Diaphorina citri psyllid: psy9226


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
ALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGNANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFRWKGENVSTCEVEGVVSNASEYRDCVVYGV
cHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccEEEEEccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEEcHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccEEEEEEccccccccccccccCEEcccccccEEEEEEccccccccccccccccHHHHHHHccccccccEEEEccccccEEEcccccccccccccCEEEEEccccccccccccccHHHHHHHHccEEECccCEEEcccEEEECccccEEEEEccccccccccccccHHHHHHHHHccccccEEEEECc
ALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPLLS*********SYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGNANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFRWKGENVSTCEVEGVVSNASEYRDCVVYGV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGNANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFRWKGENVSTCEVEGVVSNASEYRDCVVYGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long-chain fatty acid transport protein 4 Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.confidentQ6P1M0
Long-chain fatty acid transport protein 4 Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.confidentQ5RDY4
Probable crotonobetaine/carnitine-CoA ligase Could catalyze the transfer of CoA to carnitine, generating the initial carnitinyl-CoA needed for the CaiB reaction cycle.confidentB5BL55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031957 [MF]very long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0072330 [BP]monocarboxylic acid biosynthetic processprobableGO:1901576, GO:0044710, GO:0044711, GO:0006082, GO:0071704, GO:0046394, GO:0044237, GO:0009987, GO:0016053, GO:0019752, GO:0032787, GO:0044249, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283, GO:0043436
GO:0050197 [MF]phytanate-CoA ligase activityprobableGO:0016878, GO:0003824, GO:0003674, GO:0016874, GO:0016877
GO:0005779 [CC]integral to peroxisomal membraneprobableGO:0042579, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0005778, GO:0031090, GO:0016021, GO:0016020, GO:0005777, GO:0044439, GO:0044438, GO:0031903, GO:0031231, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0042760 [BP]very long-chain fatty acid catabolic processprobableGO:0006631, GO:0072329, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:0044710, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:1901575, GO:0032787, GO:0008150, GO:0008152, GO:0000038, GO:0043436, GO:0044255, GO:0009056, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0044539 [BP]long-chain fatty acid importprobableGO:0051234, GO:0015718, GO:0015908, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0015909, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031526 [CC]brush border membraneprobableGO:0016020, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0005575, GO:0005903, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0004467 [MF]long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0097089 [BP]methyl-branched fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0015245 [MF]fatty acid transporter activityprobableGO:0005319, GO:0005215, GO:0022892, GO:0003674
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0008206 [BP]bile acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0043436, GO:1901360, GO:0044281
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0006655 [BP]phosphatidylglycerol biosynthetic processprobableGO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:0046471
GO:0070328 [BP]triglyceride homeostasisprobableGO:0042592, GO:0048878, GO:0055088, GO:0065007, GO:0008150, GO:0065008, GO:0055090
GO:0070251 [MF]pristanate-CoA ligase activityprobableGO:0016878, GO:0003824, GO:0003674, GO:0016874, GO:0016877

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R44, chain A
Confidence level:very confident
Coverage over the Query: 18-148,160-374,385-415,477-548
View the alignment between query and template
View the model in PyMOL
Template: 1RY2, chain A
Confidence level:very confident
Coverage over the Query: 20-376,387-415,477-548
View the alignment between query and template
View the model in PyMOL
Template: 3B7W, chain A
Confidence level:probable
Coverage over the Query: 46-366,378-498
View the alignment between query and template
View the model in PyMOL