Diaphorina citri psyllid: psy9225


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MFLVSKCSFLLSVLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGGKSSTLSPMIESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCTKPFSPPPEHPHLAMPRAIAFIHKKLTELNKNLVQNKRAVMILGTEAAHKV
ccHHHHHHHHHHHHHHHHcccccccccccccccccccCEEccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccCEccccccccccccccccccEEEEEEccccccHHHHHHccccEEEEEcccccccc
*FLVSKCSFLLSVLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGG********IESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCTKP*********LAMPRAIAFIHKKLTELNKNLVQNKRAVMILGTE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLVSKCSFLLSVLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGGKSSTLSPMIESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCTKPFSPPPEHPHLAMPRAIAFIHKKLTELNKNLVQNKRAVMILGTEAAHKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Frizzled-7 Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.confidentO75084
Frizzled-7 Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.confidentO57329

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030855 [BP]epithelial cell differentiationprobableGO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0009888, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0007199 [BP]G-protein coupled receptor signaling pathway coupled to cGMP nucleotide second messengerprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0007204 [BP]elevation of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0017147 [MF]Wnt-protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0060027 [BP]convergent extension involved in gastrulationprobableGO:0048598, GO:0002009, GO:0060429, GO:0044707, GO:0060026, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0007223 [BP]Wnt receptor signaling pathway, calcium modulating pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0044699, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0035567
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0042813 [MF]Wnt-activated receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0042327 [BP]positive regulation of phosphorylationprobableGO:0042325, GO:0019220, GO:0009893, GO:0045937, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0031325, GO:0048522
GO:0035414 [BP]negative regulation of catenin import into nucleusprobableGO:0033157, GO:0060341, GO:0051049, GO:0032386, GO:0032387, GO:0035412, GO:0051223, GO:0051224, GO:0050789, GO:0032880, GO:0065007, GO:0048519, GO:0070201, GO:0051051, GO:0090317, GO:0050794, GO:0008150, GO:0042308, GO:0042306, GO:0032879, GO:1900180, GO:0046822, GO:0046823
GO:0035425 [BP]autocrine signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0007267, GO:0044763, GO:0044699
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0009950 [BP]dorsal/ventral axis specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0042060 [BP]wound healingprobableGO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0045995 [BP]regulation of embryonic developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0060412 [BP]ventricular septum morphogenesisprobableGO:0003281, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0003205, GO:0003206, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0003007, GO:0008150, GO:0003231, GO:0007507, GO:0003279, GO:0044707, GO:0048856, GO:0044767, GO:0048731, GO:0060411

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IJY, chain A
Confidence level:very confident
Coverage over the Query: 35-156
View the alignment between query and template
View the model in PyMOL