=11%  Similarity=0.154  Sum_probs=24.1

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++++|||+       ++|+|+.||..|||+..-
T Consensus       283 ~~~~~~~li~~mL~~dP~~Rps~~ell~hp~~~~~  317 (355)
T cd07874         283 KASQARDLLSKMLVIDPAKRISVDEALQHPYINVW  317 (355)
T ss_pred             cchHHHHHHHHHhcCCchhcCCHHHHhcCcchhcc
Confidence            4567889988       999999999999999644


No 54 
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=95.14  E-value=0.016  Score=42.27  Aligned_cols=32  Identities=28%  Similarity=0.324  Sum_probs=27.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      +.+++++.+|++       ++|.|+.|+..||||.+++.
T Consensus       252 ~~~~~~~~~li~~~l~~~P~~R~s~~e~l~~~~~~~~~~  290 (298)
T cd07841         252 PAASDDALDLLQRLLTLNPNKRITARQALEHPYFSNDPA  290 (298)
T ss_pred             ccccHHHHHHHHHHhcCCcccCcCHHHHhhCccccCCCC
Confidence            345678888887       99999999999999999843


No 55 
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=95.14  E-value=0.011  Score=42.53  Aligned_cols=30  Identities=17%  Similarity=-0.003  Sum_probs=26.5

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      +++++.|+++       ++|+|+.+|..||||.+...
T Consensus       223 ~~~~~~~~l~~~l~~~p~~Rpt~~~il~~~~~~~~~~  259 (274)
T cd06609         223 FSKPFKDFVSLCLNKDPKERPSAKELLKHKFIKKAKK  259 (274)
T ss_pred             cCHHHHHHHHHHhhCChhhCcCHHHHhhChhhcCCCc
Confidence            6788999988       89999999999999998843


No 56 
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=95.13  E-value=0.011  Score=42.87  Aligned_cols=27  Identities=22%  Similarity=0.265  Sum_probs=24.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.+++.+++||.       ++|.|+.||..|||+
T Consensus       261 ~~~~~~~~~~i~~~l~~~P~~R~~~~eil~~~~~  294 (295)
T cd07837         261 PDLSPEGLDLLQKMLRYDPAKRISAKAALTHPYF  294 (295)
T ss_pred             cccCHHHHHHHHHHccCChhhcCCHHHHhcCCCc
Confidence            678899999988       899999999999997


No 57 
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=95.12  E-value=0.012  Score=42.97  Aligned_cols=27  Identities=7%  Similarity=0.076  Sum_probs=23.9

Q ss_pred             CCChhHHHhhh-------hcccc-ccccccCcccc
Q psy9108          20 ANENRGKFLVR-------IVAIK-AGVHKEHSWVT   46 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRIT-i~EIK~HPWVT   46 (98)
                      .+++.+++||+       .+|+| +.||++||||-
T Consensus       232 ~~~~~~~~li~~~l~~~p~~R~~~~~~~l~h~~~~  266 (267)
T PHA03390        232 NVSKNANDFVQSMLKYNINYRLTNYNEIIKHPFLK  266 (267)
T ss_pred             ccCHHHHHHHHHHhccChhhCCchHHHHhcCCccc
Confidence            57889999988       89995 79999999984


No 58 
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=95.11  E-value=0.01  Score=43.04  Aligned_cols=32  Identities=16%  Similarity=0.146  Sum_probs=27.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      +.+++++++||+       ++|+|+.+|.+|||+.+.+.
T Consensus       232 ~~~~~~~~~li~~~l~~~p~~Rp~~~~l~~~~~~~~~~~  270 (286)
T cd06622         232 SGYSDDAQDFVAKCLNKIPNRRPTYAQLLEHPWLVKYKN  270 (286)
T ss_pred             cccCHHHHHHHHHHcccCcccCCCHHHHhcChhhhhccC
Confidence            347888999988       99999999999999988853


No 59 
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=95.08  E-value=0.011  Score=42.14  Aligned_cols=27  Identities=22%  Similarity=0.262  Sum_probs=24.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.++.+++|+++       ++|.|+.++..||||
T Consensus       249 ~~~~~~~~~~i~~~l~~~P~~Rp~~~~~l~~p~~  282 (282)
T cd07829         249 PRLDPEGIDLLSKMLQYNPAKRISAKEALKHPYF  282 (282)
T ss_pred             ccccHHHHHHHHHhhccCcccCCCHHHHhhCcCC
Confidence            456788899888       999999999999997


No 60 
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=95.08  E-value=0.014  Score=41.36  Aligned_cols=30  Identities=17%  Similarity=0.096  Sum_probs=25.1

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccCccc
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ++...+++.+++|++       ++|+|++||..|||+
T Consensus       228 ~~~~~~~~~~~~li~~~l~~~p~~R~~~~~i~~~~~~  264 (264)
T cd06626         228 PDSLQLSPEGKDFLDRCLESDPKKRPTASELLQHPFV  264 (264)
T ss_pred             CcccccCHHHHHHHHHHccCCcccCCCHHHHhcCCCC
Confidence            344456788899988       889999999999996


No 61 
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=95.07  E-value=0.011  Score=42.86  Aligned_cols=24  Identities=17%  Similarity=0.213  Sum_probs=21.6

Q ss_pred             ChhHHHhhh-------hccccccccccCccc
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ++.++|||+       ++|+|+.|+..||||
T Consensus       280 ~~~~~dli~~~l~~~P~~R~t~~e~l~h~~f  310 (310)
T cd07865         280 DPHALDLIDKLLVLDPAKRIDADTALNHDFF  310 (310)
T ss_pred             CHHHHHHHHHHhcCChhhccCHHHHhcCCCC
Confidence            467788988       999999999999997


No 62 
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=95.04  E-value=0.012  Score=42.10  Aligned_cols=27  Identities=15%  Similarity=0.144  Sum_probs=23.7

Q ss_pred             CCCChhHHHhhh-------hccccc-----cccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKA-----GVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi-----~EIK~HPWV   45 (98)
                      +.+++++++||+       ++|+|.     .|++.||||
T Consensus       199 ~~~~~~~~~li~~~l~~dp~~R~~~~~~~~~~~~~h~~~  237 (237)
T cd05576         199 EWVSEEARSLLQQLLQFNPTERLGAGVAGVEDIKSHPFF  237 (237)
T ss_pred             ccCCHHHHHHHHHHccCCHHHhcCCCccchHHHHcCCCC
Confidence            457888999988       899985     999999997


No 63 
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=95.03  E-value=0.019  Score=43.02  Aligned_cols=32  Identities=19%  Similarity=0.261  Sum_probs=26.7

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      +..++++.||++       ++|+|+.|+..||||..+..
T Consensus       283 ~~~~~~~~~li~~~l~~~P~~R~s~~~~l~~~~~~~~~~  321 (335)
T PTZ00024        283 PNASDDAIDLLQSLLKLNPLERISAKEALKHEYFKSDPL  321 (335)
T ss_pred             cCCChHHHHHHHHHcCCCchhccCHHHHhcCcccCCCCC
Confidence            345778888877       99999999999999987743


No 64 
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=95.02  E-value=0.015  Score=41.64  Aligned_cols=27  Identities=11%  Similarity=-0.080  Sum_probs=23.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.++++++++++       ++|+|+.|+..||||
T Consensus       232 ~~~~~~~~~~i~~~l~~~p~~Rp~~~~~l~~~~~  265 (265)
T cd06631         232 DSFSAAAIDFVTSCLTRDQHERPSALQLLRHDFL  265 (265)
T ss_pred             CCCCHHHHHHHHHHhcCCcccCCCHHHHhcCCCC
Confidence            346788999988       999999999999997


No 65 
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=94.94  E-value=0.021  Score=43.08  Aligned_cols=31  Identities=13%  Similarity=0.158  Sum_probs=27.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      |.+++++.|||+       ++|+|+.|+.+||||-.-.
T Consensus       262 ~~~~~~~~~li~~~l~~dP~~Rpt~~e~l~hp~~~~~~  299 (336)
T cd07849         262 PNADPKALDLLDKMLTFNPHKRITVEEALAHPYLEQYH  299 (336)
T ss_pred             cccCcHHHHHHHHHcCCChhhCcCHHHHhcCccccccC
Confidence            567888999988       8999999999999998663


No 66 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=94.90  E-value=0.022  Score=45.89  Aligned_cols=51  Identities=6%  Similarity=0.121  Sum_probs=33.4

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCC--CCcCCCcccCcc-ceeeChhhh
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG--AYALPTEEENCQ-LVTVSEDDV   70 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG--~dpLP~Eeenc~-~vevteEEv   70 (98)
                      ..+++++|||+       .+|+|..|+..||||..-.  ...+|.....+. +...+++|.
T Consensus       322 ~~~~~~~~li~~~L~~dP~~R~ta~e~l~hp~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~  382 (440)
T PTZ00036        322 GTPDDAINFISQFLKYEPLKRLNPIEALADPFFDDLRDPCIKLPKYIDKLPDLFNFCDAEI  382 (440)
T ss_pred             CCCHHHHHHHHHHCCCChhHCcCHHHHhCChhHHhhhcccccCCCCCCCCCCCcCCCHHHH
Confidence            36778999988       9999999999999996432  223444334444 233444444


No 67 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=94.87  E-value=0.02  Score=43.85  Aligned_cols=33  Identities=15%  Similarity=0.108  Sum_probs=27.1

Q ss_pred             ecCCCCCChhHHHhhh------hccc---cccccccCccccC
Q psy9108          15 VTTQPANENRGKFLVR------IVAI---KAGVHKEHSWVTK   47 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~------~kRI---Ti~EIK~HPWVTk   47 (98)
                      .+.+..++++++||+.      ++|+   ++.||+.||||..
T Consensus       257 ~p~~~~~s~~~~~li~~l~~~p~~R~~~~~~~ei~~hp~f~~  298 (360)
T cd05627         257 FPPEVPISEKAKDLILRFCTDSENRIGSNGVEEIKSHPFFEG  298 (360)
T ss_pred             cCCCCCCCHHHHHHHHHhccChhhcCCCCCHHHHhcCCCCCC
Confidence            4555568999999986      7788   5899999999975


No 68 
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=94.86  E-value=0.014  Score=42.59  Aligned_cols=25  Identities=20%  Similarity=0.178  Sum_probs=22.9

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +++.++|||+       ++|+|+.|+..||||
T Consensus       262 ~~~~~~~li~~~l~~~p~~R~t~~ell~~~~f  293 (293)
T cd07843         262 LSDNGFDLLNRLLTYDPAKRISAEDALKHPYF  293 (293)
T ss_pred             CChHHHHHHHHHhccCccccCCHHHHhcCCCC
Confidence            5888899988       999999999999997


No 69 
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=94.85  E-value=0.014  Score=41.06  Aligned_cols=27  Identities=11%  Similarity=-0.072  Sum_probs=23.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++++.+++.       ++|+|+.||..||||
T Consensus       223 ~~~~~~~~~~i~~~l~~~P~~Rps~~~il~~~~~  256 (256)
T cd06612         223 EKWSPEFNDFVKKCLVKDPEERPSAIQLLQHPFI  256 (256)
T ss_pred             hhcCHHHHHHHHHHHhcChhhCcCHHHHhcCCCC
Confidence            456788999987       899999999999997


No 70 
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=94.85  E-value=0.015  Score=41.05  Aligned_cols=27  Identities=4%  Similarity=-0.122  Sum_probs=24.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++++.||++       +.|+|+.||..||||
T Consensus       224 ~~~~~~~~~li~~~l~~~p~~Rp~~~~~l~~~~~  257 (257)
T cd08223         224 KDYSPELGELIATMLSKRPEKRPSVKSILRQPYI  257 (257)
T ss_pred             cccCHHHHHHHHHHhccCcccCCCHHHHhcCCCC
Confidence            457788999988       999999999999997


No 71 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=94.75  E-value=0.018  Score=45.10  Aligned_cols=36  Identities=14%  Similarity=0.140  Sum_probs=29.0

Q ss_pred             eeecCCCCCChhHHHhhh---------hccccccccccCccccCC
Q psy9108          13 FYVTTQPANENRGKFLVR---------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~---------~kRITi~EIK~HPWVTkn   48 (98)
                      +..+++..+++.+++|+.         ..|+|+.|+++||||...
T Consensus       266 ~~~p~~~~~s~~~~~li~~~L~~~~~r~~R~~~~e~l~hp~~~~~  310 (370)
T cd05621         266 LNFPEDVEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKND  310 (370)
T ss_pred             cCCCCcccCCHHHHHHHHHHccCchhccCCCCHHHHhcCcccCCC
Confidence            445666678999999987         238899999999999864


No 72 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=94.74  E-value=0.019  Score=44.55  Aligned_cols=34  Identities=15%  Similarity=0.080  Sum_probs=27.7

Q ss_pred             eecCCCCCChhHHHhhh---------hccccccccccCccccC
Q psy9108          14 YVTTQPANENRGKFLVR---------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~---------~kRITi~EIK~HPWVTk   47 (98)
                      ..+....++++++|||.         ..|+|+.||+.||||+.
T Consensus       268 ~~~~~~~~s~~~~dli~~ll~~~~~~~~R~~~~~~l~hp~f~~  310 (381)
T cd05626         268 HIPPQVKLSPEAVDLITKLCCSAEERLGRNGADDIKAHPFFSE  310 (381)
T ss_pred             CCCCCCCCCHHHHHHHHHHccCcccccCCCCHHHHhcCcccCC
Confidence            34455568999999986         34999999999999975


No 73 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=94.71  E-value=0.016  Score=40.74  Aligned_cols=23  Identities=17%  Similarity=0.222  Sum_probs=20.9

Q ss_pred             hhHHHhhh-------hccccccccccCccc
Q psy9108          23 NRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        23 ~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..+.+||+       ++|+|+.++.+||||
T Consensus       231 ~~l~~li~~~l~~~p~~R~~~~~l~~~~~~  260 (260)
T PF00069_consen  231 EELRDLIKKMLSKDPEQRPSAEELLKHPWF  260 (260)
T ss_dssp             HHHHHHHHHHSSSSGGGSTTHHHHHTSGGG
T ss_pred             HHHHHHHHHHccCChhHCcCHHHHhcCCCC
Confidence            67788877       999999999999997


No 74 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=94.68  E-value=0.014  Score=44.15  Aligned_cols=29  Identities=7%  Similarity=0.055  Sum_probs=25.8

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..++++++||+       ++|.|+.||..|||+...
T Consensus       272 ~~~~~l~~li~~~L~~~P~~Rpt~~ell~h~~~~~~  307 (331)
T cd06649         272 VFTPDFQEFVNKCLIKNPAERADLKMLMNHTFIKRS  307 (331)
T ss_pred             cccHHHHHHHHHHccCCcccCCCHHHHhcChHHhhc
Confidence            36789999988       999999999999999764


No 75 
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=94.67  E-value=0.018  Score=42.13  Aligned_cols=26  Identities=27%  Similarity=0.326  Sum_probs=22.6

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..+.++.|+++       ++|+|+.||..||||
T Consensus       284 ~~~~~~~~~i~~~l~~~P~~Rps~~eil~~~~f  316 (316)
T cd07842         284 KPDSQGFDLLRKLLEYDPTKRITAEEALEHPYF  316 (316)
T ss_pred             CCCHHHHHHHHHHhcCCcccCcCHHHHhcCCCC
Confidence            45667888877       999999999999997


No 76 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=94.67  E-value=0.022  Score=42.76  Aligned_cols=35  Identities=11%  Similarity=0.063  Sum_probs=30.1

Q ss_pred             eeecCCCCCChhHHHhhh------hcccc-ccccccCccccC
Q psy9108          13 FYVTTQPANENRGKFLVR------IVAIK-AGVHKEHSWVTK   47 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~------~kRIT-i~EIK~HPWVTk   47 (98)
                      +..+..+.+++++++||+      ++|++ +.||..||||..
T Consensus       249 ~~~p~~~~~~~~~~~li~~ll~dp~~R~~s~~~ll~hp~~~~  290 (350)
T cd05573         249 LRFPPDPPVSPEAIDLICRLLCDPEDRLGSFEEIKSHPFFKG  290 (350)
T ss_pred             ccCCCCCCCCHHHHHHHHHHccChhhcCCCHHHHhcCCCcCC
Confidence            456666778999999988      99999 999999999975


No 77 
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=94.65  E-value=0.018  Score=41.33  Aligned_cols=26  Identities=8%  Similarity=-0.034  Sum_probs=23.1

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++++++|++       ++|.|+.||..||||
T Consensus       236 ~~~~~~~~li~~~l~~~p~~Rpt~~~ll~~~~~  268 (268)
T cd06624         236 SLSAEAKNFILRCFEPDPDKRASAHDLLQDPFL  268 (268)
T ss_pred             ccCHHHHHHHHHHcCCCchhCCCHHHHHhCCCC
Confidence            46678899987       999999999999997


No 78 
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=94.61  E-value=0.018  Score=40.75  Aligned_cols=25  Identities=8%  Similarity=-0.068  Sum_probs=22.8

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++++||++       ++|.|+.||..|||+
T Consensus       244 ~~~~~~~li~~~l~~dp~~Rpt~~~ll~~~~~  275 (275)
T cd06608         244 WSKKFNDFISECLIKNYEQRPFMEELLEHPFI  275 (275)
T ss_pred             cCHHHHHHHHHHhhcChhhCcCHHHHhcCCCC
Confidence            6678899988       999999999999996


No 79 
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=94.59  E-value=0.021  Score=41.32  Aligned_cols=26  Identities=4%  Similarity=0.012  Sum_probs=23.9

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++++++|||+       .+|.|..||.+||||
T Consensus       250 ~~~~~~~~li~~cl~~~p~~Rp~~~ell~~~~~  282 (282)
T cd06636         250 KWSKKFIDFIEGCLVKNYLSRPSTEQLLKHPFI  282 (282)
T ss_pred             ccCHHHHHHHHHHhCCChhhCcCHHHHhcCCCC
Confidence            46789999998       999999999999997


No 80 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=94.56  E-value=0.016  Score=45.32  Aligned_cols=33  Identities=15%  Similarity=-0.005  Sum_probs=27.7

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCCCCCcC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYAL   53 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpL   53 (98)
                      .+.++++||+       ++|.|+.||..||||.+.+.+.|
T Consensus       347 ~~~~~~~li~~ml~~dp~~Rpsa~e~l~~p~f~~~~~~~~  386 (392)
T PHA03207        347 MHMDVEYLIAKMLTFDQEFRPSAQDILSLPLFTKEPINLL  386 (392)
T ss_pred             cchhHHHHHHHHhccChhhCCCHHHHhhCchhhccchhhh
Confidence            4567888876       89999999999999999866555


No 81 
>KOG0612|consensus
Probab=94.54  E-value=0.017  Score=54.69  Aligned_cols=36  Identities=14%  Similarity=0.114  Sum_probs=32.1

Q ss_pred             eeecCCCCCChhHHHhhh------hcccc---ccccccCccccCC
Q psy9108          13 FYVTTQPANENRGKFLVR------IVAIK---AGVHKEHSWVTKD   48 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~------~kRIT---i~EIK~HPWVTkn   48 (98)
                      |-.||+++|+++.||||+      ++|..   +.+||.||||-..
T Consensus       300 l~FP~~~~VSeeakdLI~~ll~~~e~RLgrngiedik~HpFF~g~  344 (1317)
T KOG0612|consen  300 LSFPDETDVSEEAKDLIEALLCDREVRLGRNGIEDIKNHPFFEGI  344 (1317)
T ss_pred             cCCCcccccCHHHHHHHHHHhcChhhhcccccHHHHHhCccccCC
Confidence            556899999999999999      88888   9999999999754


No 82 
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.53  E-value=0.021  Score=41.65  Aligned_cols=27  Identities=7%  Similarity=-0.034  Sum_probs=23.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+..++++|++       ++|.++.||.+||||
T Consensus       257 ~~~~~~l~~li~~~l~~~p~~Rps~~~il~~~~~  290 (291)
T cd06639         257 EKWCRSFNHFISQCLIKDFEARPSVTHLLEHPFI  290 (291)
T ss_pred             cccCHHHHHHHHHHhhcChhhCcCHHHHhcCccc
Confidence            456678999988       999999999999998


No 83 
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=94.52  E-value=0.016  Score=41.57  Aligned_cols=27  Identities=22%  Similarity=0.198  Sum_probs=23.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.+++.+.||++       +.|.|+.||..||||
T Consensus       254 ~~~~~~~~~li~~~l~~dp~~Rp~~~~il~~~~~  287 (287)
T cd07838         254 PEICEEGLDLLKKMLTFNPHKRISAFEALQHPYF  287 (287)
T ss_pred             hhhhHHHHHHHHHHhccCCccCCCHHHHhcCcCC
Confidence            466788888888       999999999999997


No 84 
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=94.51  E-value=0.019  Score=42.38  Aligned_cols=29  Identities=17%  Similarity=0.127  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hcccc-----ccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIK-----AGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTk   47 (98)
                      ..+++++++|++       ++|+|     +.|+.+||||..
T Consensus       226 ~~~~~~~~~li~~~l~~~p~~R~s~~~~~~~~~~~h~~~~~  266 (285)
T cd05630         226 EKFSPDARSLCKMLLCKDPKERLGCQGGGAREVKEHPLFKQ  266 (285)
T ss_pred             ccCCHHHHHHHHHHhhcCHHHccCCCCCchHHHHcChhhhc
Confidence            357788999988       99999     889999999965


No 85 
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=94.51  E-value=0.017  Score=42.32  Aligned_cols=31  Identities=6%  Similarity=-0.038  Sum_probs=26.6

Q ss_pred             CCCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      .+.+++++++|++       ++|+     |+.|+..||||..-
T Consensus       221 ~~~~~~~~~~li~~~l~~~P~~R~~~~~~~~~~~l~h~~~~~~  263 (280)
T cd05608         221 PDKFSPASKSFCEALLAKDPEKRLGFRDGNCDGLRTHPLFRDL  263 (280)
T ss_pred             cccCCHHHHHHHHHHhcCCHHHhcCCCCCCHHHHhcChhhhcC
Confidence            3567889999988       9999     88999999999764


No 86 
>KOG0610|consensus
Probab=94.45  E-value=0.02  Score=49.23  Aligned_cols=32  Identities=22%  Similarity=0.300  Sum_probs=29.3

Q ss_pred             ecCCCCCChhHHHhhh-------hcccc----ccccccCcccc
Q psy9108          15 VTTQPANENRGKFLVR-------IVAIK----AGVHKEHSWVT   46 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~-------~kRIT----i~EIK~HPWVT   46 (98)
                      .+++|.++..+|||||       .+|+.    ..|||+||+|-
T Consensus       354 Fp~~~~vs~~akDLIr~LLvKdP~kRlg~~rGA~eIK~HpFF~  396 (459)
T KOG0610|consen  354 FPEEPEVSSAAKDLIRKLLVKDPSKRLGSKRGAAEIKRHPFFE  396 (459)
T ss_pred             CCCCCcchhHHHHHHHHHhccChhhhhccccchHHhhcCcccc
Confidence            5788899999999999       99999    99999999884


No 87 
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=94.42  E-value=0.022  Score=40.58  Aligned_cols=27  Identities=7%  Similarity=-0.006  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ..+++++++||+       ++|.|+.||.+||||
T Consensus       234 ~~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~  267 (267)
T cd06628         234 SNISSEAIDFLEKTFEIDHNKRPTAAELLKHPFL  267 (267)
T ss_pred             cccCHHHHHHHHHHccCCchhCcCHHHHhhCCCC
Confidence            357788999988       889999999999997


No 88 
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=94.40  E-value=0.023  Score=40.90  Aligned_cols=25  Identities=12%  Similarity=0.094  Sum_probs=22.5

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++++++|++       ++|.|+.||..||||
T Consensus       252 ~~~~~~~li~~cl~~~p~~Rpt~~ei~~~~~~  283 (283)
T cd07830         252 ASPEAIDLIKDMLRWDPKKRPTASQALQHPYF  283 (283)
T ss_pred             CCHHHHHHHHHhcccCcccCCCHHHHhhCCCC
Confidence            3678899988       899999999999997


No 89 
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=94.35  E-value=0.019  Score=41.03  Aligned_cols=27  Identities=19%  Similarity=0.183  Sum_probs=24.3

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.++++++++|+       .+|.++.||..|||+
T Consensus       250 ~~~~~~~~~~i~~~l~~~P~~Rp~~~~ll~~~~~  283 (283)
T cd05118         250 PNASPQALDLLSQMLHYDPHKRITAEQALAHPYF  283 (283)
T ss_pred             hhhCHHHHHHHHHHhccCcccCcCHHHHhhCCCC
Confidence            457889999988       899999999999997


No 90 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=94.32  E-value=0.03  Score=42.36  Aligned_cols=29  Identities=3%  Similarity=0.068  Sum_probs=25.4

Q ss_pred             CCCChhHHHhhh-------hccccc------cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA------GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi------~EIK~HPWVTk   47 (98)
                      +.++++++|||+       ++|+|.      .+++.||||..
T Consensus       217 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~~~~~h~~f~~  258 (320)
T cd05590         217 TWLSQDAVDILKAFMTKNPTMRLGSLTLGGEEAILRHPFFKE  258 (320)
T ss_pred             CCCCHHHHHHHHHHcccCHHHCCCCCCCCCHHHHHcCCCcCC
Confidence            357889999988       999998      89999999965


No 91 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=94.31  E-value=0.022  Score=41.31  Aligned_cols=29  Identities=10%  Similarity=-0.075  Sum_probs=25.9

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++++++|++       ++|.|+.||..||||.+.
T Consensus       238 ~~~~~l~~li~~~l~~~p~~Rpt~~~i~~~~~~~~~  273 (288)
T cd06616         238 EFSPSFVNFINLCLIKDESKRPKYKELLEHPFIKDY  273 (288)
T ss_pred             ccCHHHHHHHHHHccCChhhCcCHHHHhcChhhhch
Confidence            47788999988       999999999999999764


No 92 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=94.30  E-value=0.035  Score=42.50  Aligned_cols=26  Identities=12%  Similarity=0.210  Sum_probs=22.9

Q ss_pred             ChhHHHhhh-------hccccccccccCccccC
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      +++++|||.       .+|+|+.|+..||||..
T Consensus       291 ~~~~~dll~~mL~~dP~~R~t~~e~L~hp~~~~  323 (364)
T cd07875         291 ASQARDLLSKMLVIDASKRISVDEALQHPYINV  323 (364)
T ss_pred             cHHHHHHHHHhcCcCcccCCCHHHHhcCccccc
Confidence            457889988       99999999999999964


No 93 
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=94.28  E-value=0.028  Score=40.65  Aligned_cols=31  Identities=10%  Similarity=-0.004  Sum_probs=27.2

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+.++.++.||++       ++|.|+.+|.+|||+.+.
T Consensus       231 ~~~~~~~~~~li~~~l~~~p~~Rps~~~il~~~~~~~~  268 (280)
T cd06611         231 PSKWSSSFNDFLKSCLVKDPDDRPTAAELLKHPFVSDQ  268 (280)
T ss_pred             cccCCHHHHHHHHHHhccChhhCcCHHHHhcChhhccc
Confidence            3457789999988       999999999999999876


No 94 
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=94.27  E-value=0.02  Score=42.08  Aligned_cols=32  Identities=16%  Similarity=0.051  Sum_probs=26.7

Q ss_pred             CCCChhHHHhhh-------hcccc-----ccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIK-----AGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTknG~   50 (98)
                      +.+++++++|++       ++|+|     +.||++||||..-..
T Consensus       226 ~~~s~~~~~li~~~l~~~P~~R~~~~~~~~~~~~~h~~~~~~~~  269 (285)
T cd05631         226 EKFSEDAKSICRMLLTKNPKERLGCRGNGAAGVKQHPIFKNINF  269 (285)
T ss_pred             ccCCHHHHHHHHHHhhcCHHHhcCCCCCCHHHHhcCHhhcCCCH
Confidence            357889999988       99997     899999999976533


No 95 
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=94.24  E-value=0.014  Score=43.95  Aligned_cols=30  Identities=13%  Similarity=-0.041  Sum_probs=26.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      ..++.++|||+       ++|+|+.|+..||||....
T Consensus       279 ~~~~~~~~li~~~l~~dP~~Rpta~e~l~~~~~~~~~  315 (328)
T cd08226         279 TFSPAFQNLVELCLQQDPEKRPSASSLLSHAFFKQVK  315 (328)
T ss_pred             hhhHHHHHHHHHHccCCcccCCCHHHHhhCHHHHHHH
Confidence            45678899988       9999999999999997763


No 96 
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=94.23  E-value=0.034  Score=41.35  Aligned_cols=31  Identities=16%  Similarity=0.140  Sum_probs=26.8

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .|.++.++.+||+       ++|.|+.++..||||-+-
T Consensus       258 ~~~~~~~~~~li~~~l~~~P~~Rpt~~~ll~~~~~~~~  295 (330)
T cd07834         258 FPGASPEAIDLLEKMLVFDPKKRITADEALAHPYLAQL  295 (330)
T ss_pred             cccCCHHHHHHHHHHccCChhhCCCHHHHHhCccHHhh
Confidence            3557888999988       899999999999999754


No 97 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=94.20  E-value=0.03  Score=47.53  Aligned_cols=30  Identities=23%  Similarity=0.347  Sum_probs=24.4

Q ss_pred             hHHHhhh-------hccccccccccCccccCCCCCcC
Q psy9108          24 RGKFLVR-------IVAIKAGVHKEHSWVTKDGAYAL   53 (98)
Q Consensus        24 ~~kdL~~-------~kRITi~EIK~HPWVTknG~dpL   53 (98)
                      .+.|||+       ++|+|+.|+.+||||.+.+...+
T Consensus       425 ~~~dLi~~mL~~dP~kR~ta~e~L~Hpff~~~~~~~~  461 (566)
T PLN03225        425 AGWELLKSMMRFKGRQRISAKAALAHPYFDREGLLGL  461 (566)
T ss_pred             HHHHHHHHHccCCcccCCCHHHHhCCcCcCCCCcccc
Confidence            3457776       99999999999999998876543


No 98 
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=94.19  E-value=0.025  Score=40.34  Aligned_cols=28  Identities=18%  Similarity=0.247  Sum_probs=24.1

Q ss_pred             CCChhHHHhhh-------hcccc-----ccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAIK-----AGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTk   47 (98)
                      .++++++++|.       ++|+|     +.|+.+||||..
T Consensus       218 ~~~~~~~~~i~~~l~~~p~~R~~~~~~~~~~l~~~~~~~~  257 (262)
T cd05572         218 YIDKAAKDLIKQLLRRNPEERLGNLKGGIKDIKKHKWFNG  257 (262)
T ss_pred             ccCHHHHHHHHHHccCChhhCcCCcccCHHHHhcChhhhC
Confidence            34778888887       99999     999999999974


No 99 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=94.18  E-value=0.029  Score=43.12  Aligned_cols=32  Identities=9%  Similarity=-0.009  Sum_probs=25.3

Q ss_pred             cCCCCCChhHHHhhh------hcc---ccccccccCccccC
Q psy9108          16 TTQPANENRGKFLVR------IVA---IKAGVHKEHSWVTK   47 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~------~kR---ITi~EIK~HPWVTk   47 (98)
                      +.++.++++++||+.      +.|   -++.||++||||..
T Consensus       258 p~~~~~s~~~~~li~~l~~~~~~r~~r~~~~ei~~hp~f~~  298 (363)
T cd05628         258 PPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKTNPFFEG  298 (363)
T ss_pred             CCcCCCCHHHHHHHHHHcCChhhcCCCCCHHHHhCCCCCCC
Confidence            445568999999986      344   58999999999964


No 100
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=94.16  E-value=0.029  Score=41.21  Aligned_cols=33  Identities=9%  Similarity=-0.074  Sum_probs=28.0

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +....+++++++|++       ++|.|+.+|..|||+...
T Consensus       240 ~~~~~~~~~l~~li~~~l~~~p~~Rp~~~~il~~~~~~~~  279 (296)
T cd06618         240 PPNEGFSPDFCSFVDLCLTKDHRKRPKYRELLQHPFIRRY  279 (296)
T ss_pred             CCCCCCCHHHHHHHHHHccCChhhCCCHHHHhcChhhhcc
Confidence            333457889999988       999999999999999976


No 101
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=94.14  E-value=0.023  Score=42.68  Aligned_cols=28  Identities=14%  Similarity=0.061  Sum_probs=24.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      ..++++++|++       ++|.|+.|+.+||||-+
T Consensus       278 ~~~~~~~~li~~~l~~dP~~Rpt~~ell~~p~f~~  312 (327)
T cd08227         278 TFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQ  312 (327)
T ss_pred             ccCHHHHHHHHHHHhhCchhcCCHHHHhcChhhhh
Confidence            35678889988       89999999999999954


No 102
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=94.13  E-value=0.026  Score=47.96  Aligned_cols=33  Identities=15%  Similarity=0.102  Sum_probs=26.5

Q ss_pred             ecCCCCCChhHHHhhh----------hccccccccccCccccC
Q psy9108          15 VTTQPANENRGKFLVR----------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~----------~kRITi~EIK~HPWVTk   47 (98)
                      ++....+++..+||+.          .+|+|+.|++.||||..
T Consensus       463 ~~~~d~~s~~~~dLi~~LL~~~~~~~~~RlSa~eaL~Hp~f~~  505 (507)
T PLN03224        463 FSLLDRNKEAGWDLACKLITKRDQANRGRLSVGQALSHRFFLP  505 (507)
T ss_pred             cccccccChHHHHHHHHHhccCCCCcccCCCHHHHhCCCCcCC
Confidence            3444567888999877          36999999999999975


No 103
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=94.12  E-value=0.029  Score=39.76  Aligned_cols=26  Identities=15%  Similarity=0.054  Sum_probs=23.5

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++++++||+       ++|.|+.|+..||||
T Consensus       231 ~~~~~~~~li~~~l~~~p~~Rpt~~~ll~~~~~  263 (263)
T cd06625         231 HVSPDARNFLRRTFVENAKKRPSAEELLRHFFV  263 (263)
T ss_pred             cCCHHHHHHHHHHhhcCcccCCCHHHHhhCCCC
Confidence            56788999987       899999999999997


No 104
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=94.12  E-value=0.038  Score=42.19  Aligned_cols=30  Identities=13%  Similarity=0.109  Sum_probs=26.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +.++.++.|||+       ++|+|+.|+..||||-.-
T Consensus       268 ~~~~~~~~~li~~~l~~dP~~R~t~~~~l~~~~~~~~  304 (343)
T cd07880         268 PNANPLAVNVLEKMLVLDAESRITAAEALAHPYFEEF  304 (343)
T ss_pred             cCCChHHHHHHHHHcCCChhhCCCHHHHhcCccHhhh
Confidence            567788999987       999999999999999875


No 105
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=94.10  E-value=0.031  Score=43.18  Aligned_cols=34  Identities=15%  Similarity=0.087  Sum_probs=27.7

Q ss_pred             eecCCCCCChhHHHhhh------hcccc---ccccccCccccC
Q psy9108          14 YVTTQPANENRGKFLVR------IVAIK---AGVHKEHSWVTK   47 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~------~kRIT---i~EIK~HPWVTk   47 (98)
                      ..+..+.++++++|||.      ++|++   +.||+.||||..
T Consensus       268 ~~p~~~~~s~~~~~li~~l~~~p~~R~~~~~~~ei~~hp~f~~  310 (382)
T cd05625         268 HIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKT  310 (382)
T ss_pred             CCCCcccCCHHHHHHHHHHccCHhHcCCCCCHHHHhcCCCcCC
Confidence            34555678999999986      77887   999999999965


No 106
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=94.09  E-value=0.028  Score=39.84  Aligned_cols=27  Identities=11%  Similarity=-0.026  Sum_probs=23.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ...+.+++||++       ++|.++.++.+||||
T Consensus       223 ~~~~~~~~~li~~~l~~~p~~Rp~~~~vl~~~~~  256 (256)
T cd08218         223 SHYSYDLRNLVSQLFKRNPRDRPSVNSILEKNFI  256 (256)
T ss_pred             ccCCHHHHHHHHHHhhCChhhCcCHHHHhhCcCC
Confidence            356778899988       999999999999997


No 107
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=94.08  E-value=0.031  Score=41.36  Aligned_cols=36  Identities=19%  Similarity=0.211  Sum_probs=27.6

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCCCCCcCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKDGAYALP   54 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTknG~dpLP   54 (98)
                      +.+++.++|||+       .+|+     |+.|++.||||..-....++
T Consensus       219 ~~~~~~~~~li~~~l~~dp~~R~~~~~~~~~~~l~h~~~~~~~~~~~~  266 (291)
T cd05612         219 RHLDLYAKDLIKKLLVVDRTRRLGNMKNGADDVKNHRWFKSVDWDDVP  266 (291)
T ss_pred             ccCCHHHHHHHHHHcCCCHHHccCCccCCHHHHhcCccccCCCHHHHh
Confidence            346778999988       8999     59999999999864333333


No 108
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=94.05  E-value=0.03  Score=43.26  Aligned_cols=29  Identities=28%  Similarity=0.346  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +.++++++|||+       ++|+     |+.||++||||.+
T Consensus       249 ~~~~~~~~~li~~~l~~dp~~R~~~~~~~~~~~~~hp~f~~  289 (340)
T PTZ00426        249 KFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQNVKEHPWFGN  289 (340)
T ss_pred             CCCCHHHHHHHHHHcccCHHHcCCCCCCCHHHHHcCCCcCC
Confidence            567888999988       8887     8999999999975


No 109
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=94.01  E-value=0.03  Score=40.65  Aligned_cols=26  Identities=19%  Similarity=0.193  Sum_probs=22.6

Q ss_pred             CCC--hhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANE--NRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~--~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++  .++.||++       ++|+|+.|+..||||
T Consensus       257 ~~~~~~~~~~li~~~L~~~p~~Rps~~e~l~~~~f  291 (291)
T cd07844         257 RLDRIPHGEELALKFLQYEPKKRISAAEAMKHPYF  291 (291)
T ss_pred             CCCCchhHHHHHHHHhccCcccccCHHHHhcCCCC
Confidence            455  77888877       999999999999997


No 110
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=94.01  E-value=0.029  Score=42.57  Aligned_cols=28  Identities=18%  Similarity=0.213  Sum_probs=24.7

Q ss_pred             CCChhHHHhhh-------hcccc-----ccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAIK-----AGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTk   47 (98)
                      .++++++||++       ++|+|     +.+|+.||||.+
T Consensus       237 ~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~ll~hp~f~~  276 (329)
T PTZ00263        237 WFDGRARDLVKGLLQTDHTKRLGTLKGGVADVKNHPYFHG  276 (329)
T ss_pred             CCCHHHHHHHHHHhhcCHHHcCCCCCCCHHHHhcCCccCC
Confidence            37788999988       99997     899999999976


No 111
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=93.97  E-value=0.035  Score=38.95  Aligned_cols=26  Identities=12%  Similarity=0.109  Sum_probs=22.8

Q ss_pred             CCChhHHHhhh-------hccccc---cccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKA---GVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi---~EIK~HPWV   45 (98)
                      .+++.++++++       +.|+|.   .|+++||||
T Consensus       215 ~~~~~l~~~i~~~l~~~p~~R~~~~~~~~l~~~~~f  250 (250)
T cd05123         215 FLSPEARDLISGLLQKDPTKRLGSGGAEEIKAHPFF  250 (250)
T ss_pred             CCCHHHHHHHHHHhcCCHhhCCCcccHHHHHhCCCC
Confidence            44778888888       999999   899999997


No 112
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=93.95  E-value=0.029  Score=39.99  Aligned_cols=26  Identities=4%  Similarity=0.041  Sum_probs=23.0

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++.++.|||+       ++|+|+.||..|||+
T Consensus       228 ~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~  260 (260)
T cd08222         228 TYSRQLNSIMQSMLNKDPSLRPSAAEILRNPFI  260 (260)
T ss_pred             hhcHHHHHHHHHHhcCChhhCcCHHHHhhCCCC
Confidence            45678889987       999999999999996


No 113
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=93.94  E-value=0.033  Score=39.59  Aligned_cols=27  Identities=19%  Similarity=0.190  Sum_probs=23.7

Q ss_pred             CCCChhHHHhhh-------hccccc----cccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKA----GVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi----~EIK~HPWV   45 (98)
                      +.+++++.+|++       ++|+|.    .+++.||||
T Consensus       243 ~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~ll~~~~~  280 (280)
T cd05581         243 PNFPPDAKDLIEKLLVLDPQDRLGVNEGYDELKAHPFF  280 (280)
T ss_pred             CccCHHHHHHHHHHhcCCHhhCCCcccCHHHHhcCCCC
Confidence            456788888887       889999    999999997


No 114
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=93.92  E-value=0.028  Score=41.36  Aligned_cols=29  Identities=21%  Similarity=0.103  Sum_probs=24.7

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +.+++++++||+       ++|+     |+.|+++||||..
T Consensus       220 ~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~~~~~h~~~~~  260 (279)
T cd05633         220 DSFSPELKSLLEGLLQRDVSKRLGCLGRGAQEVKEHVFFKG  260 (279)
T ss_pred             cccCHHHHHHHHHHhcCCHHHhcCCCCCCHHHHHhCccccC
Confidence            346788899988       9999     6999999999955


No 115
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=93.82  E-value=0.039  Score=41.62  Aligned_cols=39  Identities=18%  Similarity=0.286  Sum_probs=30.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcCCCcccCc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPTEEENC   60 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~Eeenc   60 (98)
                      |.++++++++|+       ++|.|+.|+..||||-+.   +.|..+..|
T Consensus       264 ~~~~~~~~~li~~~l~~~P~~Rpt~~~~l~~~~~~~~---~~~~~~~~~  309 (334)
T cd07855         264 PKASPEALDLLSQMLQFDPEERITVEQALQHPFLAQY---HDPDDEPTC  309 (334)
T ss_pred             ccCCHHHHHHHHHHccCChhhCcCHHHHHhChhhhhc---cCCcccccC
Confidence            557889999988       999999999999999755   344444444


No 116
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=93.82  E-value=0.036  Score=39.43  Aligned_cols=27  Identities=7%  Similarity=0.009  Sum_probs=23.9

Q ss_pred             CCCChhHHHhhh-------hccccc--cccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKA--GVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi--~EIK~HPWV   45 (98)
                      +.+++++.++|+       .+|+|.  .|+++||||
T Consensus       223 ~~~~~~~~~~i~~~l~~~p~~R~~~~~~~l~~~~~~  258 (258)
T cd05578         223 ATWSTEAIDAINKLLERDPQKRLGDNLKDLKNHPYF  258 (258)
T ss_pred             ccCcHHHHHHHHHHccCChhHcCCccHHHHhcCCCC
Confidence            456788999988       999999  999999997


No 117
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=93.80  E-value=0.028  Score=41.14  Aligned_cols=30  Identities=13%  Similarity=0.086  Sum_probs=24.8

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      .++.+.|+++       ++|.|+.||..||||.+...
T Consensus       238 ~~~~~~~li~~~l~~~p~~Rpt~~eil~~~~~~~~~~  274 (287)
T cd06621         238 WSEEFKDFIKQCLEKDPTRRPTPWDMLEHPWIKAQMK  274 (287)
T ss_pred             hHHHHHHHHHHHcCCCcccCCCHHHHHhCcccccccc
Confidence            3567888887       89999999999999966633


No 118
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=93.79  E-value=0.029  Score=39.97  Aligned_cols=30  Identities=10%  Similarity=-0.020  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hccc---cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI---KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI---Ti~EIK~HPWVTkn   48 (98)
                      +.++.++.+++.       +.|+   ++.||+.||||.+.
T Consensus       218 ~~~~~~~~~~i~~~l~~~p~~R~~~~~~~~~l~~~~~~~~  257 (260)
T cd05611         218 EFCSPEAVDLINRLLCMDPAKRLGANGYQEIKSHPFFKSI  257 (260)
T ss_pred             ccCCHHHHHHHHHHccCCHHHccCCCcHHHHHcChHhhcC
Confidence            367889999988       9999   56799999999764


No 119
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=93.78  E-value=0.036  Score=42.05  Aligned_cols=29  Identities=7%  Similarity=0.058  Sum_probs=24.7

Q ss_pred             CCCChhHHHhhh-------hcccc------ccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIK------AGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT------i~EIK~HPWVTk   47 (98)
                      +.+++++++||+       ++|+|      +.+++.||||..
T Consensus       226 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~~i~~hp~~~~  267 (329)
T cd05588         226 RSLSVKASSVLKGFLNKDPKERLGCHPQTGFRDIKSHPFFRN  267 (329)
T ss_pred             CCCCHHHHHHHHHHhccCHHHcCCCCCCCCHHHHhcCCCCCC
Confidence            357788999988       99997      789999999954


No 120
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=93.71  E-value=0.041  Score=38.67  Aligned_cols=27  Identities=19%  Similarity=0.142  Sum_probs=23.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++++++|++       ++|.|+.++..|||+
T Consensus       225 ~~~~~~~~~li~~~l~~~p~~Rp~~~~~l~~~~~  258 (258)
T cd06632         225 DHLSDEAKDFILKCLQRDPSLRPTAAELLEHPFV  258 (258)
T ss_pred             CCcCHHHHHHHHHHhhcCcccCcCHHHHhcCCCC
Confidence            456788999988       889999999999996


No 121
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=93.70  E-value=0.026  Score=42.99  Aligned_cols=28  Identities=7%  Similarity=-0.019  Sum_probs=25.2

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++++|||+       ++|+|+.||..|||+...
T Consensus       271 ~~~~~~~li~~~L~~~P~~Rpt~~ell~h~~~~~~  305 (333)
T cd06650         271 FGAEFQDFVNKCLIKNPAERADLKQLMVHAFIKRS  305 (333)
T ss_pred             cCHHHHHHHHHhccCCcccCcCHHHHhhCHHHhcC
Confidence            5678999988       999999999999999765


No 122
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=93.67  E-value=0.036  Score=38.82  Aligned_cols=26  Identities=0%  Similarity=-0.157  Sum_probs=23.1

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++.++.+|++       +.|.|+.||.+|||+
T Consensus       233 ~~~~~~~~l~~~~l~~~p~~Rp~~~~il~~~~~  265 (265)
T cd08217         233 RYSSELNEVIKSMLNVDPDKRPSTEELLQLPLI  265 (265)
T ss_pred             ccCHHHHHHHHHHccCCcccCCCHHHHhhCCCC
Confidence            56678889888       899999999999996


No 123
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=93.67  E-value=0.038  Score=41.66  Aligned_cols=29  Identities=10%  Similarity=-0.074  Sum_probs=25.7

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++++++||.       ++|.|+.||+.||||..-
T Consensus       228 ~~s~~~~~li~~~l~~~~~rr~s~~~ll~h~~~~~~  263 (333)
T cd05600         228 NLSDEAWDLITKLINDPSRRFGSLEDIKNHPFFKEV  263 (333)
T ss_pred             ccCHHHHHHHHHHhhChhhhcCCHHHHHhCcccCCC
Confidence            56889999987       899999999999999863


No 124
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=93.65  E-value=0.036  Score=41.09  Aligned_cols=32  Identities=6%  Similarity=-0.122  Sum_probs=27.9

Q ss_pred             CCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..+.++..+++|++       +.|.|+.||..|||+...
T Consensus       238 ~~~~~~~~l~~li~~~l~~~p~~Rpt~~eil~~~~~~~~  276 (296)
T cd06654         238 NPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIA  276 (296)
T ss_pred             CccccCHHHHHHHHHHCcCCcccCcCHHHHhhChhhhcc
Confidence            34567889999987       999999999999999876


No 125
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=93.64  E-value=0.041  Score=40.08  Aligned_cols=27  Identities=11%  Similarity=0.035  Sum_probs=24.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++.+++|++       ++|+|+.+|..||||
T Consensus       269 ~~~~~~~~~li~~~l~~~P~~Rp~~~~il~~~~~  302 (302)
T cd07864         269 SFIPTPALDLLDHMLTLDPSKRCTAEEALNSPWL  302 (302)
T ss_pred             CCCCHHHHHHHHHHccCChhhCCCHHHHhcCCCC
Confidence            357888999988       999999999999997


No 126
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=93.63  E-value=0.04  Score=38.62  Aligned_cols=27  Identities=15%  Similarity=0.111  Sum_probs=23.7

Q ss_pred             CChhHHHhhh-------hccccc---cccccCccccC
Q psy9108          21 NENRGKFLVR-------IVAIKA---GVHKEHSWVTK   47 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi---~EIK~HPWVTk   47 (98)
                      +++.+.++++       ++|+|+   .|+.+||||.+
T Consensus       226 ~~~~~~~~i~~~l~~~p~~Rpt~~~~~~~l~~~~~~~  262 (265)
T cd05579         226 VSDEAIDLISKLLVPDPEKRLGAKSIEEIKNHPFFKG  262 (265)
T ss_pred             CCHHHHHHHHHHhcCCHhhcCCCccHHHHhcCccccC
Confidence            4788888887       999999   99999999963


No 127
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=93.62  E-value=0.034  Score=40.42  Aligned_cols=31  Identities=13%  Similarity=-0.037  Sum_probs=27.4

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      .++.++++|++       .+|.|+.+|.+|||+++-++
T Consensus       241 ~~~~~l~~li~~~l~~~p~~Rpt~~~il~~~~~~~~~~  278 (286)
T cd06614         241 KWSPEFKDFLNKCLVKDPEKRPSAEELLQHPFLKKACP  278 (286)
T ss_pred             hCCHHHHHHHHHHhccChhhCcCHHHHhhChHhhccCc
Confidence            37889999988       89999999999999999644


No 128
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=93.61  E-value=0.042  Score=40.96  Aligned_cols=28  Identities=7%  Similarity=0.032  Sum_probs=25.0

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +++++++|+.       ++|.|+.||..||||-+.
T Consensus       259 ~~~~~~~li~~~l~~~P~~Rpt~~~ll~~~~~~~~  293 (308)
T cd06615         259 FSDEFQDFVDKCLKKNPKERADLKELTKHPFIKRA  293 (308)
T ss_pred             cCHHHHHHHHHHccCChhhCcCHHHHhcChhhhhc
Confidence            6778999988       999999999999999664


No 129
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=93.57  E-value=0.042  Score=41.49  Aligned_cols=29  Identities=17%  Similarity=0.131  Sum_probs=25.6

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +.+++++++||+       ++|+     |+.||+.||||..
T Consensus       216 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~ll~h~~f~~  256 (323)
T cd05571         216 RTLSPEAKSLLAGLLKKDPKQRLGGGPEDAKEIMEHRFFAS  256 (323)
T ss_pred             CCCCHHHHHHHHHHccCCHHHcCCCCCCCHHHHHcCCCcCC
Confidence            357889999988       9999     8999999999965


No 130
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=93.57  E-value=0.049  Score=41.85  Aligned_cols=33  Identities=15%  Similarity=0.127  Sum_probs=27.7

Q ss_pred             ecCCCCCChhHHHhhh------hccc---cccccccCccccC
Q psy9108          15 VTTQPANENRGKFLVR------IVAI---KAGVHKEHSWVTK   47 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~------~kRI---Ti~EIK~HPWVTk   47 (98)
                      ++....++++++||+.      ++|+   |+.|++.||||..
T Consensus       265 ~~~~~~~s~~~~~li~~l~~~p~~R~~~~t~~ell~h~~~~~  306 (376)
T cd05598         265 IPSQAKLSREASDLILRLCCGAEDRLGKNGADEIKAHPFFKG  306 (376)
T ss_pred             CCCCCCCCHHHHHHHHHHhcCHhhcCCCCCHHHHhCCCCcCC
Confidence            3455578889999877      8999   9999999999974


No 131
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=93.56  E-value=0.048  Score=39.89  Aligned_cols=29  Identities=14%  Similarity=0.054  Sum_probs=25.3

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      +.++.++.|||+       ++|.|+.||..||||..
T Consensus       239 ~~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~~~  274 (292)
T cd06644         239 SKWSMEFRDFLKTALDKHPETRPSAAQLLEHPFVSS  274 (292)
T ss_pred             cccCHHHHHHHHHHhcCCcccCcCHHHHhcCccccc
Confidence            456778999988       89999999999999965


No 132
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=93.55  E-value=0.035  Score=40.32  Aligned_cols=30  Identities=17%  Similarity=0.050  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      +.++++++|||+       ++|+     |..+++.||||.+-
T Consensus       219 ~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~~ll~h~~~~~~  260 (277)
T cd05577         219 DKFSPEAKDLCEALLQKDPEKRLGCRGGSADEVREHPLFKDL  260 (277)
T ss_pred             ccCCHHHHHHHHHHccCChhHccCCCcccHHHHHhChhhhcC
Confidence            457889999988       8999     77779999999653


No 133
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=93.54  E-value=0.043  Score=39.45  Aligned_cols=25  Identities=4%  Similarity=0.052  Sum_probs=22.6

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +++++++|++       ++|.|+.+|..||||
T Consensus       257 ~~~~~~~li~~~l~~~p~~Rps~~~il~~~~f  288 (288)
T cd07833         257 VSSPALDFLKACLRMDPKERLTCDELLQHPYF  288 (288)
T ss_pred             cchHHHHHHHHHhccCchhcccHHHHhcCCCC
Confidence            4788899987       999999999999997


No 134
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=93.54  E-value=0.05  Score=41.30  Aligned_cols=29  Identities=17%  Similarity=0.171  Sum_probs=24.6

Q ss_pred             CCCChhHHHhhh---------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR---------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~---------~kRITi~EIK~HPWVTk   47 (98)
                      +.+++++++||+         ..|+++.++++||||..
T Consensus       234 ~~~~~~~~~li~~ll~~~~~r~~r~~~~~~l~hp~~~~  271 (331)
T cd05597         234 TDVSEEAKDLIRRLICSPETRLGRNGLQDFKDHPFFEG  271 (331)
T ss_pred             CCCCHHHHHHHHHHccCcccccCCCCHHHHhcCCCCCC
Confidence            458999999987         34889999999999964


No 135
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=93.52  E-value=0.046  Score=41.37  Aligned_cols=29  Identities=7%  Similarity=-0.023  Sum_probs=25.1

Q ss_pred             CCChhHHHhhh-------hcccccc-ccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAG-VHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~-EIK~HPWVTkn   48 (98)
                      .++++++||+.       ++|+|+. +|+.||||..-
T Consensus       218 ~~~~~~~~li~~~l~~~P~~R~~~~~~l~~h~~~~~~  254 (316)
T cd05619         218 WLTREAKDILVKLFVREPERRLGVKGDIRQHPFFREI  254 (316)
T ss_pred             cCCHHHHHHHHHHhccCHhhcCCChHHHHcCcccCCC
Confidence            47788999987       9999997 99999999763


No 136
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=93.49  E-value=0.043  Score=41.08  Aligned_cols=30  Identities=17%  Similarity=0.124  Sum_probs=25.5

Q ss_pred             CCCChhHHHhhh-------hcccc---ccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIK---AGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT---i~EIK~HPWVTkn   48 (98)
                      +.++++++|||+       ++|+|   +.|++.||||.+.
T Consensus       214 ~~~~~~~~~li~~~L~~dp~~R~~~~~~~e~l~hp~~~~~  253 (312)
T cd05585         214 DGFDRDAKDLLIGLLSRDPTRRLGYNGAQEIKNHPFFSQL  253 (312)
T ss_pred             CcCCHHHHHHHHHHcCCCHHHcCCCCCHHHHHcCCCcCCC
Confidence            457889999988       99985   6899999999874


No 137
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=93.47  E-value=0.045  Score=41.62  Aligned_cols=29  Identities=21%  Similarity=0.123  Sum_probs=25.6

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +.+++++++||+       ++|+     |+.||++||||+.
T Consensus       216 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~il~h~~~~~  256 (328)
T cd05593         216 RTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTG  256 (328)
T ss_pred             CCCCHHHHHHHHHHcCCCHHHcCCCCCCCHHHHhcCCCcCC
Confidence            457889999988       9999     8999999999975


No 138
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=93.37  E-value=0.043  Score=39.45  Aligned_cols=32  Identities=9%  Similarity=0.080  Sum_probs=27.2

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCCCCCc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYA   52 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dp   52 (98)
                      ++.+++|+++       +.|.|+.||..|||+.++...+
T Consensus       227 ~~~~~~~~i~~~l~~~p~~R~~~~~il~~~~~~~~~~~~  265 (277)
T cd06917         227 YSKLLREFVAACLDEEPKERLSAEELLKSKWIKAHSKTP  265 (277)
T ss_pred             CCHHHHHHHHHHcCCCcccCcCHHHHhhChHhhccccCc
Confidence            5678999988       9999999999999998875443


No 139
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=93.35  E-value=0.049  Score=40.93  Aligned_cols=30  Identities=17%  Similarity=0.067  Sum_probs=25.6

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      +.+++.+++|++       ++|+     ++.++.+||||...
T Consensus       232 ~~~~~~~~~li~~~l~~dp~~R~~~~~~~~~~~l~h~~~~~~  273 (332)
T cd05614         232 SFIGPEAQDLLHKLLRKDPKKRLGAGPQGASEIKEHPFFKGL  273 (332)
T ss_pred             CCCCHHHHHHHHHHcCCCHHHcCCCCCCCHHHHHcCCCcCCC
Confidence            357788999988       9999     78899999999864


No 140
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=93.33  E-value=0.052  Score=38.81  Aligned_cols=26  Identities=15%  Similarity=0.022  Sum_probs=23.0

Q ss_pred             CCCChhHHHhhh-------hccccccccccCcc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSW   44 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPW   44 (98)
                      ..+++++++|++       +.|+|+.||..|||
T Consensus       235 ~~~~~~~~~li~~~l~~~P~~R~~~~~ll~~~~  267 (267)
T cd06645         235 MKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPF  267 (267)
T ss_pred             CCCCHHHHHHHHHHccCCchhCcCHHHHhcCCC
Confidence            356788999988       89999999999999


No 141
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=93.31  E-value=0.045  Score=38.91  Aligned_cols=27  Identities=4%  Similarity=-0.273  Sum_probs=23.3

Q ss_pred             CCChhHHHhhh-------hccccccccccCcccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      .+++++++++.       ++|.|..|+.+||||.
T Consensus       235 ~~~~~~~~~i~~~l~~~p~~R~~~~~ll~~~~~~  268 (268)
T cd06630         235 HLSPGLRDVTLRCLELQPEDRPPSRELLKHPVFR  268 (268)
T ss_pred             hhCHHHHHHHHHHcCCCcccCcCHHHHhcCcccC
Confidence            46778888876       8899999999999984


No 142
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=93.27  E-value=0.057  Score=41.08  Aligned_cols=34  Identities=12%  Similarity=0.097  Sum_probs=28.1

Q ss_pred             eecCCCCCChhHHHhhh------hcccc---ccccccCccccC
Q psy9108          14 YVTTQPANENRGKFLVR------IVAIK---AGVHKEHSWVTK   47 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~------~kRIT---i~EIK~HPWVTk   47 (98)
                      ..+.+..++++++|||+      .+|++   +.|++.||||..
T Consensus       259 ~~~~~~~~s~~~~~li~~ll~~p~~R~~~~~~~~ll~h~~~~~  301 (364)
T cd05599         259 QFPDEVPLSPEAKDLIKRLCCEAERRLGNNGVNEIKSHPFFKG  301 (364)
T ss_pred             CCCCCCCCCHHHHHHHHHHccCHhhcCCCCCHHHHhcCCCcCC
Confidence            34555568899999987      78998   999999999965


No 143
>KOG0605|consensus
Probab=93.25  E-value=0.045  Score=48.02  Aligned_cols=33  Identities=15%  Similarity=0.131  Sum_probs=29.6

Q ss_pred             ecCCCCCChhHHHhhh------hcccc---ccccccCccccC
Q psy9108          15 VTTQPANENRGKFLVR------IVAIK---AGVHKEHSWVTK   47 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~------~kRIT---i~EIK~HPWVTk   47 (98)
                      -+++..++++.+|||.      ++|+-   +.|||.||||..
T Consensus       409 fP~~~~~s~eA~DLI~rll~d~~~RLG~~G~~EIK~HPfF~~  450 (550)
T KOG0605|consen  409 FPEEVDLSDEAKDLITRLLCDPENRLGSKGAEEIKKHPFFKG  450 (550)
T ss_pred             CCCcCcccHHHHHHHHHHhcCHHHhcCcccHHHHhcCCcccc
Confidence            4788899999999988      99997   899999999975


No 144
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=93.25  E-value=0.055  Score=37.60  Aligned_cols=26  Identities=8%  Similarity=-0.034  Sum_probs=23.7

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++++++++++       ++|.|+.|+.+||||
T Consensus       226 ~~~~~~~~~i~~~l~~~p~~Rp~~~~ll~~~~~  258 (258)
T cd08215         226 QYSSELRNLVSSLLQKDPEERPSIAQILQSPFI  258 (258)
T ss_pred             CCCHHHHHHHHHHcCCChhhCcCHHHHhcCCCC
Confidence            57788999888       999999999999997


No 145
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=93.22  E-value=0.06  Score=42.08  Aligned_cols=34  Identities=15%  Similarity=0.110  Sum_probs=28.0

Q ss_pred             ecCCCCCChhHHHhhh---------hccccccccccCccccCC
Q psy9108          15 VTTQPANENRGKFLVR---------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~~---------~kRITi~EIK~HPWVTkn   48 (98)
                      .++.+.+++.+++|+.         ..|.++.||++||||...
T Consensus       268 ~~~~~~~s~~~~~li~~~L~~~~~r~~r~~~~ei~~h~~~~~~  310 (371)
T cd05622         268 FPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKND  310 (371)
T ss_pred             CCCcCCCCHHHHHHHHHHcCChhhhcCCCCHHHHhcCcccCCC
Confidence            4566789999999987         248899999999999763


No 146
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=93.22  E-value=0.054  Score=41.04  Aligned_cols=29  Identities=21%  Similarity=0.193  Sum_probs=24.3

Q ss_pred             CCCChhHHHhhh---------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR---------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~---------~kRITi~EIK~HPWVTk   47 (98)
                      ..++++++|||+         ..|.|+.|++.||||..
T Consensus       234 ~~~s~~~~~li~~ll~~~~~r~~r~~~~~~~~h~~f~~  271 (332)
T cd05623         234 TDVSEDAKDLIRRLICSREHRLGQNGIEDFKQHPFFTG  271 (332)
T ss_pred             ccCCHHHHHHHHHHccChhhhcCCCCHHHHhCCCCcCC
Confidence            367899999988         33689999999999975


No 147
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=93.20  E-value=0.047  Score=40.62  Aligned_cols=30  Identities=17%  Similarity=0.114  Sum_probs=26.6

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      .++.++.+++.       .+|+|+.++..||||.+.|
T Consensus       241 ~~~~~l~~li~~~l~~~P~~R~~~~~ll~~~~~~~~~  277 (292)
T cd06657         241 KVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAG  277 (292)
T ss_pred             cCCHHHHHHHHHHHhCCcccCcCHHHHhcChHHhccC
Confidence            46778888877       8999999999999999996


No 148
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=93.16  E-value=0.062  Score=39.88  Aligned_cols=36  Identities=8%  Similarity=-0.014  Sum_probs=29.6

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccCccccCCCCC
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAY   51 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~d   51 (98)
                      .+...+++.++++++       ++|+|+.||..||||-..+..
T Consensus       239 ~~~~~~~~~~~~li~~~l~~~P~~Rpt~~~il~~~~~~~~~~~  281 (292)
T cd06658         239 KDSHKVSSVLRGFLDLMLVREPSQRATAQELLQHPFLKLAGPP  281 (292)
T ss_pred             ccccccCHHHHHHHHHHccCChhHCcCHHHHhhChhhhccCCc
Confidence            344567888999987       899999999999999977543


No 149
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=93.16  E-value=0.057  Score=40.74  Aligned_cols=29  Identities=10%  Similarity=0.094  Sum_probs=24.6

Q ss_pred             CCChhHHHhhh-------hccccc-cccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKA-GVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi-~EIK~HPWVTkn   48 (98)
                      .++.++++||+       ++|+|+ .+|+.||||...
T Consensus       218 ~~~~~~~~li~~~l~~dP~~R~~~~~~~~~h~~f~~~  254 (316)
T cd05620         218 WITKESKDILEKLFERDPTRRLGVVGNIRGHPFFKTI  254 (316)
T ss_pred             CCCHHHHHHHHHHccCCHHHcCCChHHHHcCCCcCCC
Confidence            36778999988       999998 589999999663


No 150
>KOG0592|consensus
Probab=93.15  E-value=0.048  Score=48.32  Aligned_cols=30  Identities=10%  Similarity=0.129  Sum_probs=25.4

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      -|.++++.+||++       ..|+|+.|||.||+|-.
T Consensus       307 p~~fp~~a~dLv~KLLv~dp~~Rlt~~qIk~HpFF~~  343 (604)
T KOG0592|consen  307 PEGFPEDARDLIKKLLVRDPSDRLTSQQIKAHPFFEG  343 (604)
T ss_pred             CCCCCHHHHHHHHHHHccCccccccHHHHhhCccccc
Confidence            3567788888887       99999999999998853


No 151
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=93.01  E-value=0.06  Score=41.49  Aligned_cols=35  Identities=17%  Similarity=0.096  Sum_probs=28.3

Q ss_pred             eeecCCCCCChhHHHhhh------hc---cccccccccCccccC
Q psy9108          13 FYVTTQPANENRGKFLVR------IV---AIKAGVHKEHSWVTK   47 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~------~k---RITi~EIK~HPWVTk   47 (98)
                      +..++...++.+++|||+      .+   |.|+.|++.||||..
T Consensus       267 ~~~p~~~~~s~~~~dli~~lL~~~~~r~~r~~~~~~l~hp~~~~  310 (377)
T cd05629         267 LYFPDDIHLSVEAEDLIRRLITNAENRLGRGGAHEIKSHPFFRG  310 (377)
T ss_pred             cCCCCCCCCCHHHHHHHHHHhcCHhhcCCCCCHHHHhcCCCcCC
Confidence            455666678999999988      34   569999999999974


No 152
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=92.99  E-value=0.028  Score=41.42  Aligned_cols=28  Identities=14%  Similarity=-0.010  Sum_probs=23.7

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +++++++|++       ++|+|+.|+.+||||.+-
T Consensus       267 ~~~~~~~li~~~l~~~P~~Rpt~~~ll~~p~~~~~  301 (314)
T cd08216         267 FSEHFHQFVELCLQRDPESRPSASQLLNHSFFKQC  301 (314)
T ss_pred             HHHHHHHHHHHHhhcCCCcCcCHHHHhcCchHhhh
Confidence            3467888887       999999999999999754


No 153
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=92.96  E-value=0.06  Score=40.47  Aligned_cols=28  Identities=7%  Similarity=0.109  Sum_probs=24.6

Q ss_pred             CCChhHHHhhh-------hccc-------cccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAI-------KAGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRI-------Ti~EIK~HPWVTk   47 (98)
                      .++.+++|||+       ++|+       |+.+|+.||||..
T Consensus       218 ~~~~~~~~ll~~~L~~dp~~R~~~~~~~~~~~~~~~hp~~~~  259 (321)
T cd05591         218 WLSKEAVSILKAFMTKNPNKRLGCVASQGGEDAIKQHPFFKE  259 (321)
T ss_pred             CCCHHHHHHHHHHhccCHHHcCCCCCCCCCHHHHhcCCccCC
Confidence            46788999988       8999       9999999999965


No 154
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=92.95  E-value=0.078  Score=38.99  Aligned_cols=31  Identities=16%  Similarity=0.169  Sum_probs=27.5

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      +.+++.+.|+++       ++|.|+.||..|||+.+.+
T Consensus       239 ~~~~~~l~~li~~~l~~~p~~Rpt~~~il~~~~~~~~~  276 (285)
T cd06648         239 HKVSPRLRSFLDRMLVRDPAQRATAAELLNHPFLAKAG  276 (285)
T ss_pred             ccCCHHHHHHHHHHcccChhhCcCHHHHccCcccccCC
Confidence            347889999988       8999999999999999874


No 155
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=92.94  E-value=0.052  Score=39.57  Aligned_cols=24  Identities=17%  Similarity=0.062  Sum_probs=21.2

Q ss_pred             ChhHHHhhh-------hccccccccccCccc
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++||++       ++|+|+.|+..||||
T Consensus       261 ~~~~~~ll~~~l~~dp~~R~t~~~~l~h~~~  291 (291)
T cd07870         261 PPKAEDLASQMLMMFPKDRISAQDALLHPYF  291 (291)
T ss_pred             ChHHHHHHHHHhCcCcccCcCHHHHhcCCCC
Confidence            557788877       999999999999997


No 156
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=92.90  E-value=0.063  Score=39.30  Aligned_cols=29  Identities=10%  Similarity=0.127  Sum_probs=24.7

Q ss_pred             CCCChhHHHhhh-------hccccc----cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA----GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi----~EIK~HPWVTk   47 (98)
                      +.++++++||++       ++|+|.    .+++.||||-.
T Consensus       220 ~~~~~~~~~li~~~L~~~P~~R~~~~~~~~~~~~h~~f~~  259 (277)
T cd05607         220 QNFTEESKDICRLFLAKKPEDRLGSREKNDDPRKHEFFKT  259 (277)
T ss_pred             ccCCHHHHHHHHHHhccCHhhCCCCccchhhhhcChhhcC
Confidence            467889999988       999999    66889999943


No 157
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=92.90  E-value=0.063  Score=40.84  Aligned_cols=29  Identities=3%  Similarity=0.038  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hcccc------ccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIK------AGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT------i~EIK~HPWVTk   47 (98)
                      +.++..+++||+       ++|+|      +.+|+.||||..
T Consensus       226 ~~~~~~~~~ll~~~L~~dP~~R~~~~~~~~~~~i~~hp~f~~  267 (329)
T cd05618         226 RSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRN  267 (329)
T ss_pred             CCCCHHHHHHHHHHhcCCHHHcCCCCCCCCHHHHhcCCCCCC
Confidence            356778889988       99998      579999999965


No 158
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=92.89  E-value=0.064  Score=40.49  Aligned_cols=31  Identities=13%  Similarity=0.185  Sum_probs=26.7

Q ss_pred             CCCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      .+.++++++|||+       ++|+     ++.+++.||||...
T Consensus       220 ~~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~~l~~h~~~~~~  262 (323)
T cd05584         220 PPYLTPEARDLLKKLLKRNPSSRLGAGPGDAAEVQSHPFFRHV  262 (323)
T ss_pred             CCCCCHHHHHHHHHHcccCHhHcCCCCCCCHHHHhcCCCcCCC
Confidence            3567889999988       8999     89999999999753


No 159
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=92.85  E-value=0.064  Score=37.75  Aligned_cols=26  Identities=4%  Similarity=-0.172  Sum_probs=23.3

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .+++++++|+.       ++|+|+.||..|||+
T Consensus       224 ~~~~~l~~li~~~l~~~p~~Rpt~~~ll~~p~~  256 (256)
T cd08220         224 RYSPDLRQLILSMLNLDPSKRPQLSQIMAQPIC  256 (256)
T ss_pred             CcCHHHHHHHHHHccCChhhCCCHHHHhhCCCC
Confidence            36788999987       999999999999996


No 160
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=92.84  E-value=0.08  Score=38.58  Aligned_cols=31  Identities=3%  Similarity=-0.004  Sum_probs=26.4

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      ..+++++||++       ++|.|+.|+..|||+..-+.
T Consensus       224 ~~~~~~~~li~~~l~~~P~~Rp~~~eil~~~~~~~~~~  261 (279)
T cd06619         224 QFSEKFVHFITQCMRKQPKERPAPENLMDHPFIVQYND  261 (279)
T ss_pred             cCCHHHHHHHHHHhhCChhhCCCHHHHhcCcccccccC
Confidence            46778999988       89999999999999976643


No 161
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=92.84  E-value=0.062  Score=40.93  Aligned_cols=28  Identities=11%  Similarity=0.120  Sum_probs=23.2

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .++.++|||+       ++|+|+.|+..|||+.+.
T Consensus       283 ~~~~~~~li~~~L~~dP~~R~t~~eiL~~~~~~~~  317 (353)
T cd07850         283 KASQARDLLSKMLVIDPEKRISVDDALQHPYINVW  317 (353)
T ss_pred             chhHHHHHHHHHcCCChhhCcCHHHHhcChhHhhc
Confidence            4556788887       899999999999988643


No 162
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=92.75  E-value=0.065  Score=40.36  Aligned_cols=28  Identities=14%  Similarity=0.118  Sum_probs=24.9

Q ss_pred             CCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      .+++++++||+       ++|+     |..||.+||||..
T Consensus       218 ~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~il~h~~~~~  257 (325)
T cd05594         218 TLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAG  257 (325)
T ss_pred             CCCHHHHHHHHHHhhcCHHHhCCCCCCCHHHHhcCCCcCC
Confidence            47788999988       9999     8999999999985


No 163
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=92.73  E-value=0.071  Score=36.70  Aligned_cols=24  Identities=13%  Similarity=-0.011  Sum_probs=21.7

Q ss_pred             CChhHHHhhh-------hccccccccccCcc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSW   44 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPW   44 (98)
                      ++..+.++++       ++|.|+.|+..|||
T Consensus       223 ~~~~~~~~i~~~l~~~p~~R~t~~~~l~~~~  253 (253)
T cd05122         223 WSDEFKDFLKKCLQKNPEKRPTAEQLLKHPF  253 (253)
T ss_pred             cCHHHHHHHHHHccCChhhCCCHHHHhcCCC
Confidence            4788899987       89999999999999


No 164
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=92.71  E-value=0.07  Score=39.49  Aligned_cols=33  Identities=15%  Similarity=0.057  Sum_probs=27.1

Q ss_pred             CCCCCChhHHHhhh-------hcccc---ccccccCccccCCC
Q psy9108          17 TQPANENRGKFLVR-------IVAIK---AGVHKEHSWVTKDG   49 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRIT---i~EIK~HPWVTknG   49 (98)
                      .++.++++++++|+       ++|+|   +.|+..||||+...
T Consensus       238 ~~~~~~~~~~~li~~~l~~~P~~R~~~~~~~~ll~~~~~~~~~  280 (305)
T cd05609         238 GDEALPADAQDLISRLLRQNPLERLGTGGAFEVKQHRFFLGLD  280 (305)
T ss_pred             ccccCCHHHHHHHHHHhccChhhccCccCHHHHHhCccccCCC
Confidence            34467888999988       99998   78999999997753


No 165
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=92.70  E-value=0.068  Score=39.76  Aligned_cols=31  Identities=10%  Similarity=0.031  Sum_probs=27.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      +.++++++++|+       ++|+|+.||..||||.+-+
T Consensus       241 ~~~~~~l~~~i~~~l~~~P~~Rps~~~ll~~~~~~~~~  278 (297)
T cd06659         241 HKISPVLRDFLERMLTREPQERATAQELLDHPFLLQTG  278 (297)
T ss_pred             CCCCHHHHHHHHHHhcCCcccCcCHHHHhhChhhccCC
Confidence            456788899988       8999999999999999774


No 166
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=92.61  E-value=0.068  Score=36.96  Aligned_cols=26  Identities=15%  Similarity=0.112  Sum_probs=22.8

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++..+++++.       ++|.|+.|+..||||
T Consensus       228 ~~~~~l~~~i~~~l~~~p~~Rp~~~~ll~~~~~  260 (260)
T cd06606         228 HLSEEAKDFLRKCLRRDPKKRPTADELLQHPFL  260 (260)
T ss_pred             ccCHHHHHHHHHhCcCChhhCCCHHHHhhCCCC
Confidence            44678888887       899999999999997


No 167
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=92.51  E-value=0.078  Score=39.72  Aligned_cols=30  Identities=13%  Similarity=0.049  Sum_probs=26.0

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +.+++.+++|+.       ++|+|+.++..||||.+.
T Consensus       243 ~~~~~~l~~li~~~l~~~P~~Rp~~~~~l~~~~~~~~  279 (313)
T cd06633         243 NEWTDSFRGFVDYCLQKIPQERPASAELLRHDFVRRD  279 (313)
T ss_pred             cccCHHHHHHHHHHccCChhhCcCHHHHhcCcccCCC
Confidence            346678999988       899999999999999975


No 168
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=92.41  E-value=0.071  Score=39.06  Aligned_cols=29  Identities=17%  Similarity=0.071  Sum_probs=24.9

Q ss_pred             CCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      .++.+++||++       ++|+     |+.|+++||||-.-
T Consensus       221 ~~s~~~~~li~~~l~~~p~~R~~~~~~~~~~ll~~~~~~~~  261 (278)
T cd05606         221 SFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKEHPFFRSL  261 (278)
T ss_pred             cCCHHHHHHHHHHhhcCHHhccCCCCCCHHHHHhCccccCC
Confidence            35778889887       9999     99999999999664


No 169
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=92.39  E-value=0.087  Score=36.80  Aligned_cols=27  Identities=15%  Similarity=0.124  Sum_probs=23.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.+++.++++++       ++|+|+.++..||||
T Consensus       221 ~~~~~~~~~~i~~~l~~~p~~R~~~~~~l~~~~~  254 (254)
T cd06627         221 EGISPELKDFLMQCFQKDPNLRPTAKQLLKHPWI  254 (254)
T ss_pred             CCCCHHHHHHHHHHHhCChhhCcCHHHHhcCCCC
Confidence            456788888887       899999999999997


No 170
>PHA03211 serine/threonine kinase US3; Provisional
Probab=92.35  E-value=0.07  Score=44.20  Aligned_cols=28  Identities=11%  Similarity=-0.072  Sum_probs=24.1

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      .++.+++|||+       ++|+|..|+..||||..
T Consensus       426 ~~~~~~~dli~~mL~~DP~~RPsa~elL~hp~f~~  460 (461)
T PHA03211        426 KLDLDVEYLVCRALTFDGARRPSAAELLRLPLFQS  460 (461)
T ss_pred             cccchHHHHHHHHcccChhhCcCHHHHhhCcccCC
Confidence            45668888877       99999999999999964


No 171
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=92.31  E-value=0.063  Score=39.76  Aligned_cols=29  Identities=7%  Similarity=-0.130  Sum_probs=25.5

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++.++||++       ++|.|+.||..||||.+.
T Consensus       240 ~~~~~l~~li~~~l~~~p~~Rp~~~~il~h~~~~~~  275 (293)
T cd06647         240 KLSAIFRDFLNRCLEMDVEKRGSAKELLQHPFLKIA  275 (293)
T ss_pred             ccCHHHHHHHHHHccCChhhCcCHHHHhcCHHHhcC
Confidence            46778999988       889999999999999754


No 172
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=92.31  E-value=0.11  Score=39.53  Aligned_cols=36  Identities=11%  Similarity=0.027  Sum_probs=29.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcCCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPT   55 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~   55 (98)
                      |.+++.++++|+       ++|+|+.|+..|||+-+. .+|...
T Consensus       258 ~~~~~~~~~li~~~l~~~P~~R~t~~ell~~~~~~~~-~~~~~~  300 (328)
T cd07856         258 KNADPSAIDLLEKMLVFDPQKRISAAEALAHPYLAPY-HDPTDE  300 (328)
T ss_pred             CCCCHHHHHHHHHHcCCChhhCCCHHHHhcCCccccc-cCCccc
Confidence            467888999988       999999999999999655 445443


No 173
>PHA03210 serine/threonine kinase US3; Provisional
Probab=92.27  E-value=0.062  Score=44.22  Aligned_cols=30  Identities=3%  Similarity=-0.128  Sum_probs=25.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      .++++|.|||+       ++|+|..|+..||||....
T Consensus       425 ~~~~~~~~li~kmL~~DP~~Rpsa~elL~hp~f~~~~  461 (501)
T PHA03210        425 GLPADFEYPLVKMLTFDWHLRPGAAELLALPLFSAEE  461 (501)
T ss_pred             CCChHHHHHHHHHhccCcccCcCHHHHhhChhhhcCC
Confidence            35678888876       8999999999999997753


No 174
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=92.22  E-value=0.075  Score=39.51  Aligned_cols=30  Identities=7%  Similarity=-0.138  Sum_probs=25.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..+++.+++|++       ++|.|+.+|..||||-..
T Consensus       239 ~~~~~~~~~li~~~l~~dp~~Rpt~~~il~~~~~~~~  275 (296)
T cd06655         239 EKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLA  275 (296)
T ss_pred             ccCCHHHHHHHHHHhhcChhhCCCHHHHhhChHhhhc
Confidence            457888999987       889999999999999643


No 175
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=92.21  E-value=0.08  Score=40.08  Aligned_cols=30  Identities=17%  Similarity=0.066  Sum_probs=26.1

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      ..+++++++||+       ++|+     ++.++++||||.+.
T Consensus       216 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~~l~h~~~~~~  257 (323)
T cd05595         216 RTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSI  257 (323)
T ss_pred             CCCCHHHHHHHHHHccCCHHHhCCCCCCCHHHHHcCCCcCCC
Confidence            457889999988       9999     99999999999863


No 176
>KOG0599|consensus
Probab=92.20  E-value=0.051  Score=45.78  Aligned_cols=29  Identities=17%  Similarity=0.093  Sum_probs=25.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      -+++++.|||++       .+|||..|...||||..
T Consensus       253 adis~~~KdLIsrlLqVdp~~Ritake~LaHpff~q  288 (411)
T KOG0599|consen  253 ADISATVKDLISRLLQVDPTKRITAKEALAHPFFIQ  288 (411)
T ss_pred             hhccccHHHHHHHHHeeCchhcccHHHHhcChHHHH
Confidence            468889999998       99999999999999943


No 177
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=92.14  E-value=0.095  Score=39.45  Aligned_cols=29  Identities=7%  Similarity=0.151  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hccccc-----cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA-----GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi-----~EIK~HPWVTk   47 (98)
                      ..++++++||++       ++|++.     .+|++||||..
T Consensus       222 ~~~~~~~~~li~~~l~~~P~~R~~~~~~~~~~~~~hp~~~~  262 (324)
T cd05587         222 KSLSKEAVSICKGLLTKHPAKRLGCGPTGERDIREHAFFRR  262 (324)
T ss_pred             CCCCHHHHHHHHHHhhcCHHHcCCCCCCCHHHHhcCCCcCC
Confidence            457889999988       999987     89999999975


No 178
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=92.11  E-value=0.092  Score=39.32  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=24.9

Q ss_pred             CCCChhHHHhhh-------hcccc-----ccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIK-----AGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTk   47 (98)
                      +.+++++++||+       ++|+|     +.+++.||||.+
T Consensus       219 ~~~~~~~~~li~~~l~~~P~~R~~a~~~~~~~~~~~~~~~~  259 (318)
T cd05582         219 QFLSPEAQSLLRALFKRNPANRLGAGPDGVEEIKRHPFFST  259 (318)
T ss_pred             CCCCHHHHHHHHHHhhcCHhHcCCCCCCCHHHHhCCCCcCC
Confidence            457889999988       99999     677999999965


No 179
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=91.80  E-value=0.1  Score=38.53  Aligned_cols=38  Identities=21%  Similarity=0.281  Sum_probs=29.9

Q ss_pred             CCCCChhHHHhhh-------hcccc----ccccccCccccCCCCCcCCCc
Q psy9108          18 QPANENRGKFLVR-------IVAIK----AGVHKEHSWVTKDGAYALPTE   56 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRIT----i~EIK~HPWVTknG~dpLP~E   56 (98)
                      ...+++++++++.       +.|+|    +.|+..||||.. ..+++.+.
T Consensus       254 ~~~~~~~~~~li~~~l~~~p~~R~s~~~~~~~ll~~~~~~~-~~~~~~~~  302 (316)
T cd05574         254 SPPVSSSARDLIRKLLVKDPSKRLGSKRGAAEIKQHPFFRG-VNWALIRH  302 (316)
T ss_pred             ccccCHHHHHHHHHHccCCHhHCCCchhhHHHHHcCchhhc-CChhhccc
Confidence            3347888999988       99999    999999999965 44665543


No 180
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=91.76  E-value=0.083  Score=39.15  Aligned_cols=28  Identities=11%  Similarity=0.016  Sum_probs=25.4

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .++.+++||+       ++|.|+.+|..||||.+.
T Consensus       239 ~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~~~~  273 (307)
T cd06607         239 WSDYFRNFVDSCLQKIPQDRPSSEELLKHRFVLRE  273 (307)
T ss_pred             hCHHHHHHHHHHhcCChhhCcCHHHHhcChhhccc
Confidence            5678899988       899999999999999987


No 181
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=91.73  E-value=0.087  Score=38.72  Aligned_cols=30  Identities=13%  Similarity=0.132  Sum_probs=25.9

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      +.+++.+++|++       ++|+     |+.+++.||||-+-
T Consensus       226 ~~~~~~~~~li~~~l~~~P~~R~~~~~~~~~~l~~~~~~~~~  267 (285)
T cd05605         226 EKFSEAARSICRQLLTKDPGFRLGCRGEGAEEVKAHPFFRTA  267 (285)
T ss_pred             cccCHHHHHHHHHHccCCHHHhcCCCCCCHHHHhcCcCccCC
Confidence            457888999988       9999     88899999999764


No 182
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=91.71  E-value=0.085  Score=40.30  Aligned_cols=29  Identities=14%  Similarity=0.045  Sum_probs=25.1

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      .+++++|||+       ++|+|..|+..||||.+-+
T Consensus       272 ~~~~~~~li~~~L~~dp~~R~t~~e~l~h~~f~~~~  307 (345)
T cd07877         272 ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYH  307 (345)
T ss_pred             CCHHHHHHHHHHcCCChhhcCCHHHHhcChhhhhcC
Confidence            4678889987       8999999999999998653


No 183
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=91.69  E-value=0.11  Score=39.08  Aligned_cols=30  Identities=20%  Similarity=0.258  Sum_probs=25.5

Q ss_pred             CCChhHHHhhh-------hccc----cccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAI----KAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRI----Ti~EIK~HPWVTknG   49 (98)
                      .+++++++|++       ++|+    |+.|+++||||....
T Consensus       220 ~~~~~~~~li~~~L~~~P~~R~~~~~~~~~ll~h~~~~~~~  260 (330)
T cd05586         220 VLSDEGRQFVKGLLNRNPQHRLGAHRDAVELKEHPFFADID  260 (330)
T ss_pred             cCCHHHHHHHHHHcCCCHHHCCCCCCCHHHHhcCccccCCC
Confidence            47888999988       8998    799999999997643


No 184
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=91.63  E-value=0.11  Score=38.59  Aligned_cols=29  Identities=7%  Similarity=-0.144  Sum_probs=25.3

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++.+++|+.       ++|.|+.+|..||||-+-
T Consensus       240 ~~~~~~~~li~~~l~~~p~~Rps~~~il~~~~~~~~  275 (297)
T cd06656         240 RLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLA  275 (297)
T ss_pred             ccCHHHHHHHHHHccCChhhCcCHHHHhcCchhccc
Confidence            46678889887       889999999999999876


No 185
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=91.50  E-value=0.091  Score=37.66  Aligned_cols=26  Identities=12%  Similarity=0.141  Sum_probs=22.3

Q ss_pred             CCChhHHHhhh------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~------~kRITi~EIK~HPWV   45 (98)
                      .+++.++|+++      +.|.|+.||..||||
T Consensus       233 ~~~~~~~~~i~~~l~~p~~Rp~~~~il~~~~~  264 (265)
T cd06652         233 HVSDHCRDFLKRIFVEAKLRPSADELLRHTFV  264 (265)
T ss_pred             hhCHHHHHHHHHHhcChhhCCCHHHHhcCccc
Confidence            45567788887      899999999999998


No 186
>KOG0575|consensus
Probab=91.37  E-value=0.1  Score=46.27  Aligned_cols=40  Identities=15%  Similarity=0.169  Sum_probs=32.5

Q ss_pred             eeeeeeeecCCCCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108           8 IRLRKFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus         8 ~~~~~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      |+...+-++.  .++...+|||+       ..|.|+.+|..|+||+++.
T Consensus       230 Ik~~~Y~~P~--~ls~~A~dLI~~lL~~~P~~Rpsl~~vL~h~Ff~~g~  276 (592)
T KOG0575|consen  230 IKLNEYSMPS--HLSAEAKDLIRKLLRPNPSERPSLDEVLDHPFFKSGF  276 (592)
T ss_pred             HHhcCccccc--ccCHHHHHHHHHHhcCCcccCCCHHHHhcCHhhhCCC
Confidence            4445555555  78899999998       9999999999999996664


No 187
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=91.35  E-value=0.13  Score=38.82  Aligned_cols=30  Identities=10%  Similarity=0.035  Sum_probs=26.3

Q ss_pred             CCCChhHHHhhh-------hccccc-----cccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKA-----GVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi-----~EIK~HPWVTkn   48 (98)
                      ..++++++|||+       ++|+|.     .+++.|||+.+-
T Consensus       217 ~~~~~~~~~li~~~l~~dP~~R~s~~~~~~~~ll~~~~~~~~  258 (318)
T cd05570         217 RWLSKEAKSILKSFLTKNPEKRLGCLPTGEQDIKGHPFFREI  258 (318)
T ss_pred             CcCCHHHHHHHHHHccCCHHHcCCCCCCCHHHHhcCCCcCCC
Confidence            357889999988       999999     999999999764


No 188
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=91.34  E-value=0.13  Score=37.20  Aligned_cols=25  Identities=12%  Similarity=0.019  Sum_probs=22.6

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++++++||+       ++|.|+.||.+|||+
T Consensus       255 ~~~~~~~li~~~l~~~p~~Rps~~ell~~~~~  286 (286)
T cd06638         255 WSNEFNDFIRKCLTKDYEKRPTVSDLLQHVFI  286 (286)
T ss_pred             cCHHHHHHHHHHccCCcccCCCHHHHhhcccC
Confidence            4678999987       999999999999997


No 189
>KOG0671|consensus
Probab=91.20  E-value=0.049  Score=46.45  Aligned_cols=39  Identities=15%  Similarity=0.145  Sum_probs=28.5

Q ss_pred             eeeeeeecCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108           9 RLRKFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus         9 ~~~~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .|+++.-+++++-- +|-|||+       .+|||+.|+..||||+.-
T Consensus       367 pl~~~~~~~d~e~~-~LfDLl~~mL~fDP~~RiTl~EAL~HpFF~~~  412 (415)
T KOG0671|consen  367 PLKKYMLQDDLEHV-QLFDLLRRMLEFDPARRITLREALSHPFFARL  412 (415)
T ss_pred             cHHHHhccCcHHHh-HHHHHHHHHHccCccccccHHHHhcCHHhhcC
Confidence            34444445544432 4778888       999999999999999865


No 190
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=91.10  E-value=0.14  Score=37.32  Aligned_cols=28  Identities=4%  Similarity=-0.256  Sum_probs=25.2

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ++.++.||++       +.|+|+.|+..||||.+.
T Consensus       238 ~~~~~~~li~~~l~~dp~~Rpt~~e~~~~~~~~~~  272 (284)
T cd06620         238 FPEDLRDFVDACLLKDPTERPTPQQLCAMPPFIQA  272 (284)
T ss_pred             cCHHHHHHHHHHhcCCcccCcCHHHHhcCcccccc
Confidence            6678889988       999999999999999876


No 191
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=91.02  E-value=0.16  Score=38.32  Aligned_cols=30  Identities=13%  Similarity=0.170  Sum_probs=24.3

Q ss_pred             CCCCChhHHHhhh-------hcccccc----ccccCccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAG----VHKEHSWVTK   47 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~----EIK~HPWVTk   47 (98)
                      .|.++..+.+||+       ++|+++.    +|+.||||..
T Consensus       216 ~~~~~~~~~~ll~~ll~~~p~~R~~~~~~~~~i~~h~~f~~  256 (325)
T cd05604         216 RPGASLTAWSILEELLEKDRQRRLGAKEDFLEIQEHPFFES  256 (325)
T ss_pred             CCCCCHHHHHHHHHHhccCHHhcCCCCCCHHHHhcCCCcCC
Confidence            3567788888877       8998874    8999999975


No 192
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=91.01  E-value=0.13  Score=37.76  Aligned_cols=30  Identities=20%  Similarity=0.221  Sum_probs=25.3

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTkn   48 (98)
                      +.++++++++++       ++|+     ++.|+..||||..-
T Consensus       219 ~~~~~~l~~li~~~l~~~p~~R~~~~~~~~~~l~~~~~~~~~  260 (290)
T cd05580         219 SFFSPDAKDLIRNLLQVDLTKRLGNLKNGVNDIKNHPWFAGI  260 (290)
T ss_pred             ccCCHHHHHHHHHHccCCHHHccCcccCCHHHHHcCcccccC
Confidence            356789999988       8999     99999999998553


No 193
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=90.95  E-value=0.13  Score=36.77  Aligned_cols=24  Identities=17%  Similarity=0.153  Sum_probs=21.5

Q ss_pred             ChhHHHhhh-------hccccccccccCccc
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      ++.+.++++       ++|+|+.|+..||||
T Consensus       257 ~~~~~~~i~~~l~~~P~~Rp~~~~~l~~~~~  287 (287)
T cd07840         257 DPSALDLLDKLLTLDPKKRISADQALQHEYF  287 (287)
T ss_pred             CHHHHHHHHHHcCCChhhCcCHHHHhhCcCC
Confidence            677888877       999999999999997


No 194
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=90.88  E-value=0.11  Score=39.02  Aligned_cols=31  Identities=19%  Similarity=0.211  Sum_probs=26.7

Q ss_pred             CCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .|.++.++.+|+.       ++|+|+.++..|||+.+=
T Consensus       264 ~~~~~~~l~~li~~~l~~~P~~Rps~~~il~~~~~~~~  301 (337)
T cd07852         264 LPKASDDALDLLKKLLVFNPNKRLTAEEALEHPYVAQF  301 (337)
T ss_pred             ccCCCHHHHHHHHHhccCCcccccCHHHHhhChhhhhh
Confidence            3557889999987       899999999999999764


No 195
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=90.75  E-value=0.15  Score=36.69  Aligned_cols=26  Identities=12%  Similarity=0.093  Sum_probs=23.1

Q ss_pred             CCChhHHHhhh------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~------~kRITi~EIK~HPWV   45 (98)
                      .+++.++|+++      ..|.|.+++..||||
T Consensus       233 ~~~~~~~~~i~~~l~~~~~r~~~~~~~~~~~~  264 (264)
T cd06653         233 GVSDACRDFLKQIFVEEKRRPTAEFLLRHPFV  264 (264)
T ss_pred             ccCHHHHHHHHHHhcCcccCccHHHHhcCCCC
Confidence            46678889888      899999999999997


No 196
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=90.66  E-value=0.16  Score=38.16  Aligned_cols=31  Identities=16%  Similarity=0.178  Sum_probs=26.0

Q ss_pred             CCCCChhHHHhhh-------hccccc----cccccCccccCC
Q psy9108          18 QPANENRGKFLVR-------IVAIKA----GVHKEHSWVTKD   48 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi----~EIK~HPWVTkn   48 (98)
                      .|.++++++|||+       ++|++.    .||.+||||..-
T Consensus       216 ~~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~il~~~~~~~~  257 (323)
T cd05575         216 KPNISVSARHLLEGLLQKDRTKRLGAKDDFLEIKNHVFFSSI  257 (323)
T ss_pred             CCCCCHHHHHHHHHHhhcCHHhCCCCCCCHHHHHcCCCcCCC
Confidence            4667889999987       999998    599999999653


No 197
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=90.49  E-value=0.12  Score=36.40  Aligned_cols=26  Identities=8%  Similarity=-0.004  Sum_probs=23.3

Q ss_pred             CChhHHHhhh-------hccccccccccCcccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      +++.+++|++       +.|.|+.||.+|||+-
T Consensus       228 ~~~~l~~li~~~l~~~p~~R~~~~~ll~~~~~~  260 (264)
T cd06623         228 FSPEFRDFISACLQKDPKKRPSAAELLQHPFIK  260 (264)
T ss_pred             CCHHHHHHHHHHccCChhhCCCHHHHHhCHHHH
Confidence            5777999988       8999999999999994


No 198
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=90.39  E-value=0.2  Score=37.77  Aligned_cols=30  Identities=20%  Similarity=0.309  Sum_probs=26.1

Q ss_pred             CCCCChhHHHhhh-------hcccccc----ccccCccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAG----VHKEHSWVTK   47 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~----EIK~HPWVTk   47 (98)
                      .|.+++.++||++       .+|++..    +|++||||..
T Consensus       216 ~~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~i~~~~~~~~  256 (325)
T cd05602         216 KPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKNHIFFSP  256 (325)
T ss_pred             CCCCCHHHHHHHHHHcccCHHHCCCCCCCHHHHhcCcccCC
Confidence            4678999999988       8999987    8999999964


No 199
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=90.05  E-value=0.19  Score=38.10  Aligned_cols=28  Identities=7%  Similarity=0.116  Sum_probs=23.6

Q ss_pred             CCChhHHHhhh-------hccccc------cccccCccccC
Q psy9108          20 ANENRGKFLVR-------IVAIKA------GVHKEHSWVTK   47 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi------~EIK~HPWVTk   47 (98)
                      .+++.+++|++       ++|+|.      .+|+.||||..
T Consensus       225 ~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~~i~~h~~f~~  265 (327)
T cd05617         225 FLSVKASHVLKGFLNKDPKERLGCQPQTGFSDIKSHTFFRS  265 (327)
T ss_pred             CCCHHHHHHHHHHhccCHHHcCCCCCCCCHHHHHcCCCCCC
Confidence            46788899987       899985      69999999965


No 200
>KOG0615|consensus
Probab=89.98  E-value=0.11  Score=44.93  Aligned_cols=33  Identities=12%  Similarity=0.066  Sum_probs=28.1

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .-.-.|+++..|||.       +.|+|+.|..+||||-.-
T Consensus       404 ~~w~~Iseea~dlI~~mL~VdP~~R~s~~eaL~hpW~~~~  443 (475)
T KOG0615|consen  404 LQWDRISEEALDLINWMLVVDPENRPSADEALNHPWFKDA  443 (475)
T ss_pred             hhhhhhhHHHHHHHHHhhEeCcccCcCHHHHhcChhhhcc
Confidence            344568899999988       999999999999999744


No 201
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=89.83  E-value=0.12  Score=37.55  Aligned_cols=31  Identities=13%  Similarity=0.067  Sum_probs=26.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGA   50 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~   50 (98)
                      .++.++.+|+.       ++|.|+.+|..||||.+.+.
T Consensus       224 ~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~~~~~~  261 (277)
T cd06640         224 EFSKPFKEFIDACLNKDPSFRPTAKELLKHKFIVKNAK  261 (277)
T ss_pred             hhhHHHHHHHHHHcccCcccCcCHHHHHhChHhhhcch
Confidence            35667888877       99999999999999988854


No 202
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=89.83  E-value=0.2  Score=37.71  Aligned_cols=29  Identities=10%  Similarity=0.050  Sum_probs=24.7

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +.+++++.+||+       ++|+     ++.+|+.||||.+
T Consensus       222 ~~~~~~~~~li~~~L~~dP~~R~~~~~~~~~~l~~~~~f~~  262 (324)
T cd05589         222 RFLSREAISIMRRLLRRNPERRLGSGEKDAEDVKKQPFFRD  262 (324)
T ss_pred             CCCCHHHHHHHHHHhhcCHhHcCCCCCCCHHHHhhCCCcCC
Confidence            357888899988       8998     7999999999965


No 203
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=89.36  E-value=0.23  Score=37.04  Aligned_cols=30  Identities=13%  Similarity=0.032  Sum_probs=26.4

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +.++..+++||+       ++|+|+.|+..|||+-+.
T Consensus       237 ~~~~~~~~~li~~cl~~~P~~Rp~~~~ll~~~~~~~~  273 (308)
T cd06634         237 GHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRE  273 (308)
T ss_pred             ccccHHHHHHHHHHhhCCcccCCCHHHHhhCcccccc
Confidence            356778899888       999999999999999986


No 204
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=89.25  E-value=0.16  Score=35.89  Aligned_cols=28  Identities=7%  Similarity=-0.076  Sum_probs=23.9

Q ss_pred             CCCCCChhHHHhhh-------hccccccccccCcc
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKEHSW   44 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~HPW   44 (98)
                      +.+.++.++++|++       +.|.|+.+|..|||
T Consensus       228 ~~~~~~~~~~~li~~~l~~~p~~Rpt~~~il~~~~  262 (262)
T cd06613         228 DKEKWSPVFHDFIKKCLTKDPKKRPTATKLLQHPF  262 (262)
T ss_pred             chhhhhHHHHHHHHHHcCCChhhCCCHHHHhcCCC
Confidence            34456778999988       89999999999999


No 205
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=88.99  E-value=0.25  Score=37.30  Aligned_cols=30  Identities=7%  Similarity=-0.034  Sum_probs=24.8

Q ss_pred             CCCChhHHHhhh-------hcccccc-ccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAG-VHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~-EIK~HPWVTkn   48 (98)
                      +.++++++|||+       ++|+++. +++.||||..-
T Consensus       217 ~~~~~~~~~ll~~~l~~~P~~R~~~~~~l~~h~~~~~~  254 (316)
T cd05592         217 RWISKEAKDCLSKLFERDPTKRLGVDGDIRQHPFFRGI  254 (316)
T ss_pred             CCCCHHHHHHHHHHccCCHHHcCCChHHHHcCcccCCC
Confidence            347788999987       8999985 89999999753


No 206
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=88.96  E-value=0.21  Score=37.35  Aligned_cols=35  Identities=9%  Similarity=-0.016  Sum_probs=28.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYAL   53 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpL   53 (98)
                      +.+++.+++|++       ++|+|+.+|..|||+-.....++
T Consensus       247 ~~~~~~l~~li~~~l~~~p~~Rpt~~~il~~~~~~~~~~~~~  288 (317)
T cd06635         247 NEWSDYFRNFVDSCLQKIPQDRPTSEELLKHMFVLRERPETV  288 (317)
T ss_pred             ccccHHHHHHHHHHccCCcccCcCHHHHHhChhhhccCcccc
Confidence            356778899988       89999999999999988754444


No 207
>KOG0616|consensus
Probab=88.87  E-value=0.25  Score=41.51  Aligned_cols=29  Identities=17%  Similarity=0.216  Sum_probs=23.3

Q ss_pred             CCCChhHHHhhh-------hccc-----cccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAI-----KAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTk   47 (98)
                      +-.+.+++||++       .+|+     ...+||.||||-.
T Consensus       262 ~~fs~~~kdLl~~LL~vD~t~R~gnlknG~~dIk~H~wF~~  302 (355)
T KOG0616|consen  262 SYFSSDAKDLLKKLLQVDLTKRFGNLKNGVEDIKNHPWFKG  302 (355)
T ss_pred             cccCHHHHHHHHHHHhhhhHhhhcCcCCCccccccCccccc
Confidence            456789999988       7774     5678999999963


No 208
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=88.58  E-value=0.15  Score=36.88  Aligned_cols=29  Identities=17%  Similarity=0.058  Sum_probs=24.7

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .++.++.||+.       +.|-|+.+|..|||+.+=
T Consensus       224 ~~~~~~~~li~~~l~~~p~~Rp~~~~il~~~~~~~~  259 (277)
T cd06642         224 QYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRY  259 (277)
T ss_pred             ccCHHHHHHHHHHccCCcccCcCHHHHHHhHHHHHH
Confidence            35667889887       999999999999998764


No 209
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=88.39  E-value=0.23  Score=36.05  Aligned_cols=30  Identities=13%  Similarity=0.006  Sum_probs=25.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +.++.++.|++.       ++|.++.+|..|||+-+-
T Consensus       223 ~~~~~~~~~~i~~~l~~~p~~Rp~~~~~l~~~~~~~~  259 (277)
T cd06641         223 GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIVRF  259 (277)
T ss_pred             cccCHHHHHHHHHHccCChhhCcCHHHHHhCHHHhhh
Confidence            356778899877       899999999999999875


No 210
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=88.18  E-value=0.25  Score=36.28  Aligned_cols=32  Identities=16%  Similarity=0.176  Sum_probs=26.9

Q ss_pred             CCCChhHHHhhh-------hcccc-----ccccccCccccCCCC
Q psy9108          19 PANENRGKFLVR-------IVAIK-----AGVHKEHSWVTKDGA   50 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRIT-----i~EIK~HPWVTknG~   50 (98)
                      +.+++++.+|+.       ++|+|     ..|++.||||..-+.
T Consensus       226 ~~~~~~~~~li~~~l~~~P~~R~~~~~~~~~~l~~~~~~~~~~~  269 (285)
T cd05632         226 AKFSEEAKSICKMLLTKDPKQRLGCQEEGAGEVKRHPFFRNMNF  269 (285)
T ss_pred             ccCCHHHHHHHHHHccCCHhHcCCCcccChHHHHcChhhhcCCH
Confidence            567888999987       99999     789999999977543


No 211
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=87.96  E-value=0.34  Score=34.65  Aligned_cols=26  Identities=12%  Similarity=-0.080  Sum_probs=23.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCcc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSW   44 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPW   44 (98)
                      ..++..++||++       ++|.|+.||..|+|
T Consensus       235 ~~~~~~~~~li~~~l~~~P~~Rp~~~~il~~l~  267 (267)
T cd06646         235 TKWSSTFHNFVKISLTKNPKKRPTAERLLTHLF  267 (267)
T ss_pred             cccCHHHHHHHHHHhhCChhhCcCHHHHhcCCC
Confidence            356789999988       89999999999998


No 212
>KOG0659|consensus
Probab=87.85  E-value=0.33  Score=40.25  Aligned_cols=30  Identities=20%  Similarity=0.181  Sum_probs=26.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |+.+++.-|||.       .+|||..|..+||||+.-
T Consensus       251 ~aas~d~ldLl~~m~~ynP~~Rita~qaL~~~yf~~~  287 (318)
T KOG0659|consen  251 PAASSDALDLLSKMLTYNPKKRITASQALKHPYFKSL  287 (318)
T ss_pred             ccccHHHHHHHHhhhccCchhcccHHHHhcchhhhcC
Confidence            667888899988       999999999999999973


No 213
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=87.74  E-value=0.34  Score=36.47  Aligned_cols=29  Identities=10%  Similarity=0.075  Sum_probs=24.3

Q ss_pred             CCCChhHHHhhh-------hccccc-----cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA-----GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi-----~EIK~HPWVTk   47 (98)
                      ..++++++||++       ++|++.     .+|++||||-.
T Consensus       222 ~~~s~~~~~li~~~l~~~p~~R~~~~~~~~~~i~~h~~~~~  262 (323)
T cd05616         222 KSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRY  262 (323)
T ss_pred             CcCCHHHHHHHHHHcccCHHhcCCCCCCCHHHHhcCCCcCC
Confidence            357888999988       899985     79999999964


No 214
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=87.19  E-value=0.35  Score=32.83  Aligned_cols=25  Identities=20%  Similarity=0.194  Sum_probs=22.7

Q ss_pred             CChhHHHhhh-------hccccccccccCccc
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +++++.++++       +.|.|+.++.+||||
T Consensus       213 ~~~~~~~~i~~~l~~~p~~Rp~~~~~~~~~~~  244 (244)
T smart00220      213 ISPEAKDLIRKLLVKDPEKRLTAEEALQHPFF  244 (244)
T ss_pred             CCHHHHHHHHHHccCCchhccCHHHHhhCCCC
Confidence            7788888877       899999999999997


No 215
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=86.39  E-value=0.46  Score=35.97  Aligned_cols=29  Identities=7%  Similarity=0.140  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccc-----cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA-----GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi-----~EIK~HPWVTk   47 (98)
                      +.+++++++|++       ++|++.     .+|+.||||..
T Consensus       222 ~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~~i~~h~~f~~  262 (323)
T cd05615         222 KSLSKEAVSICKGLMTKHPSKRLGCGPEGERDIREHAFFRR  262 (323)
T ss_pred             ccCCHHHHHHHHHHcccCHhhCCCCCCCCHHHHhcCcccCC
Confidence            457888899887       899985     68999999985


No 216
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=85.85  E-value=0.51  Score=35.82  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=23.4

Q ss_pred             CCCChhHHHhhh---------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR---------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~---------~kRITi~EIK~HPWVTk   47 (98)
                      ++++++++||++         ..|.++.+++.||||..
T Consensus       234 ~~~~~~~~~li~~ll~~~~~~~~~~~~~~~~~h~~f~~  271 (331)
T cd05624         234 TDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEG  271 (331)
T ss_pred             ccCCHHHHHHHHHHccCchhhcCCCCHHHHhcCCCcCC
Confidence            357889999986         22579999999999964


No 217
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=84.91  E-value=0.58  Score=34.02  Aligned_cols=29  Identities=10%  Similarity=0.106  Sum_probs=23.2

Q ss_pred             CCChhHHHhhh-------hccccc---cccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKA---GVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi---~EIK~HPWVTkn   48 (98)
                      .++.++++|++       ++|+|+   .++.+|||+.+-
T Consensus       234 ~~~~~l~~li~~~l~~~p~~R~t~~~~~~~l~~~~~~~~  272 (288)
T cd05583         234 TMSAEARDFIQKLLEKDPKKRLGANGADEIKNHPFFQGI  272 (288)
T ss_pred             ccCHHHHHHHHHHhcCCHhhccCcchHHHHhcCcccccC
Confidence            35678888877       999995   577999999654


No 218
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=84.01  E-value=0.63  Score=32.92  Aligned_cols=27  Identities=11%  Similarity=-0.075  Sum_probs=23.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +.++.++++++.       +.|+++.|+..|||+
T Consensus       223 ~~~~~~~~~~i~~~l~~~p~~R~s~~~ll~~~~l  256 (256)
T cd08221         223 SVYSSELISLVHSLLQQDPEKRPTADEVLDQPLL  256 (256)
T ss_pred             cccCHHHHHHHHHHcccCcccCCCHHHHhhCcCC
Confidence            556788999887       899999999999995


No 219
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=84.01  E-value=0.59  Score=32.83  Aligned_cols=26  Identities=4%  Similarity=-0.208  Sum_probs=23.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .++.+++++++       +.|.++.||..|||+
T Consensus       224 ~~~~~~~~~i~~~l~~~p~~Rp~~~~ll~~~~~  256 (256)
T cd08529         224 MYSQQLAQLIDQCLTKDYRQRPDTFQLLRNPSL  256 (256)
T ss_pred             ccCHHHHHHHHHHccCCcccCcCHHHHhhCCCC
Confidence            56778899988       999999999999995


No 220
>KOG0670|consensus
Probab=83.82  E-value=0.32  Score=43.85  Aligned_cols=34  Identities=18%  Similarity=0.178  Sum_probs=29.2

Q ss_pred             eecCCCCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          14 YVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      |--|+|.+=-.|+|||.       ++|||+.+-..||+||.
T Consensus       711 ~~deq~~~~~~~rdLLdkml~LdP~KRit~nqAL~HpFi~~  751 (752)
T KOG0670|consen  711 LPDEQPKIVQQLRDLLDKMLILDPEKRITVNQALKHPFITE  751 (752)
T ss_pred             CCchhHHHHHHHHHHHHHHhccChhhcCCHHHHhcCCcccC
Confidence            45566777778999988       99999999999999985


No 221
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=83.72  E-value=0.74  Score=33.49  Aligned_cols=30  Identities=17%  Similarity=0.154  Sum_probs=25.7

Q ss_pred             CCChhHHHhhh-------hccc-----cccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAI-----KAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRI-----Ti~EIK~HPWVTknG   49 (98)
                      .++..+++|++       +.|+     ++.++..||||.+.+
T Consensus       234 ~~~~~~~~ll~~~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~  275 (290)
T cd05613         234 EMSALAKDIIQRLLMKDPKKRLGCGPSDADEIKKHPFFQKIN  275 (290)
T ss_pred             cCCHHHHHHHHHHhcCCHHHhcCCCCCCHHHHHcCcccccCC
Confidence            46778888887       8998     899999999998874


No 222
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=83.53  E-value=0.83  Score=34.23  Aligned_cols=29  Identities=14%  Similarity=-0.019  Sum_probs=23.2

Q ss_pred             CCCChhHHHhhh-------hccccc----cccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKA----GVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi----~EIK~HPWVTk   47 (98)
                      +..+.++++|+.       .+|++.    .||++|||+..
T Consensus       217 ~~~~~~~~~li~~~l~~~p~~R~~~~~~~~~~~~~~~~~~  256 (321)
T cd05603         217 GGKTVAACDLLVGLLHKDQRRRLGAKADFLEIKNHVFFSP  256 (321)
T ss_pred             CCCCHHHHHHHHHHccCCHhhcCCCCCCHHHHhCCCCcCC
Confidence            456778888877       789875    49999999975


No 223
>KOG0666|consensus
Probab=83.09  E-value=0.82  Score=39.16  Aligned_cols=27  Identities=37%  Similarity=0.458  Sum_probs=23.6

Q ss_pred             hccccccccccCccccCCCCCcCCCcc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      .+|||..+-.+|++||.+.-.|+|.++
T Consensus       326 ~kRIta~qAleh~yF~~d~lpp~pt~~  352 (438)
T KOG0666|consen  326 IKRITAEQALEHPYFTEDPLPPLPTSD  352 (438)
T ss_pred             hhhccHHHHhcccccccCCCCCCcccc
Confidence            999999999999999999777776644


No 224
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=82.33  E-value=0.76  Score=32.18  Aligned_cols=27  Identities=11%  Similarity=0.023  Sum_probs=23.0

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      +..++++++++.       +.|+|+.|+..||-+
T Consensus       223 ~~~~~~~~~li~~~l~~~p~~Rp~~~~~l~~p~~  256 (256)
T cd08530         223 PIYSQDLQNFIRSMLQVKPKLRPNCDKILASPAV  256 (256)
T ss_pred             hhhCHHHHHHHHHHcCCCcccCCCHHHHhcCCCC
Confidence            356778899987       999999999999964


No 225
>KOG0198|consensus
Probab=81.80  E-value=0.81  Score=37.12  Aligned_cols=28  Identities=18%  Similarity=0.179  Sum_probs=25.3

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ++++.+|.|+       ++|-|..|+.+|||+.++
T Consensus       248 ls~~a~~Fl~~C~~~~p~~Rpta~eLL~hpf~~~~  282 (313)
T KOG0198|consen  248 LSDEAKDFLRKCFKRDPEKRPTAEELLEHPFLKQN  282 (313)
T ss_pred             cCHHHHHHHHHHhhcCcccCcCHHHHhhChhhhcc
Confidence            6668888888       899999999999999987


No 226
>KOG0667|consensus
Probab=81.28  E-value=0.92  Score=40.26  Aligned_cols=24  Identities=13%  Similarity=0.081  Sum_probs=21.2

Q ss_pred             hhHHHhhh-------hccccccccccCcccc
Q psy9108          23 NRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        23 ~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      ..|.|+|.       .+|||-.|...|||+|
T Consensus       476 ~~F~dflk~~L~~dP~~R~tp~qal~Hpfl~  506 (586)
T KOG0667|consen  476 KLFIDFLKRCLEWDPAERITPAQALNHPFLT  506 (586)
T ss_pred             HHHHHHHHHHhccCchhcCCHHHHhcCcccc
Confidence            45677766       9999999999999999


No 227
>KOG0581|consensus
Probab=80.11  E-value=0.79  Score=38.63  Aligned_cols=28  Identities=14%  Similarity=-0.008  Sum_probs=25.4

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      .+++|++.+.       ..|=|..|+.+|||+.+-
T Consensus       307 fS~ef~~FV~~CL~Kdp~~R~s~~qLl~Hpfi~~~  341 (364)
T KOG0581|consen  307 FSPEFRSFVSCCLRKDPSERPSAKQLLQHPFIKKF  341 (364)
T ss_pred             CCHHHHHHHHHHhcCCcccCCCHHHHhcCHHHhhc
Confidence            5667999988       999999999999999987


No 228
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=79.42  E-value=0.93  Score=39.06  Aligned_cols=30  Identities=7%  Similarity=-0.096  Sum_probs=24.6

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..++..++++++       ++|+|+.|+..||||...
T Consensus       604 ~~~~~~~~~~l~~lL~~dP~~R~ta~e~l~h~~~~~~  640 (669)
T cd05610         604 EKLSVNAQNAIEILLTMDPTKRAGLKELKQHPLFHGV  640 (669)
T ss_pred             ccCCHHHHHHHHHHcccChhHCcCHHHHHhCHhhcCC
Confidence            356677888776       999999999999999553


No 229
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=78.05  E-value=1.2  Score=36.94  Aligned_cols=31  Identities=6%  Similarity=-0.115  Sum_probs=27.0

Q ss_pred             CCCCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      -.+.+++++++|++       ++|.|+.|+..|||+-.
T Consensus       265 ~~~~~~~~l~~li~~~L~~dP~~RPs~~ell~~p~~~~  302 (496)
T PTZ00283        265 LPPSISPEMQEIVTALLSSDPKRRPSSSKLLNMPICKL  302 (496)
T ss_pred             CCCCCCHHHHHHHHHHcccChhhCcCHHHHHhCHHHHH
Confidence            45678899999988       99999999999999754


No 230
>KOG0596|consensus
Probab=77.05  E-value=1.5  Score=39.55  Aligned_cols=30  Identities=10%  Similarity=0.102  Sum_probs=24.3

Q ss_pred             HHHhhh-------hccccccccccCccccCCCCCcCCCcc
Q psy9108          25 GKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        25 ~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      +.|||.       .+|+|++|+..||+++--   |+|.+.
T Consensus       603 li~~mK~CL~rdPkkR~si~eLLqhpFl~~~---~i~~~~  639 (677)
T KOG0596|consen  603 LIDVMKCCLARDPKKRWSIPELLQHPFLQIQ---PIPVEQ  639 (677)
T ss_pred             HHHHHHHHHhcCcccCCCcHHHhcCcccccc---cccchH
Confidence            788887       999999999999999763   455443


No 231
>KOG0660|consensus
Probab=76.49  E-value=1.4  Score=37.04  Aligned_cols=41  Identities=22%  Similarity=0.238  Sum_probs=31.3

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCCCCCcCCCcccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALPTEEENCQL   62 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP~Eeenc~~   62 (98)
                      |..+++.-||+.       .+|||..|-..||++-.=   --|++|--|..
T Consensus       280 p~a~p~AidLlekmL~fdP~kRita~eAL~hPYl~~~---hdp~dEP~~~~  327 (359)
T KOG0660|consen  280 PNANPLAIDLLEKMLVFDPKKRITAEEALAHPYLAPY---HDPEDEPVCQP  327 (359)
T ss_pred             CCCCHHHHHHHHHHhccCccccCCHHHHhcChhhhhh---cCCccCCCCCC
Confidence            567778888887       999999999999999753   34555555553


No 232
>KOG0663|consensus
Probab=71.50  E-value=2.6  Score=36.17  Aligned_cols=28  Identities=18%  Similarity=0.116  Sum_probs=25.6

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +++..-|||.       .+|||..|-.+|+||...
T Consensus       333 lse~g~~Lln~llt~dP~kR~tA~~~L~h~~F~e~  367 (419)
T KOG0663|consen  333 LSEQGFDLLNKLLTYDPGKRITAEDGLKHEYFRET  367 (419)
T ss_pred             cchhHHHHHHHHhccCccccccHHHhhcccccccC
Confidence            6688889988       999999999999999986


No 233
>smart00750 KIND kinase non-catalytic C-lobe domain. It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Probab=70.21  E-value=1.2  Score=30.08  Aligned_cols=24  Identities=13%  Similarity=-0.179  Sum_probs=21.5

Q ss_pred             hHHHhhh-------hccccccccccCccccC
Q psy9108          24 RGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        24 ~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      .++++++       ++|.|+.|+.+|+|+..
T Consensus       140 ~~~~~i~~cl~~~p~~Rp~~~~ll~~~~~~~  170 (176)
T smart00750      140 SFADFMRVCASRLPQRREAANHYLAHCRALF  170 (176)
T ss_pred             hHHHHHHHHHhcccccccCHHHHHHHHHHHH
Confidence            5888887       99999999999999874


No 234
>KOG0598|consensus
Probab=69.91  E-value=2.7  Score=35.43  Aligned_cols=32  Identities=16%  Similarity=0.225  Sum_probs=25.8

Q ss_pred             cCCCC-CChhHHHhhh-------hccc----cccccccCccccC
Q psy9108          16 TTQPA-NENRGKFLVR-------IVAI----KAGVHKEHSWVTK   47 (98)
Q Consensus        16 ~d~p~-i~~~~kdL~~-------~kRI----Ti~EIK~HPWVTk   47 (98)
                      .--|. ++++.+||++       ++|+    ...+|+.||||-.
T Consensus       243 ~~~p~~ls~~ardll~~LL~rdp~~RLg~~~d~~~ik~HpfF~~  286 (357)
T KOG0598|consen  243 PLPPGYLSEEARDLLKKLLKRDPRQRLGGPGDAEEIKRHPFFKG  286 (357)
T ss_pred             CCCCccCCHHHHHHHHHHhccCHHHhcCCCCChHHhhcCccccc
Confidence            33456 8889999988       8885    7899999999853


No 235
>COG1731 Archaeal riboflavin synthase [Coenzyme metabolism]
Probab=69.14  E-value=1.1  Score=33.87  Aligned_cols=60  Identities=27%  Similarity=0.308  Sum_probs=38.9

Q ss_pred             hHHHhhh---hccccccccccCccccCCCCCcCCCcccCccce------eeChhhhhccc-ccCCChhHHHHHHHHhhh
Q psy9108          24 RGKFLVR---IVAIKAGVHKEHSWVTKDGAYALPTEEENCQLV------TVSEDDVRNVI-KNFPKLDTLILIKTMLKN   92 (98)
Q Consensus        24 ~~kdL~~---~kRITi~EIK~HPWVTknG~dpLP~Eeenc~~v------evteEEv~~av-qsIp~L~tliliK~Mlk~   92 (98)
                      .+|.++.   -.|+|+|.||.-||--|.    | .||+.|..|      ..|+.|-.++. .|+    -||++--|-.+
T Consensus        23 ~lk~~~~~~~i~R~TVPGIKdlpvaakr----L-ieeeGCd~Vi~lG~~G~t~~Dk~~~~~aS~----GLi~~QlmTn~   92 (154)
T COG1731          23 ELKKLLPGIKIKRYTVPGIKDLPVAAKR----L-IEEEGCDIVIALGWVGPTEKDKYSYLAASI----GLIMAQLMTNK   92 (154)
T ss_pred             HHHhhCCCCceEEeeCCCcccChHHHHH----H-HHhcCCcEEEEccCcCcchhhHHHHHHHhh----HHHHHHHHcCC
Confidence            4555554   899999999999998887    4 467789852      24666665443 232    24555544433


No 236
>KOG0607|consensus
Probab=66.82  E-value=2.6  Score=36.34  Aligned_cols=30  Identities=20%  Similarity=0.276  Sum_probs=26.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      -.|+++.|||++       ..|....+..+||||..-
T Consensus       331 ahIS~eakdlisnLlvrda~~rlsa~~vlnhPw~~~~  367 (463)
T KOG0607|consen  331 AHISSEAKDLISNLLVRDAKQRLSAAQVLNHPWVQRC  367 (463)
T ss_pred             HHhhHHHHHHHHHHHhccHHhhhhhhhccCCcccccc
Confidence            468899999998       889999999999999765


No 237
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=64.54  E-value=4.4  Score=29.61  Aligned_cols=27  Identities=15%  Similarity=-0.075  Sum_probs=22.6

Q ss_pred             CCChhHHHhhh-------hcccccccccc------Ccccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKE------HSWVT   46 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~------HPWVT   46 (98)
                      .+++.++++++       ++|.|+.++.+      ||||-
T Consensus       245 ~~~~~~~~li~~~l~~~p~~Rps~~~ll~~l~~~~~~~~~  284 (288)
T cd05061         245 NCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFP  284 (288)
T ss_pred             CCCHHHHHHHHHHcCCChhHCcCHHHHHHHHHhhcCCCCC
Confidence            45678999987       89999999976      99874


No 238
>KOG0594|consensus
Probab=64.27  E-value=3.5  Score=34.11  Aligned_cols=37  Identities=16%  Similarity=0.087  Sum_probs=30.7

Q ss_pred             eeecCCCCCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          13 FYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      .+..-.|..+++..||+.       .+||+.....+||||...+
T Consensus       266 ~l~~~~~~~~~~~~dll~~~L~y~p~~R~Sa~~al~h~yf~~~~  309 (323)
T KOG0594|consen  266 DLSSILPKLDPDGIELLSKLLQYDPAKRISAKGALTHPYFSELP  309 (323)
T ss_pred             chHHhccccCccHHHHHHHHhccCcccCcCHHHHhcChhhcccc
Confidence            345556777788888877       7999999999999998884


No 239
>KOG0665|consensus
Probab=64.20  E-value=3.5  Score=35.01  Aligned_cols=24  Identities=13%  Similarity=0.149  Sum_probs=21.4

Q ss_pred             hhHHHhhh-------hccccccccccCcccc
Q psy9108          23 NRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        23 ~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      ..+.||++       ++||.+.++..||++.
T Consensus       284 ~~ardll~~MLvi~pe~Risv~daL~HPY~~  314 (369)
T KOG0665|consen  284 SLARDLLSKMLVIDPEKRISVDDALRHPYIK  314 (369)
T ss_pred             HHHHHHHHHhhccChhhcccHHHHhcCCeee
Confidence            36688888       9999999999999886


No 240
>KOG4717|consensus
Probab=62.47  E-value=4.3  Score=37.15  Aligned_cols=35  Identities=14%  Similarity=0.188  Sum_probs=27.8

Q ss_pred             eeeecCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          12 KFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        12 ~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |+-|++  -++.+-+|||.       .+|-++.||-.|||+...
T Consensus       235 KYtvPs--hvS~eCrdLI~sMLvRdPkkRAslEeI~s~~Wlq~~  276 (864)
T KOG4717|consen  235 KYTVPS--HVSKECRDLIQSMLVRDPKKRASLEEIVSTSWLQAG  276 (864)
T ss_pred             cccCch--hhhHHHHHHHHHHHhcCchhhccHHHHhccccccCC
Confidence            344443  36778899987       999999999999999654


No 241
>KOG1290|consensus
Probab=57.22  E-value=5.3  Score=35.67  Aligned_cols=26  Identities=12%  Similarity=0.093  Sum_probs=21.0

Q ss_pred             hHHHhhh-------hccccccccccCccccCCC
Q psy9108          24 RGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        24 ~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      +|.|.|.       +||+|..+..+|||+-..+
T Consensus       525 ~fsdFL~PmLef~PeKR~tA~~cl~hPwLn~~~  557 (590)
T KOG1290|consen  525 QFSDFLSPMLEFDPEKRPTAAQCLKHPWLNPVA  557 (590)
T ss_pred             HHHHHHHHHHhcCccccccHHHHhcCccccCCC
Confidence            4556555       9999999999999997653


No 242
>KOG0579|consensus
Probab=56.23  E-value=5.8  Score=37.26  Aligned_cols=27  Identities=11%  Similarity=0.019  Sum_probs=23.3

Q ss_pred             ChhHHHhhh-------hccccccccccCccccCC
Q psy9108          22 ENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        22 ~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      +-.|+|.|.       ..|-+.++|.+||||++-
T Consensus       262 s~~F~DfLk~cL~Knp~~Rp~aaqll~Hpfv~~~  295 (1187)
T KOG0579|consen  262 SRSFSDFLKRCLVKNPRNRPPAAQLLKHPFVQNA  295 (1187)
T ss_pred             hhHHHHHHHHHHhcCCccCCCHHHHhhCcccccC
Confidence            447888877       899999999999999954


No 243
>PLN00181 protein SPA1-RELATED; Provisional
Probab=55.89  E-value=5.7  Score=34.60  Aligned_cols=18  Identities=0%  Similarity=-0.029  Sum_probs=16.8

Q ss_pred             hccccccccccCccccCC
Q psy9108          31 IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTkn   48 (98)
                      .+|.|+.||.+||||...
T Consensus       254 ~~Rps~~eil~h~~~~~~  271 (793)
T PLN00181        254 SCRPSMSELLQSEFINEP  271 (793)
T ss_pred             hhCcChHHHhhchhhhhh
Confidence            899999999999999874


No 244
>KOG0586|consensus
Probab=55.28  E-value=5.3  Score=35.74  Aligned_cols=28  Identities=11%  Similarity=-0.021  Sum_probs=23.4

Q ss_pred             CChhHHHhhh-------hccccccccccCccccCC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ++-+.++||+       .+|.|+.+|+.|.|.--.
T Consensus       278 ms~dce~lLrk~lvl~Pskr~~~dqim~~~W~n~~  312 (596)
T KOG0586|consen  278 MSCDCEDLLRKFLVLNPSKRGPCDQIMKDRWRNDL  312 (596)
T ss_pred             eechhHHHHHHhhccCccccCCHHHhhhhcccchh
Confidence            4556778877       999999999999998655


No 245
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=54.85  E-value=5.9  Score=32.30  Aligned_cols=29  Identities=7%  Similarity=-0.070  Sum_probs=25.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      ..+++++++||+       ++|.|+.++..|||+..
T Consensus       293 ~~~s~~~~~li~~~L~~dP~~Rps~~~~l~~~~~~~  328 (478)
T PTZ00267        293 CPVSSGMKALLDPLLSKNPALRPTTQQLLHTEFLKY  328 (478)
T ss_pred             ccCCHHHHHHHHHHhccChhhCcCHHHHHhCHHHHH
Confidence            357889999988       99999999999999853


No 246
>PRK14380 hypothetical protein; Provisional
Probab=53.56  E-value=9.2  Score=26.03  Aligned_cols=22  Identities=23%  Similarity=0.471  Sum_probs=17.4

Q ss_pred             hccccccccccCccccCCCCCcCCCcc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      .+||    ++-|||. ++|-||+|..-
T Consensus        58 ~~Ri----lRC~P~~-~gG~Dpvp~~~   79 (81)
T PRK14380         58 LNRL----SRCHPWS-KGGYDPLFPND   79 (81)
T ss_pred             HHHH----HhCCCCC-CCCcCCCCCCC
Confidence            6676    6889998 77899999643


No 247
>PF05931 AgrD:  Staphylococcal AgrD protein;  InterPro: IPR009229 This family consists of several AgrD proteins from many Staphylococcus species. The agr locus was initially described in Staphylococcus aureus as an element controlling the production of exoproteins implicated in virulence. Its pattern of action has been shown to be complex, upregulating certain extracellular toxins and enzymes expressed post-exponentially and repressing some exponential-phase surface components. AgrD encodes the precursor of the autoinducing peptide (AIP).The AIP derived from AgrD by the action of AgrB interacts with AgrC in the membrane to activate AgrA, which upregulates transcription both from promoter P2, amplifying the response, and from P3, initiating the production of a novel effector: RNAIII. In S. aureus, delta-hemolysin is the only translation product of RNA III and is not involved in the regulatory functions of the transcript, which is therefore the primary agent for modulating the expression of other operons controlled by agr [].
Probab=53.43  E-value=8.1  Score=23.74  Aligned_cols=14  Identities=14%  Similarity=0.024  Sum_probs=12.4

Q ss_pred             ecCCCCCChhHHHh
Q psy9108          15 VTTQPANENRGKFL   28 (98)
Q Consensus        15 ~~d~p~i~~~~kdL   28 (98)
                      ..|||.|+++|.+|
T Consensus        30 ~~DEpEVP~ELt~l   43 (45)
T PF05931_consen   30 YFDEPEVPKELTKL   43 (45)
T ss_pred             eccCCcCcHHHHhh
Confidence            46999999999887


No 248
>KOG0662|consensus
Probab=52.59  E-value=7  Score=31.68  Aligned_cols=30  Identities=20%  Similarity=0.309  Sum_probs=25.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      |.++...+||++       .+||...+-.+||+|+.-
T Consensus       253 p~lns~grdllqkll~cnp~qrisaeaalqhpyf~d~  289 (292)
T KOG0662|consen  253 PKLNSTGRDLLQKLLKCNPAQRISAEAALQHPYFSDF  289 (292)
T ss_pred             hhhcchhHHHHHHHhccCcccccCHHHHhcCcccccc
Confidence            566677788888       999999999999999864


No 249
>PF04823 Herpes_UL49_2:  Herpesvirus UL49 tegument protein;  InterPro: IPR006908 This is a family of herpesvirus UL49 tegument proteins. It was shown that interactions between herpesvirus envelope and tegument proteins may play a role in secondary envelopment during herpesvirus virion maturation.
Probab=49.69  E-value=10  Score=26.80  Aligned_cols=22  Identities=14%  Similarity=0.229  Sum_probs=19.3

Q ss_pred             CCCCCChhHHHhhh--hccccccc
Q psy9108          17 TQPANENRGKFLVR--IVAIKAGV   38 (98)
Q Consensus        17 d~p~i~~~~kdL~~--~kRITi~E   38 (98)
                      +-|..+++|.+||.  .-|||+.|
T Consensus        64 ~pPrtneeLd~lL~~a~IrItV~E   87 (96)
T PF04823_consen   64 NPPRTNEELDRLLEAAVIRITVCE   87 (96)
T ss_pred             CCCCChHHHHHHHHhceEEEEecc
Confidence            45889999999999  88999876


No 250
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=48.76  E-value=9.1  Score=27.71  Aligned_cols=24  Identities=8%  Similarity=-0.240  Sum_probs=19.7

Q ss_pred             CCCCCChhHHHhhh-------hccccccccc
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHK   40 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK   40 (98)
                      ..+.+++++++|++       ++|+|+.||.
T Consensus       261 ~~~~~~~~l~~li~~cl~~~p~~Rpt~~el~  291 (296)
T cd05051         261 RPPNCPKDIYELMLECWRRDEEDRPTFREIH  291 (296)
T ss_pred             CccCCCHHHHHHHHHHhccChhcCCCHHHHH
Confidence            34566789999988       8999999994


No 251
>KOG0590|consensus
Probab=48.45  E-value=7.4  Score=33.98  Aligned_cols=18  Identities=11%  Similarity=0.163  Sum_probs=17.1

Q ss_pred             hccccccccccCccccCC
Q psy9108          31 IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTkn   48 (98)
                      .+||||.+|.+-+||-..
T Consensus       574 ~~R~ti~~i~~d~W~~~i  591 (601)
T KOG0590|consen  574 TKRITIEQILNDEWIRSI  591 (601)
T ss_pred             hheecHHHHhhChHhhhc
Confidence            999999999999999876


No 252
>PF13170 DUF4003:  Protein of unknown function (DUF4003)
Probab=47.58  E-value=2.3  Score=34.02  Aligned_cols=27  Identities=26%  Similarity=0.608  Sum_probs=17.5

Q ss_pred             ccCccccCCCCCcCCCcccCccceeeChhhhhc
Q psy9108          40 KEHSWVTKDGAYALPTEEENCQLVTVSEDDVRN   72 (98)
Q Consensus        40 K~HPWVTknG~dpLP~Eeenc~~vevteEEv~~   72 (98)
                      +.|||+|...-.|+      |.+...+++++..
T Consensus       131 k~H~fLTs~~D~~~------a~lLA~~~~~~e~  157 (297)
T PF13170_consen  131 KKHPFLTSPEDYPF------AALLAMTSEDVEE  157 (297)
T ss_pred             HhCccccCccchhH------HHHHhcccccHHH
Confidence            57999999977776      4444444444443


No 253
>PF05250 UPF0193:  Uncharacterised protein family (UPF0193);  InterPro: IPR007914 This family of proteins is functionally uncharacterised.
Probab=47.03  E-value=14  Score=29.00  Aligned_cols=56  Identities=14%  Similarity=0.176  Sum_probs=47.2

Q ss_pred             CCCCCcceeeeeeeecCCCCCChhHHHhhh----hccccccccccCccccCCCCCcCCCcc
Q psy9108           1 MKWDSKPIRLRKFYVTTQPANENRGKFLVR----IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus         1 ~~~~~~~~~~~~~~~~d~p~i~~~~kdL~~----~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      +.|-+.+|-...+|-+..+..+.+-+|||+    +..+|+-+=++---=.++| ++||...
T Consensus         3 ~~~~~~~V~~Gg~f~~~~a~ySkeTq~LLk~mM~ESKLT~fQqr~i~~~lk~G-~aLP~~~   62 (212)
T PF05250_consen    3 SQWRSQRVAKGGLFHPPKAQYSKETQELLKVMMKESKLTNFQQRQIMDSLKRG-EALPLPC   62 (212)
T ss_pred             cccccccccCCCccCCCCCCCCHHHHHHHHHHHHHccCcHHHHHHHHHhccCC-CCCCCCC
Confidence            478899998888898999999999988888    8899988887777778888 7888743


No 254
>KOG0669|consensus
Probab=46.69  E-value=11  Score=31.74  Aligned_cols=29  Identities=24%  Similarity=0.330  Sum_probs=23.5

Q ss_pred             hhHHHhhh-------hccccccccccCccccCCCCCcCC
Q psy9108          23 NRGKFLVR-------IVAIKAGVHKEHSWVTKDGAYALP   54 (98)
Q Consensus        23 ~~~kdL~~-------~kRITi~EIK~HPWVTknG~dpLP   54 (98)
                      ++.-|||.       .+||+-.+..+|.||-++   |+|
T Consensus       289 ~~a~dLle~ll~~DP~kR~~ad~alnh~~F~kd---p~p  324 (376)
T KOG0669|consen  289 DEALDLLEKLLKLDPTKRIDADQALNHDFFWKD---PMP  324 (376)
T ss_pred             hhHHHHHHHHhccCcccCcchHhhhchhhhhcC---Ccc
Confidence            34556655       999999999999999887   565


No 255
>KOG0578|consensus
Probab=45.89  E-value=11  Score=33.60  Aligned_cols=27  Identities=15%  Similarity=-0.011  Sum_probs=24.5

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      .-++..|+|.|.       ++|-+..|+.+||++
T Consensus       493 ~klS~~~kdFL~~cL~~dv~~RasA~eLL~HpFl  526 (550)
T KOG0578|consen  493 EKLSPELKDFLDRCLVVDVEQRASAKELLEHPFL  526 (550)
T ss_pred             cccCHHHHHHHHHHhhcchhcCCCHHHHhcChhh
Confidence            457789999988       999999999999999


No 256
>smart00794 AgrD Staphylococcal AgrD protein. This family consists of several AgrD proteins from many Staphylococcus species. The agr locus was initially described in Staphylococcus aureus as an element controlling the production of exoproteins implicated in virulence. Its pattern of action has been shown to be complex, upregulating certain extracellular toxins and enzymes expressed post-exponentially and repressing some exponential-phase surface components. AgrD encodes the precursor of the autoinducing peptide (AIP).The AIP derived from AgrD by the action of AgrB interacts with AgrC in the membrane to activate AgrA, which upregulates transcription both from promoter P2, amplifying the response, and from P3, initiating the production of a novel effector: RNAIII. In S. aureus, delta-hemolysin is the only translation product of RNA III and is not involved in the regulatory functions of the transcript, which is therefore the primary agent for modulating the expression of other operons con
Probab=44.64  E-value=14  Score=22.83  Aligned_cols=15  Identities=13%  Similarity=-0.029  Sum_probs=12.7

Q ss_pred             ecCCCCCChhHHHhh
Q psy9108          15 VTTQPANENRGKFLV   29 (98)
Q Consensus        15 ~~d~p~i~~~~kdL~   29 (98)
                      .-|||.|+.+|-+|-
T Consensus        30 ~fDEpEVPkELt~l~   44 (45)
T smart00794       30 YFDEPEVPKELTDLY   44 (45)
T ss_pred             cCCCCcCcHHHHhhc
Confidence            459999999998873


No 257
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=43.92  E-value=12  Score=26.59  Aligned_cols=27  Identities=7%  Similarity=-0.159  Sum_probs=22.0

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccC
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      ...+.+++.+++|+.       ++|.|+.||.++
T Consensus       234 ~~~~~~~~~~~~li~~~l~~~p~~Rps~~~l~~~  267 (272)
T cd05075         234 KQPPDCLDGLYSLMSSCWLLNPKDRPSFETLRCE  267 (272)
T ss_pred             CCCCCCCHHHHHHHHHHcCCCcccCcCHHHHHHH
Confidence            345678889999988       899999998753


No 258
>KOG0661|consensus
Probab=43.47  E-value=14  Score=32.81  Aligned_cols=29  Identities=10%  Similarity=0.068  Sum_probs=23.2

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..++++..||.       .+|.|..|-.+||+|.-.
T Consensus       262 ~~s~~~~~li~~ll~WDP~kRpTA~~al~~pffq~~  297 (538)
T KOG0661|consen  262 NASSEAASLIERLLAWDPDKRPTASQALQHPFFQVG  297 (538)
T ss_pred             ccCHHHHHHHHHHhcCCCccCccHHHHhcCcccccc
Confidence            35666666655       999999999999999765


No 259
>PF04558 tRNA_synt_1c_R1:  Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1    ;  InterPro: IPR007639 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This is a domain found N-terminal to the catalytic domain of glutaminyl-tRNA synthetase (6.1.1.18 from EC) in eukaryotes but not in Escherichia coli. This domain is thought to bind RNA in a non-specific manner, enhancing interactions between the tRNA and enzyme, but is not essential for enzyme function [].; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 3TL4_X.
Probab=41.75  E-value=8.5  Score=28.63  Aligned_cols=32  Identities=13%  Similarity=0.412  Sum_probs=17.8

Q ss_pred             cccCCCCCcCCC--cccCccc-eeeChhhhhcccc
Q psy9108          44 WVTKDGAYALPT--EEENCQL-VTVSEDDVRNVIK   75 (98)
Q Consensus        44 WVTknG~dpLP~--Eeenc~~-vevteEEv~~avq   75 (98)
                      |+..++..|+..  -++.|++ |+||+|||.++|.
T Consensus        93 Yl~~~~~~~~d~~~Fe~~cGVGV~VT~E~I~~~V~  127 (164)
T PF04558_consen   93 YLKSNPSEPIDVAEFEKACGVGVVVTPEQIEAAVE  127 (164)
T ss_dssp             HHHHHGG-G--HHHHHHTTTTT----HHHHHHHHH
T ss_pred             HHHHCCCCCCCHHHHHHHcCCCeEECHHHHHHHHH
Confidence            555666655543  3468997 9999999999884


No 260
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=41.50  E-value=17  Score=26.67  Aligned_cols=29  Identities=10%  Similarity=-0.028  Sum_probs=23.5

Q ss_pred             eeecCCCCCChhHHHhhh-------hcccccccccc
Q psy9108          13 FYVTTQPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        13 ~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      .|....+.+++.++||++       ++|.|+.+|.+
T Consensus       256 ~~~~~~~~~~~~l~~li~~~l~~~p~~RPs~~~i~~  291 (295)
T cd05097         256 IYLSQTPLCPSPVFKLMMRCWSRDIKDRPTFNKIHH  291 (295)
T ss_pred             ccCCCCCCCCHHHHHHHHHHcCCCchhCcCHHHHHH
Confidence            455667778899999988       89999999853


No 261
>KOG0668|consensus
Probab=40.93  E-value=15  Score=30.72  Aligned_cols=17  Identities=12%  Similarity=0.126  Sum_probs=15.7

Q ss_pred             hccccccccccCccccC
Q psy9108          31 IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTk   47 (98)
                      +.|.|..|-+.||||..
T Consensus       311 qeRlTakEam~HpyF~~  327 (338)
T KOG0668|consen  311 QERLTAKEAMAHPYFAP  327 (338)
T ss_pred             ccccchHHHhcCchHHH
Confidence            99999999999999953


No 262
>PRK14371 hypothetical protein; Provisional
Probab=39.79  E-value=19  Score=24.42  Aligned_cols=22  Identities=18%  Similarity=0.462  Sum_probs=17.4

Q ss_pred             hccccccccccCccccCCCCCcCCCcc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      ..||    ++=|||+ ++|-||+|...
T Consensus        51 ~~Ri----lRC~P~~-~gG~DpvP~~~   72 (81)
T PRK14371         51 VRRL----GRCHPWN-PGGYDPVPPAP   72 (81)
T ss_pred             HHHH----hcCCCCC-CCCcCCCCCCC
Confidence            6666    6889998 78899999543


No 263
>KOG0590|consensus
Probab=39.47  E-value=18  Score=31.68  Aligned_cols=29  Identities=10%  Similarity=0.192  Sum_probs=24.2

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVTK   47 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVTk   47 (98)
                      -.++....++++       ..|+++++++.+||++.
T Consensus       256 ~~~~~~~~~~l~k~l~~~~~~r~s~~~~~~d~~~~~  291 (601)
T KOG0590|consen  256 NSISDQAHDLLHKILKENPSNRLSIEELKLDNWLSS  291 (601)
T ss_pred             ccCChhhhhcccccccCCchhccccccccccccccc
Confidence            356666666666       89999999999999999


No 264
>PF15142 INCA1:  INCA1
Probab=37.77  E-value=18  Score=27.87  Aligned_cols=41  Identities=22%  Similarity=0.244  Sum_probs=33.7

Q ss_pred             hhHHHhhhhccccccccccCccccCCC-CCcCCCcccCcccee
Q psy9108          23 NRGKFLVRIVAIKAGVHKEHSWVTKDG-AYALPTEEENCQLVT   64 (98)
Q Consensus        23 ~~~kdL~~~kRITi~EIK~HPWVTknG-~dpLP~Eeenc~~ve   64 (98)
                      =-|.||-|.+|| |.|+|.--|=..+. .+||+..++.|....
T Consensus       106 yHLEDLRRRQri-InElKkAqWG~s~Aa~epl~~~e~g~~~~s  147 (178)
T PF15142_consen  106 YHLEDLRRRQRI-INELKKAQWGSSGAASEPLVLAEEGCGFPS  147 (178)
T ss_pred             HHHHHHHHHHHH-HHHHHHhhcCCCCCCCCCcccccccCCCCc
Confidence            357888888886 89999999988776 567999999998633


No 265
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=36.91  E-value=18  Score=34.12  Aligned_cols=30  Identities=10%  Similarity=-0.009  Sum_probs=25.6

Q ss_pred             CCChhHHHhhh-------hccccccccccCccccCCC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEHSWVTKDG   49 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~HPWVTknG   49 (98)
                      ..+.++.|||.       ++|.|+.|+..|||+..-+
T Consensus       266 ~~S~eL~dLI~~~L~~dPeeRPSa~QlL~h~~ik~i~  302 (1021)
T PTZ00266        266 GKSKELNILIKNLLNLSAKERPSALQCLGYQIIKNVG  302 (1021)
T ss_pred             CCCHHHHHHHHHHhcCChhHCcCHHHHhccHHHhhcC
Confidence            45778999987       9999999999999997553


No 266
>PRK14391 hypothetical protein; Provisional
Probab=36.86  E-value=20  Score=24.48  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=16.8

Q ss_pred             hccccccccccCccccCCCCCcCCCc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTE   56 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~E   56 (98)
                      .+||    ++=|||. ++|-||+|..
T Consensus        51 ~~Ri----lRC~P~~-~Gg~DPvP~~   71 (84)
T PRK14391         51 AWRI----LRCNPLS-QGFDDPLPPN   71 (84)
T ss_pred             HHHH----hcCCCCC-CCCCCCCCCC
Confidence            6676    6889998 6899999943


No 267
>KOG0593|consensus
Probab=34.68  E-value=19  Score=30.91  Aligned_cols=27  Identities=15%  Similarity=0.060  Sum_probs=23.9

Q ss_pred             CCCChhHHHhhh-------hccccccccccCccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWV   45 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWV   45 (98)
                      |.+++-+-|||.       ++|++-+|+.+||+|
T Consensus       254 p~~s~~~ld~~k~cL~~dP~~R~sc~qll~H~yF  287 (396)
T KOG0593|consen  254 PKISNVLLDLLKKCLKMDPDDRLSCEQLLHHPYF  287 (396)
T ss_pred             ccchHHHHHHHHHHhcCCccccccHHHHhcChHH
Confidence            667777788877       999999999999999


No 268
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=34.54  E-value=20  Score=25.92  Aligned_cols=24  Identities=4%  Similarity=-0.235  Sum_probs=20.3

Q ss_pred             CCCChhHHHhhh-------hccccccccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      +.++..+.++++       +.|.|+.|+.+|
T Consensus       244 ~~~~~~~~~~i~~cl~~~p~~Rps~~~vl~~  274 (277)
T cd05036         244 KGCPGPVYRIMTDCWQHTPEDRPNFATILER  274 (277)
T ss_pred             CCCCHHHHHHHHHHcCCCcccCcCHHHHHHH
Confidence            557788899987       999999999876


No 269
>PRK14379 hypothetical protein; Provisional
Probab=34.40  E-value=25  Score=24.62  Aligned_cols=22  Identities=14%  Similarity=0.338  Sum_probs=17.5

Q ss_pred             hccccccccccCccccCCCCCcCCCcc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      ..||    ++-|||+ ++|-||+|...
T Consensus        51 ~~Ri----lRCnP~~-~gG~DpvP~~~   72 (95)
T PRK14379         51 LARI----LRCNPFI-RGGVDPVPDYF   72 (95)
T ss_pred             HHHH----HhcCCCC-CCCCCCCCCcc
Confidence            6676    6899998 77999999543


No 270
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=34.33  E-value=19  Score=25.49  Aligned_cols=24  Identities=8%  Similarity=-0.285  Sum_probs=19.8

Q ss_pred             CCCChhHHHhhh-------hccccccccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      +.+++++.+|++       ++|.|+.|+..+
T Consensus       238 ~~~~~~~~~li~~~l~~~p~~Rp~~~e~~~~  268 (273)
T cd05035         238 EDCLDELYDLMYSCWRADPKDRPTFTKLREV  268 (273)
T ss_pred             cCCCHHHHHHHHHHcCCChhhCcCHHHHHHH
Confidence            457788999988       899999998764


No 271
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=32.58  E-value=28  Score=24.88  Aligned_cols=23  Identities=9%  Similarity=-0.156  Sum_probs=19.4

Q ss_pred             CCCChhHHHhhh-------hcccccccccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      ..++..+++|++       ++|+|+.||.+
T Consensus       247 ~~~~~~~~~li~~~l~~~p~~Rp~~~eil~  276 (280)
T cd05049         247 RTCPSEVYDIMLGCWKRDPQQRINIKDIHE  276 (280)
T ss_pred             CCCCHHHHHHHHHHcCCCcccCCCHHHHHH
Confidence            467889999988       99999999864


No 272
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=31.83  E-value=26  Score=24.26  Aligned_cols=27  Identities=7%  Similarity=-0.260  Sum_probs=20.8

Q ss_pred             cCCCCCChhHHHhhh-------hccccccccccC
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      ...+.+++++.++++       +.|.|+.|+..|
T Consensus       227 ~~~~~~~~~~~~li~~~l~~~p~~Rps~~~l~~~  260 (262)
T cd00192         227 PKPEYCPDELYELMLSCWQLDPEDRPTFSELVER  260 (262)
T ss_pred             CCCccCChHHHHHHHHHccCCcccCcCHHHHHHh
Confidence            344567888888887       889999988764


No 273
>KOG1167|consensus
Probab=31.74  E-value=27  Score=30.15  Aligned_cols=23  Identities=17%  Similarity=-0.008  Sum_probs=20.4

Q ss_pred             hHHHhhh-------hccccccccccCcccc
Q psy9108          24 RGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        24 ~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      .+-||++       .+|||..|-..||+|+
T Consensus       356 ~~~dlLdk~le~np~kRitAEeALkHpFF~  385 (418)
T KOG1167|consen  356 LLLDLLDKCLELNPQKRITAEDALKHPFFD  385 (418)
T ss_pred             HHHHHHHHHccCChhhcccHHHHhcCcCCc
Confidence            5677777       7999999999999999


No 274
>TIGR00278 conserved hypothetical protein YidD. This model describes a family of small proteins of unknown function restricted to and broadly but not universally distributed among the Bacteria. Members frequently are found in the vicinity of rnpA, the gene for the protein subunit of ribonuclease P. A related protein is found in the temperature phage HP1 of Haemophilus influenzae. Annotation of some members of this family as hemolysins appears to represent propagation from an unpublished GenBank submission, L36462, attributed to Aeromonas hydrophila but a close match to E. coli.
Probab=31.58  E-value=34  Score=22.84  Aligned_cols=22  Identities=18%  Similarity=0.323  Sum_probs=17.1

Q ss_pred             hccccccccccCccccCCCCCcCCCcc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTEE   57 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~Ee   57 (98)
                      ..||    ++=|||+ ++|-||.|...
T Consensus        47 ~~Ri----lRC~P~~-~gG~Dpvp~~~   68 (75)
T TIGR00278        47 LKRI----LRCHPLH-PGGNDPVPKKK   68 (75)
T ss_pred             HHHH----hcCCCCC-CCCcCCCCCcc
Confidence            5666    5789998 77899999644


No 275
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=31.36  E-value=34  Score=25.15  Aligned_cols=27  Identities=11%  Similarity=-0.102  Sum_probs=22.1

Q ss_pred             eecCCCCCChhHHHhhh-------hccccccccc
Q psy9108          14 YVTTQPANENRGKFLVR-------IVAIKAGVHK   40 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~-------~kRITi~EIK   40 (98)
                      +....|.+++.+++|+.       ++|.|+.||.
T Consensus       266 ~~~~~~~~~~~~~~li~~cl~~~p~~RPs~~~i~  299 (304)
T cd05096         266 YLFRPPPCPQGLYELMLQCWSRDCRERPSFSDIH  299 (304)
T ss_pred             cccCCCCCCHHHHHHHHHHccCCchhCcCHHHHH
Confidence            34456788899999988       8999999983


No 276
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=31.30  E-value=30  Score=24.87  Aligned_cols=25  Identities=4%  Similarity=-0.141  Sum_probs=20.5

Q ss_pred             CCCCCChhHHHhhh-------hcccccccccc
Q psy9108          17 TQPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        17 d~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      ..+.+++++.+|++       ++|.|+.||..
T Consensus       247 ~~~~~~~~~~~li~~cl~~~p~~Rpt~~ei~~  278 (284)
T cd05081         247 APPGCPAEIYAIMKECWNNDPSQRPSFSELAL  278 (284)
T ss_pred             CCCCCCHHHHHHHHHHccCChhhCCCHHHHHH
Confidence            44677889999988       89999999864


No 277
>PRK14375 hypothetical protein; Provisional
Probab=30.77  E-value=31  Score=22.86  Aligned_cols=22  Identities=14%  Similarity=0.146  Sum_probs=17.8

Q ss_pred             hccccccccccCccccCCCCCcCCCc
Q psy9108          31 IVAIKAGVHKEHSWVTKDGAYALPTE   56 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTknG~dpLP~E   56 (98)
                      .+||    ++=|||+..+|-||+|..
T Consensus        45 ~~Ri----lRCnP~~~gGg~DpvP~~   66 (70)
T PRK14375         45 TRRL----LRCHPLSKRDYYDLVPCK   66 (70)
T ss_pred             HHHH----hcCCCCCCCCCCCCCCCC
Confidence            6676    688999988789999853


No 278
>PLN02859 glutamine-tRNA ligase
Probab=29.83  E-value=16  Score=33.75  Aligned_cols=33  Identities=27%  Similarity=0.518  Sum_probs=25.2

Q ss_pred             ccccCCCCCcCCC--cccCccc-eeeChhhhhcccc
Q psy9108          43 SWVTKDGAYALPT--EEENCQL-VTVSEDDVRNVIK   75 (98)
Q Consensus        43 PWVTknG~dpLP~--Eeenc~~-vevteEEv~~avq   75 (98)
                      -|+.++|..++..  -++.|++ |+||+|||.++|.
T Consensus        94 kYl~~~~~~~~d~~~Fek~CGVGV~VT~EqI~~~V~  129 (788)
T PLN02859         94 SFFSSTGPESFDLNKFEEACGVGVVVSPEDIEAAVN  129 (788)
T ss_pred             HHHHhCCCCccCHHHHHHhCCCCEEECHHHHHHHHH
Confidence            3777777655542  3678997 9999999999885


No 279
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=28.91  E-value=32  Score=24.28  Aligned_cols=23  Identities=4%  Similarity=-0.164  Sum_probs=18.5

Q ss_pred             CCCChhHHHhhh-------hcccccccccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      ..+++.+.||++       ++|.|+.|+..
T Consensus       222 ~~~~~~~~~li~~~l~~~p~~Rp~~~~l~~  251 (256)
T cd05039         222 EGCPPEVYKVMKDCWELDPAKRPTFKQLRE  251 (256)
T ss_pred             cCCCHHHHHHHHHHhccChhhCcCHHHHHH
Confidence            456788999987       89999988764


No 280
>PF07563 DUF1541:  Protein of unknown function (DUF1541);  InterPro: IPR011438 This domain is found in several hypothetical bacterial proteins as a tandem repeat.; PDB: 2KY9_A 4FIB_B.
Probab=28.78  E-value=16  Score=23.34  Aligned_cols=11  Identities=45%  Similarity=0.818  Sum_probs=8.7

Q ss_pred             cccccCccccC
Q psy9108          37 GVHKEHSWVTK   47 (98)
Q Consensus        37 ~EIK~HPWVTk   47 (98)
                      .++++|-||+.
T Consensus        43 ~~v~nHKWV~e   53 (53)
T PF07563_consen   43 EKVKNHKWVTE   53 (53)
T ss_dssp             SEEEEEEEEEG
T ss_pred             cEeeeeeeEeC
Confidence            46889999974


No 281
>cd06553 ASCH_Ef3133_like ASC-1 homology domain, subfamily similar to Enterococcus faecalis Ef3133. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=28.52  E-value=23  Score=25.36  Aligned_cols=27  Identities=11%  Similarity=0.034  Sum_probs=23.0

Q ss_pred             eeeecCCCCCChhHHHhhh--hccccccc
Q psy9108          12 KFYVTTQPANENRGKFLVR--IVAIKAGV   38 (98)
Q Consensus        12 ~~~~~d~p~i~~~~kdL~~--~kRITi~E   38 (98)
                      .|+.-|+|+..+.|.+|+.  .||+|.+-
T Consensus         3 ~~~FGd~~~~ad~l~~LVl~G~KtAT~s~   31 (127)
T cd06553           3 AWAFGDSPELADELAALVLAGKKTATCSA   31 (127)
T ss_pred             ccccCCCHHHHHHHHHHHHcCCcEEEEec
Confidence            4667888999999999977  99999875


No 282
>KOG1151|consensus
Probab=27.70  E-value=40  Score=30.67  Aligned_cols=40  Identities=10%  Similarity=0.141  Sum_probs=34.7

Q ss_pred             eeeeeeecCCCCCChhHHHhhh-------hccccccccccCccccCC
Q psy9108           9 RLRKFYVTTQPANENRGKFLVR-------IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus         9 ~~~~~~~~d~p~i~~~~kdL~~-------~kRITi~EIK~HPWVTkn   48 (98)
                      ..+..-.+--|.++.+.|+.||       +.||.+.++-.||++.-+
T Consensus       701 kAtEVqFP~KPvVsseAkaFIRRCLaYRKeDR~DV~qLA~dpyllPh  747 (775)
T KOG1151|consen  701 KATEVQFPPKPVVSSEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPH  747 (775)
T ss_pred             cceeccCCCCCccCHHHHHHHHHHHHhhhhhhhhHHHHccCccccch
Confidence            3455566788999999999999       899999999999999875


No 283
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=27.59  E-value=29  Score=24.55  Aligned_cols=22  Identities=9%  Similarity=-0.130  Sum_probs=18.1

Q ss_pred             CCChhHHHhhh-------hcccccccccc
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      .+++.+++|++       ++|+|+.+|.+
T Consensus       232 ~~~~~~~~li~~~l~~~p~~Rpt~~~i~~  260 (267)
T cd08229         232 HYSEELRQLVNMCINPDPEKRPDITYVYD  260 (267)
T ss_pred             cccHHHHHHHHHhcCCCcccCCCHHHHHH
Confidence            36778999987       99999998753


No 284
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=26.92  E-value=41  Score=23.74  Aligned_cols=26  Identities=4%  Similarity=-0.217  Sum_probs=20.3

Q ss_pred             cCCCCCChhHHHhhh-------hcccccccccc
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      +..+.+++.+.+++.       ++|.|+.||.+
T Consensus       224 ~~~~~~~~~~~~~i~~~l~~~p~~Rpt~~~l~~  256 (261)
T cd05148         224 PCPAKCPQEIYKIMLECWAAEPEDRPSFKALRE  256 (261)
T ss_pred             CCCCCCCHHHHHHHHHHcCCCchhCcCHHHHHH
Confidence            344677888999977       89999998854


No 285
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=26.49  E-value=34  Score=24.34  Aligned_cols=23  Identities=9%  Similarity=-0.249  Sum_probs=19.5

Q ss_pred             CCCChhHHHhhh-------hcccccccccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      +.++++++|||+       +.|.++.+|.+
T Consensus       221 ~~~~~~l~~li~~~~~~~p~~Rp~~~~i~~  250 (257)
T cd05116         221 QRCPPEMYDLMKLCWTYGVDERPGFAVVEL  250 (257)
T ss_pred             CCCCHHHHHHHHHHhccCchhCcCHHHHHH
Confidence            458889999988       89999998864


No 286
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=26.31  E-value=16  Score=21.22  Aligned_cols=19  Identities=26%  Similarity=0.545  Sum_probs=13.8

Q ss_pred             cccCCCCCcCCCcccCccc
Q psy9108          44 WVTKDGAYALPTEEENCQL   62 (98)
Q Consensus        44 WVTknG~dpLP~Eeenc~~   62 (98)
                      |+..|-..|-|++++.-.+
T Consensus         1 Wl~~h~~nPYPs~~ek~~L   19 (40)
T PF05920_consen    1 WLLEHLHNPYPSKEEKEEL   19 (40)
T ss_dssp             HHHHTTTSGS--HHHHHHH
T ss_pred             CHHHHCCCCCCCHHHHHHH
Confidence            8888989999998887554


No 287
>PF07157 DNA_circ_N:  DNA circularisation protein N-terminus;  InterPro: IPR009826 This entry represents the N terminus (approximately 100 residues) of a number of phage DNA circulation proteins.
Probab=25.57  E-value=71  Score=21.94  Aligned_cols=39  Identities=21%  Similarity=0.397  Sum_probs=28.2

Q ss_pred             CcceeeeeeeecCCCCCChhHHHhhhhccccccccccCccc
Q psy9108           5 SKPIRLRKFYVTTQPANENRGKFLVRIVAIKAGVHKEHSWV   45 (98)
Q Consensus         5 ~~~~~~~~~~~~d~p~i~~~~kdL~~~kRITi~EIK~HPWV   45 (98)
                      ...++++-|++-|  +...+++.|+..-.=.=+.-..|||+
T Consensus        48 ~r~~~~~a~~~G~--dy~~~~~~L~~al~~~G~G~LvHP~~   86 (93)
T PF07157_consen   48 ARRIRVTAFFVGD--DYEAQRDALIAALEAPGPGELVHPWF   86 (93)
T ss_pred             CcEEEEEEEEECC--cHHHHHHHHHHHHcCCCCeEEecCCC
Confidence            4567888888866  45667778888555556777889997


No 288
>PHA02988 hypothetical protein; Provisional
Probab=25.29  E-value=37  Score=25.10  Aligned_cols=23  Identities=13%  Similarity=-0.198  Sum_probs=19.5

Q ss_pred             CCCChhHHHhhh-------hcccccccccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      +.+++.+++|+.       +.|.|+.||.+
T Consensus       245 ~~~~~~l~~li~~cl~~dp~~Rps~~ell~  274 (283)
T PHA02988        245 LDCPLEIKCIVEACTSHDSIKRPNIKEILY  274 (283)
T ss_pred             CcCcHHHHHHHHHHhcCCcccCcCHHHHHH
Confidence            368899999998       89999999864


No 289
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=24.72  E-value=44  Score=23.41  Aligned_cols=26  Identities=4%  Similarity=-0.149  Sum_probs=20.3

Q ss_pred             cCCCCCChhHHHhhh-------hcccccccccc
Q psy9108          16 TTQPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        16 ~d~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      ...+.++.++.+|+.       +.|.|+.|+.+
T Consensus       214 ~~~~~~~~~~~~li~~~l~~~p~~Rp~~~~l~~  246 (250)
T cd05085         214 SCPQKCPDDVYKVMQRCWDYKPENRPKFSELQK  246 (250)
T ss_pred             CCCCCCCHHHHHHHHHHcccCcccCCCHHHHHH
Confidence            334567889999987       89999998854


No 290
>PHA03381 tegument protein VP22; Provisional
Probab=24.44  E-value=41  Score=27.70  Aligned_cols=22  Identities=18%  Similarity=0.184  Sum_probs=19.1

Q ss_pred             CCCCCChhHHHhhh--hccccccc
Q psy9108          17 TQPANENRGKFLVR--IVAIKAGV   38 (98)
Q Consensus        17 d~p~i~~~~kdL~~--~kRITi~E   38 (98)
                      +-|..+++|.+||.  .-|||+-|
T Consensus       221 ~pPrtnEeLd~fL~~AvIRITVcE  244 (290)
T PHA03381        221 SHPRNDEELNDLLGATNIRIIVCE  244 (290)
T ss_pred             CCCCchHHHHHHHhhceEEEEeec
Confidence            45889999999998  88999876


No 291
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=23.93  E-value=39  Score=23.96  Aligned_cols=24  Identities=8%  Similarity=-0.140  Sum_probs=19.6

Q ss_pred             CCCCChhHHHhhh-------hcccccccccc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      .+.+++++++|+.       ++|.|+.+|.+
T Consensus       235 ~~~~~~~~~~li~~~l~~~p~~Rp~~~~i~~  265 (269)
T cd05044         235 PENCPDKIYQLMTNCWAQDPSERPTFDRIQE  265 (269)
T ss_pred             cccchHHHHHHHHHHcCCCcccCCCHHHHHH
Confidence            3467788999988       89999999864


No 292
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=23.16  E-value=50  Score=23.45  Aligned_cols=24  Identities=8%  Similarity=-0.166  Sum_probs=18.5

Q ss_pred             CCCCChhHHHhhh-------hcccccccccc
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      .+.+++.+.+|++       +.|.|+.||.+
T Consensus       248 ~~~~~~~~~~li~~cl~~~p~~Rpt~~ei~~  278 (284)
T cd05038         248 PPSCPDEVYDLMKLCWEAEPQDRPSFADLIL  278 (284)
T ss_pred             CccCCHHHHHHHHHHhccChhhCCCHHHHHH
Confidence            3456678888887       88999998854


No 293
>KOG0658|consensus
Probab=22.97  E-value=46  Score=28.29  Aligned_cols=28  Identities=11%  Similarity=-0.049  Sum_probs=24.0

Q ss_pred             CCCChhHHHhhh-------hccccccccccCcccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEHSWVT   46 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~HPWVT   46 (98)
                      ..++.|.-||+.       .+|+|-.|+..||+|-
T Consensus       276 ~~~~~d~~dll~~~L~Y~P~~R~~~~~~l~h~fFd  310 (364)
T KOG0658|consen  276 KRLPPDALDLLSKLLQYSPSKRLSALEALAHPFFD  310 (364)
T ss_pred             cCCCHHHHHHHHHHhccChhhcCCHHHHhcchhhH
Confidence            456778888877       9999999999999984


No 294
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=22.91  E-value=45  Score=23.94  Aligned_cols=23  Identities=9%  Similarity=-0.153  Sum_probs=19.0

Q ss_pred             CCCChhHHHhhh-------hcccccccccc
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      +.+++++++||.       +.|.|+.+|.+
T Consensus       221 ~~~~~~l~~li~~c~~~~~~~Rp~~~~i~~  250 (257)
T cd05115         221 AECPPEMYALMKDCWIYKWEDRPNFAKVEE  250 (257)
T ss_pred             CCCCHHHHHHHHHHcCCChhhCcCHHHHHH
Confidence            456789999988       89999998865


No 295
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=22.62  E-value=46  Score=23.68  Aligned_cols=25  Identities=4%  Similarity=-0.340  Sum_probs=19.5

Q ss_pred             CCCCChhHHHhhh-------hccccccccccC
Q psy9108          18 QPANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        18 ~p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      ....++++.+|++       +.|.|+.||.+|
T Consensus       230 ~~~~~~~l~~li~~cl~~~p~~Rp~~~ei~~~  261 (266)
T cd05033         230 PMDCPSALYQLMLDCWQKDRNERPTFSQIVST  261 (266)
T ss_pred             CCCCCHHHHHHHHHHcCCCcccCcCHHHHHHH
Confidence            3456788999987       889999988654


No 296
>PHA03120 tegument protein VP22; Provisional
Probab=22.12  E-value=46  Score=27.55  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=19.2

Q ss_pred             CCCCCChhHHHhhh--hccccccc
Q psy9108          17 TQPANENRGKFLVR--IVAIKAGV   38 (98)
Q Consensus        17 d~p~i~~~~kdL~~--~kRITi~E   38 (98)
                      +-|..+++|.+||.  .-|||+.|
T Consensus       212 nPPRnNEeLDrlL~~AvIRITVcE  235 (310)
T PHA03120        212 NPPRNNAELDRLLAGAVIRITVHE  235 (310)
T ss_pred             CCCCChHHHHHHHHhceEEEEecc
Confidence            45889999999998  88999876


No 297
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=22.08  E-value=59  Score=23.84  Aligned_cols=23  Identities=9%  Similarity=-0.117  Sum_probs=19.0

Q ss_pred             CCChhHHHhhh-------hccccccccccC
Q psy9108          20 ANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        20 ~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      .+++.+++|++       .+|.|+.+|.+.
T Consensus       242 ~~~~~~~~li~~~l~~~p~~Rp~~~~i~~~  271 (297)
T cd05089         242 NCDDEVYELMRQCWRDRPYERPPFAQISVQ  271 (297)
T ss_pred             CCCHHHHHHHHHHcCCChhhCcCHHHHHHH
Confidence            47789999988       899999999543


No 298
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=21.75  E-value=63  Score=23.61  Aligned_cols=28  Identities=7%  Similarity=-0.139  Sum_probs=21.4

Q ss_pred             eecCCCCCChhHHHhhh-------hcccccccccc
Q psy9108          14 YVTTQPANENRGKFLVR-------IVAIKAGVHKE   41 (98)
Q Consensus        14 ~~~d~p~i~~~~kdL~~-------~kRITi~EIK~   41 (98)
                      |.+..+.+++.+++|+.       ++|.|+.||.+
T Consensus       258 ~~~~~~~~~~~~~~li~~cl~~~p~~Rp~~~~i~~  292 (296)
T cd05095         258 YLPKPALCPDSLYKLMLSCWRRNAKERPSFQEIHA  292 (296)
T ss_pred             cCCCCCCCCHHHHHHHHHHcCCCcccCCCHHHHHH
Confidence            34445667889999987       89999998853


No 299
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=21.37  E-value=46  Score=24.03  Aligned_cols=22  Identities=5%  Similarity=-0.324  Sum_probs=18.1

Q ss_pred             CChhHHHhhh-------hccccccccccC
Q psy9108          21 NENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        21 i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      .++++++||+       ++|.|+.+|..+
T Consensus       232 ~~~~~~~li~~cl~~dp~~Rp~~~~il~~  260 (262)
T cd05077         232 SCKELADLMTHCMNYDPNQRPFFRAIMRD  260 (262)
T ss_pred             ChHHHHHHHHHHcCCChhhCcCHHHHHHh
Confidence            3568899988       999999998764


No 300
>KOG0600|consensus
Probab=21.35  E-value=74  Score=28.58  Aligned_cols=18  Identities=11%  Similarity=-0.005  Sum_probs=16.4

Q ss_pred             hccccccccccCccccCC
Q psy9108          31 IVAIKAGVHKEHSWVTKD   48 (98)
Q Consensus        31 ~kRITi~EIK~HPWVTkn   48 (98)
                      .+|+|..+-.+|+|||..
T Consensus       389 ~kR~tA~~aL~seyF~t~  406 (560)
T KOG0600|consen  389 DKRGTASSALQSEYFTTE  406 (560)
T ss_pred             cccccHHHHhcCcccccC
Confidence            999999999999999544


No 301
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=21.03  E-value=46  Score=24.06  Aligned_cols=24  Identities=13%  Similarity=-0.115  Sum_probs=19.1

Q ss_pred             CCCChhHHHhhh-------hccccccccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      +.+++++.+|++       ++|.|+.||.++
T Consensus       257 ~~~~~~~~~li~~~l~~~p~~Rps~~eil~~  287 (293)
T cd05053         257 QNCTQELYHLMRDCWHEVPSQRPTFKQLVED  287 (293)
T ss_pred             CCCCHHHHHHHHHHcccCcccCcCHHHHHHH
Confidence            346778999987       899999998754


No 302
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=20.19  E-value=47  Score=23.82  Aligned_cols=24  Identities=8%  Similarity=-0.190  Sum_probs=20.0

Q ss_pred             CCCChhHHHhhh-------hccccccccccC
Q psy9108          19 PANENRGKFLVR-------IVAIKAGVHKEH   42 (98)
Q Consensus        19 p~i~~~~kdL~~-------~kRITi~EIK~H   42 (98)
                      +.+++++.+|++       ++|-|+.||.+|
T Consensus       249 ~~~~~~~~~l~~~c~~~~p~~Rp~~~~i~~~  279 (283)
T cd05048         249 EDCPARVYALMIECWNEIPARRPRFKDIHTR  279 (283)
T ss_pred             ccCCHHHHHHHHHHccCChhhCcCHHHHHHH
Confidence            457789999988       899999998764


Done!