Query         psy9229
Match_columns 258
No_of_seqs    109 out of 153
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:11:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9229.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9229hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00853 Runt:  Runt domain;  I 100.0   3E-87 6.4E-92  553.9  10.6  135   74-208     1-135 (135)
  2 KOG3982|consensus              100.0 2.8E-81   6E-86  589.0  12.7  140   70-209    94-234 (475)
  3 PF00853 Runt:  Runt domain;  I  99.8 5.9E-21 1.3E-25  159.2   6.6  108  130-245    15-134 (135)
  4 KOG3982|consensus               99.7 6.4E-18 1.4E-22  161.0   6.0  109  130-246   112-233 (475)
  5 PF04028 DUF374:  Domain of unk  58.2     6.4 0.00014   30.1   1.6   14  191-204    61-74  (74)
  6 cd01858 NGP_1 NGP-1.  Autoanti  55.9     7.9 0.00017   30.9   1.8   11  162-172   107-117 (157)
  7 PRK10738 hypothetical protein;  53.0      15 0.00033   30.2   3.1   82  150-232     1-107 (134)
  8 cd04159 Arl10_like Arl10-like   51.9     7.2 0.00016   29.0   0.9   14  159-172     1-14  (159)
  9 COG0432 Uncharacterized conser  42.6      30 0.00066   29.9   3.4   32  173-204    99-130 (137)
 10 TIGR03729 acc_ester putative p  41.5      26 0.00056   30.2   2.9   42  126-167    61-110 (239)
 11 cd01856 YlqF YlqF.  Proteins o  40.7      17 0.00038   29.6   1.6   44  128-172    78-130 (171)
 12 cd03279 ABC_sbcCD SbcCD and ot  39.1      14  0.0003   31.4   0.8   15  161-175    32-46  (213)
 13 TIGR02788 VirB11 P-type DNA tr  38.7      67  0.0014   29.4   5.2  112   77-205    42-186 (308)
 14 PF10442 FIST_C:  FIST C domain  37.7      39 0.00084   26.4   3.1   33  118-150    51-83  (136)
 15 cd01876 YihA_EngB The YihA (En  37.6      16 0.00034   27.4   0.8   16  159-174     1-16  (170)
 16 cd01852 AIG1 AIG1 (avrRpt2-ind  34.4      19 0.00041   29.8   0.9   14  160-173     3-16  (196)
 17 TIGR00149 TIGR00149_YbjQ secon  33.7      37 0.00081   28.5   2.6   28  174-201    95-122 (132)
 18 PF13555 AAA_29:  P-loop contai  33.6      22 0.00047   26.5   1.1   24  149-172    11-38  (62)
 19 PF01894 UPF0047:  Uncharacteri  32.8      23 0.00049   29.2   1.1   29  173-201    82-110 (118)
 20 PF00005 ABC_tran:  ABC transpo  32.6      20 0.00043   27.4   0.7   16  160-175    14-29  (137)
 21 PRK14238 phosphate transporter  32.5      30 0.00064   30.6   1.9   51  127-178     4-71  (271)
 22 PF12846 AAA_10:  AAA-like doma  32.4      12 0.00026   31.5  -0.6   15  161-175     5-19  (304)
 23 COG3638 ABC-type phosphate/pho  30.0      25 0.00055   33.2   1.1   15  161-175    34-48  (258)
 24 PF01926 MMR_HSR1:  50S ribosom  29.9      20 0.00043   26.9   0.3   12  160-171     2-13  (116)
 25 cd03277 ABC_SMC5_euk Eukaryoti  29.7      29 0.00062   30.1   1.3   32  143-175     8-41  (213)
 26 PF05356 Phage_Coat_B:  Phage C  29.4      18 0.00039   29.1   0.0   13  149-161     3-15  (83)
 27 COG1116 TauB ABC-type nitrate/  29.2      12 0.00025   34.9  -1.2   46  160-211    32-79  (248)
 28 cd00820 PEPCK_HprK Phosphoenol  29.1      23  0.0005   28.7   0.6   18  160-177    18-35  (107)
 29 cd03273 ABC_SMC2_euk Eukaryoti  29.0      22 0.00048   30.8   0.5   15  161-175    29-43  (251)
 30 PF13304 AAA_21:  AAA domain; P  28.7      19 0.00041   27.7   0.0   14  162-175     4-17  (303)
 31 PF02575 YbaB_DNA_bd:  YbaB/Ebf  28.7      19 0.00041   27.1   0.0   26  144-169     5-30  (93)
 32 cd01898 Obg Obg subfamily.  Th  28.6      25 0.00055   27.1   0.7   13  159-171     2-14  (170)
 33 cd01859 MJ1464 MJ1464.  This f  28.4      36 0.00077   26.9   1.5   44  128-172    73-116 (156)
 34 PRK13159 cytochrome c-type bio  28.2      71  0.0015   28.0   3.4   32  110-141    92-129 (155)
 35 KOG1068|consensus               27.8      36 0.00078   31.9   1.7   37  171-207    25-64  (245)
 36 cd04114 Rab30 Rab30 subfamily.  27.7      30 0.00065   26.8   1.0   15  158-172     8-22  (169)
 37 cd03272 ABC_SMC3_euk Eukaryoti  27.0      26 0.00057   29.7   0.6   12  161-172    27-38  (243)
 38 cd01881 Obg_like The Obg-like   26.9      21 0.00044   27.6  -0.1   10  162-171     1-10  (176)
 39 COG1132 MdlB ABC-type multidru  26.8      24 0.00052   34.3   0.4   10  162-171   360-369 (567)
 40 smart00175 RAB Rab subfamily o  26.7      25 0.00054   26.8   0.3   14  160-173     3-16  (164)
 41 COG2274 SunT ABC-type bacterio  26.3      26 0.00056   36.6   0.5   26  160-185   502-527 (709)
 42 PF03193 DUF258:  Protein of un  25.7      25 0.00054   30.4   0.2   30  135-172    21-50  (161)
 43 cd01853 Toc34_like Toc34-like   24.9      27 0.00058   31.4   0.3   14  160-173    34-47  (249)
 44 cd01918 HprK_C HprK/P, the bif  23.8      30 0.00066   29.5   0.4   12  160-171    17-28  (149)
 45 TIGR02695 azurin azurin. Azuri  23.4      36 0.00078   29.0   0.8   13   94-107   106-118 (125)
 46 PF00988 CPSase_sm_chain:  Carb  23.3      17 0.00038   30.9  -1.2   24  100-123    85-111 (131)
 47 COG1124 DppF ABC-type dipeptid  23.1      24 0.00052   33.2  -0.4   49  155-209    31-79  (252)
 48 cd04155 Arl3 Arl3 subfamily.    22.9      35 0.00075   26.7   0.5   13  160-172    17-29  (173)
 49 PRK12289 GTPase RsgA; Reviewed  22.9      65  0.0014   30.7   2.4   36  128-172   152-187 (352)
 50 cd03274 ABC_SMC4_euk Eukaryoti  22.8      35 0.00077   29.4   0.6   16  160-175    28-43  (212)
 51 cd04104 p47_IIGP_like p47 (47-  22.7      33 0.00071   28.7   0.4   12  160-171     4-15  (197)
 52 TIGR02868 CydC thiol reductant  22.5      32  0.0007   32.9   0.4   28  159-186   363-390 (529)
 53 COG1126 GlnQ ABC-type polar am  22.3      41 0.00089   31.5   1.0   38  155-198    26-63  (240)
 54 cd03263 ABC_subfamily_A The AB  22.3      34 0.00073   28.6   0.4   27  160-186    31-57  (220)
 55 TIGR00157 ribosome small subun  22.3      35 0.00076   30.3   0.5   35  129-172   101-135 (245)
 56 cd03278 ABC_SMC_barmotin Barmo  21.9      36 0.00078   29.0   0.5   15  161-175    26-40  (197)
 57 TIGR03263 guanyl_kin guanylate  21.8      35 0.00076   27.4   0.4   13  160-172     4-16  (180)
 58 TIGR00296 uncharacterized prot  21.5      50  0.0011   29.5   1.3   58  124-185    43-113 (200)
 59 cd03225 ABC_cobalt_CbiO_domain  21.5      36 0.00078   28.3   0.4   27  160-186    30-56  (211)
 60 KOG0951|consensus               21.5      70  0.0015   36.9   2.6   81   90-173  1080-1175(1674)
 61 TIGR01166 cbiO cobalt transpor  21.4      36 0.00078   28.0   0.4   26  160-185    21-46  (190)
 62 cd04119 RJL RJL (RabJ-Like) su  21.3      36 0.00079   25.8   0.3   12  160-171     3-14  (168)
 63 cd03224 ABC_TM1139_LivF_branch  21.3      36 0.00079   28.4   0.4   27  160-186    29-55  (222)
 64 PF14564 Membrane_bind:  Membra  21.0      93   0.002   25.5   2.7   24  159-182     3-27  (110)
 65 cd04160 Arfrp1 Arfrp1 subfamil  21.0      47   0.001   25.6   0.9   13  160-172     2-14  (167)
 66 PF12568 DUF3749:  Acetyltransf  20.9      51  0.0011   28.1   1.2   10  154-164    42-51  (128)
 67 PF13207 AAA_17:  AAA domain; P  20.8      37 0.00081   25.3   0.3   11  162-172     4-14  (121)
 68 PF02463 SMC_N:  RecF/RecN/SMC   20.7      48   0.001   27.7   1.0   31  142-172     6-39  (220)
 69 PRK13150 cytochrome c-type bio  20.7 1.2E+02  0.0026   26.7   3.4   35  110-144    98-140 (159)
 70 PF01935 DUF87:  Domain of unkn  20.6      27 0.00058   29.5  -0.6   15  161-175    27-41  (229)
 71 cd03235 ABC_Metallic_Cations A  20.6      38 0.00082   28.3   0.3   25  160-184    28-52  (213)
 72 cd03264 ABC_drug_resistance_li  20.6      38 0.00083   28.2   0.3   25  160-184    28-52  (211)
 73 cd04164 trmE TrmE (MnmE, ThdF,  20.6      41 0.00088   25.2   0.5   12  160-171     4-15  (157)
 74 COG1135 AbcC ABC-type metal io  20.5      38 0.00083   33.2   0.4   15  161-175    36-50  (339)
 75 cd03261 ABC_Org_Solvent_Resist  20.5      39 0.00084   28.7   0.4   27  160-186    29-55  (235)
 76 cd03292 ABC_FtsE_transporter F  20.4      39 0.00085   28.0   0.4   34  160-199    30-63  (214)
 77 PRK14257 phosphate ABC transpo  20.3      39 0.00084   31.4   0.4   17  160-176   111-127 (329)
 78 cd04123 Rab21 Rab21 subfamily.  20.3      46   0.001   25.1   0.7   13  160-172     3-15  (162)
 79 cd04139 RalA_RalB RalA/RalB su  20.2      46   0.001   25.2   0.7   12  160-171     3-14  (164)
 80 PF09547 Spore_IV_A:  Stage IV   20.2      67  0.0015   32.9   2.0   64   33-97     10-76  (492)
 81 TIGR02673 FtsE cell division A  20.1      40 0.00086   28.1   0.4   27  160-186    31-57  (214)

No 1  
>PF00853 Runt:  Runt domain;  InterPro: IPR013524 The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia []. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene []. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.  In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.  The protein is a heterodimer of alpha- and beta-subunits. The alpha-subunit binds DNA as a monomer, and appears to have a role in the development of normal hematopoiesis. CBF is a nuclear protein expressed in numerous tissue types, except brain and heart; highest levels have been found to occur in thymus, bone marrow and peripheral blood. This domain occurs towards the N terminus of the proteins in this entry.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1E50_E 1LJM_A 1CO1_A 1H9D_C 1CMO_A 1EAO_B 1HJC_D 1HJB_F 2J6W_B 1EAN_A ....
Probab=100.00  E-value=3e-87  Score=553.88  Aligned_cols=135  Identities=81%  Similarity=1.270  Sum_probs=116.9

Q ss_pred             hhhhhhhhhcCCCceeecCCCceEeecCCCccccCCCCCcceEEEEeeecCCCeEEEEeccCCCccceeccchhhhhccc
Q psy9229          74 ERTLGDFLSEHPGELVRTGSPQFVCTVLPPHWRSNKTLPVAFKVVALGDVMDGTIVTIRAGNDENYCAELRNCTAVMKNQ  153 (258)
Q Consensus        74 e~~~~~~l~~~~~elv~T~sP~~lcs~LP~HWR~NKtLP~~FkVvalg~v~DGt~Vtv~AGNdEn~~aeLRN~~a~mknq  153 (258)
                      ||+|.|+|+|||||||+||||||+||+||+||||||+||++|||||||||||||+|||||||||||||||||++|+||||
T Consensus         1 er~~~~~l~~~~~~lv~T~sP~~lcs~LP~HWR~NKsLP~~FkVvalg~V~DGT~Vtv~AGNDEn~~aElRN~tavmknq   80 (135)
T PF00853_consen    1 ERTLHEALAEHPGELVRTDSPNFLCSVLPSHWRSNKSLPVAFKVVALGDVPDGTLVTVMAGNDENYCAELRNATAVMKNQ   80 (135)
T ss_dssp             ---HHHHHHHSTCCEEECSSTTEEEES-TSEEETTSS-SS-EEEEESSS-STTEEEEEEEEESSCSSBBEES-EEEEETT
T ss_pred             CccHHHHHHhCCcccccCCCCCEEeecccccccccCCCCCceeEEEEEEcCCCcEEEEEecCCchhhhhhhchhhhhhcc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeecceeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCCCCCCCCCCc
Q psy9229         154 VAKFNDLRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPRSKTRK  208 (258)
Q Consensus       154 vA~FnDLRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGPRepRs~r~K  208 (258)
                      |||||||||||||||||||+|||+|+|+|||||||++|||||||||||||++++|
T Consensus        81 vA~FnDLRFvGRSGRGKsFtltItv~t~PpqvAty~~AIKVTVDGPRePR~~~~~  135 (135)
T PF00853_consen   81 VARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRSKRQK  135 (135)
T ss_dssp             EEEESS-EECST-TTTSEEEEEEEE-SSS-EEEEECCEEEEESS-SSCCG-----
T ss_pred             cccccccccccccCCccceEEEEEEeCCCchHHhheeeEEEEecCCCCCccccCC
Confidence            9999999999999999999999999999999999999999999999999999876


No 2  
>KOG3982|consensus
Probab=100.00  E-value=2.8e-81  Score=589.01  Aligned_cols=140  Identities=82%  Similarity=1.243  Sum_probs=135.9

Q ss_pred             hhhhhhhhhhhhhcCCCceeecCCCceEeecCCCccccCCCCCcceEEEEeeecCCCeEEEEeccCCCccceeccchhhh
Q psy9229          70 DILAERTLGDFLSEHPGELVRTGSPQFVCTVLPPHWRSNKTLPVAFKVVALGDVMDGTIVTIRAGNDENYCAELRNCTAV  149 (258)
Q Consensus        70 ~~~~e~~~~~~l~~~~~elv~T~sP~~lcs~LP~HWR~NKtLP~~FkVvalg~v~DGt~Vtv~AGNdEn~~aeLRN~~a~  149 (258)
                      +.+.+|+|+|+|+|||||||+||||||||++||+|||||||||+||||||||||||||+||||||||||||+|||||+|+
T Consensus        94 mt~~~rt~~~~laehpgeLvrT~SPn~lcs~LP~HWRsNKtlp~aFkVvaLgdVpDgT~Vti~aGNDEnyc~ElRN~tA~  173 (475)
T KOG3982|consen   94 MTLVFRTVVEFLAEHPGELVRTSSPNFLCSVLPTHWRSNKTLPVAFKVVALGDVPDGTLVTIMAGNDENYCAELRNCTAV  173 (475)
T ss_pred             hhhhHHHHHHHHHhCccceeecCCCceeeecCcchhccCCcccceeEEEEecccCCCcEEEEEecCCcchhHHhhhhHHH
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccceeecceeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCCCCCC-CCCCcc
Q psy9229         150 MKNQVAKFNDLRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPR-SKTRKS  209 (258)
Q Consensus       150 mknqvA~FnDLRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGPRepR-s~r~KS  209 (258)
                      |||||||||||||||||||||+|||||+|+|+|||||||+|||||||||||||| +|-+++
T Consensus       174 mknQVAkFNDLRFVGRSGRGKsFtLTIti~TnP~qvATy~kaIKVTVDGPRepRr~K~~~~  234 (475)
T KOG3982|consen  174 MKNQVAKFNDLRFVGRSGRGKSFTLTITIFTNPPQVATYHKAIKVTVDGPREPRRSKLSDQ  234 (475)
T ss_pred             HHhhhhhhccceeecccCCCcceEEEEEEecCCcceeeeeceEEEeccCCCcccccccccc
Confidence            999999999999999999999999999999999999999999999999999999 555555


No 3  
>PF00853 Runt:  Runt domain;  InterPro: IPR013524 The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia []. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene []. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.  In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.  The protein is a heterodimer of alpha- and beta-subunits. The alpha-subunit binds DNA as a monomer, and appears to have a role in the development of normal hematopoiesis. CBF is a nuclear protein expressed in numerous tissue types, except brain and heart; highest levels have been found to occur in thymus, bone marrow and peripheral blood. This domain occurs towards the N terminus of the proteins in this entry.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1E50_E 1LJM_A 1CO1_A 1H9D_C 1CMO_A 1EAO_B 1HJC_D 1HJB_F 2J6W_B 1EAN_A ....
Probab=99.83  E-value=5.9e-21  Score=159.23  Aligned_cols=108  Identities=39%  Similarity=0.494  Sum_probs=85.5

Q ss_pred             EEeccCCCccceeccchhhhhcccceeecceeeeecCCCCCcceEE------------EEEecCCCeeeeeeeeEEEeee
Q psy9229         130 TIRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLT------------ITISSSPPQVTTYSKAIKVTVD  197 (258)
Q Consensus       130 tv~AGNdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsftlt------------Itv~t~PPqvAt~~~AIKVtvD  197 (258)
                      .|..|+..-.|.-|..+|...|...+.|.- -.+|.-..|...||.            .....+..|+|.|++..+|   
T Consensus        15 lv~T~sP~~lcs~LP~HWR~NKsLP~~FkV-valg~V~DGT~Vtv~AGNDEn~~aElRN~tavmknqvA~FnDLRFv---   90 (135)
T PF00853_consen   15 LVRTDSPNFLCSVLPSHWRSNKSLPVAFKV-VALGDVPDGTLVTVMAGNDENYCAELRNATAVMKNQVARFNDLRFV---   90 (135)
T ss_dssp             EEECSSTTEEEES-TSEEETTSS-SS-EEE-EESSS-STTEEEEEEEEESSCSSBBEES-EEEEETTEEEESS-EEC---
T ss_pred             cccCCCCCEEeecccccccccCCCCCceeE-EEEEEcCCCcEEEEEecCCchhhhhhhchhhhhhcccccccccccc---
Confidence            468899999999999999999999999975 566889999887776            3444556899999999999   


Q ss_pred             CCCCCCCCCCcceeeEEEeecCCCceeeeccceeeeeeCCCCCCCCCc
Q psy9229         198 GPREPRSKTRKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPRSKTI  245 (258)
Q Consensus       198 GPRepRs~r~KSf~lTItisTSPPqvat~~~AIKVtVDGPRePR~k~~  245 (258)
                          +||||||||+++|++.|+||||+||++|||||||||||||++..
T Consensus        91 ----GRSGRGKsFtltItv~t~PpqvAty~~AIKVTVDGPRePR~~~~  134 (135)
T PF00853_consen   91 ----GRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRSKRQ  134 (135)
T ss_dssp             ----ST-TTTSEEEEEEEE-SSS-EEEEECCEEEEESS-SSCCG----
T ss_pred             ----cccCCccceEEEEEEeCCCchHHhheeeEEEEecCCCCCccccC
Confidence                99999999999999999999999999999999999999999864


No 4  
>KOG3982|consensus
Probab=99.71  E-value=6.4e-18  Score=160.97  Aligned_cols=109  Identities=40%  Similarity=0.478  Sum_probs=96.6

Q ss_pred             EEeccCCCccceeccchhhhhcccceeecceeeeecCCCCCcceEE------------EEEecCCCeeeeeeeeEEEeee
Q psy9229         130 TIRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLT------------ITISSSPPQVTTYSKAIKVTVD  197 (258)
Q Consensus       130 tv~AGNdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsftlt------------Itv~t~PPqvAt~~~AIKVtvD  197 (258)
                      .|+.+...-.|..|.++|...|..-..|+. ..+|..=.|.-.++.            .+-.....|||.|++..+|   
T Consensus       112 LvrT~SPn~lcs~LP~HWRsNKtlp~aFkV-vaLgdVpDgT~Vti~aGNDEnyc~ElRN~tA~mknQVAkFNDLRFV---  187 (475)
T KOG3982|consen  112 LVRTSSPNFLCSVLPTHWRSNKTLPVAFKV-VALGDVPDGTLVTIMAGNDENYCAELRNCTAVMKNQVAKFNDLRFV---  187 (475)
T ss_pred             eeecCCCceeeecCcchhccCCcccceeEE-EEecccCCCcEEEEEecCCcchhHHhhhhHHHHHhhhhhhccceee---
Confidence            468899999999999999999999999997 577877788777665            3444556899999999999   


Q ss_pred             CCCCCCCCCCcceeeEEEeecCCCceeeeccceeeeeeCCCCCC-CCCcc
Q psy9229         198 GPREPRSKTRKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPR-SKTIL  246 (258)
Q Consensus       198 GPRepRs~r~KSf~lTItisTSPPqvat~~~AIKVtVDGPRePR-~k~~~  246 (258)
                          +||||||+|+|+|+|.|.|+||+||++||||||||||||| +|..-
T Consensus       188 ----GRSGRGKsFtLTIti~TnP~qvATy~kaIKVTVDGPRepRr~K~~~  233 (475)
T KOG3982|consen  188 ----GRSGRGKSFTLTITIFTNPPQVATYHKAIKVTVDGPREPRRSKLSD  233 (475)
T ss_pred             ----cccCCCcceEEEEEEecCCcceeeeeceEEEeccCCCccccccccc
Confidence                9999999999999999999999999999999999999999 55543


No 5  
>PF04028 DUF374:  Domain of unknown function (DUF374);  InterPro: IPR007172 This is a bacterial domain of unknown function.
Probab=58.24  E-value=6.4  Score=30.11  Aligned_cols=14  Identities=57%  Similarity=1.032  Sum_probs=11.1

Q ss_pred             eEEEeeeCCCCCCC
Q psy9229         191 AIKVTVDGPREPRS  204 (258)
Q Consensus       191 AIKVtvDGPRepRs  204 (258)
                      -+=+|.||||-||+
T Consensus        61 ~~~itpDGPrGP~r   74 (74)
T PF04028_consen   61 SIAITPDGPRGPRR   74 (74)
T ss_pred             eEEEeCCCCCCCCC
Confidence            34579999999984


No 6  
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=55.90  E-value=7.9  Score=30.95  Aligned_cols=11  Identities=45%  Similarity=0.694  Sum_probs=10.1

Q ss_pred             eeecCCCCCcc
Q psy9229         162 FVGRSGRGKSF  172 (258)
Q Consensus       162 FvGRSGRGKsf  172 (258)
                      |+|++|.|||=
T Consensus       107 ~~G~~nvGKSt  117 (157)
T cd01858         107 FIGYPNVGKSS  117 (157)
T ss_pred             EEeCCCCChHH
Confidence            99999999984


No 7  
>PRK10738 hypothetical protein; Provisional
Probab=53.03  E-value=15  Score=30.23  Aligned_cols=82  Identities=16%  Similarity=0.281  Sum_probs=45.9

Q ss_pred             hcccceeecceeeeecCCCCCcceEEEE---EecCCCee-----eee---------------eeeEEEeeeCCCCCCCCC
Q psy9229         150 MKNQVAKFNDLRFVGRSGRGKSFTLTIT---ISSSPPQV-----TTY---------------SKAIKVTVDGPREPRSKT  206 (258)
Q Consensus       150 mknqvA~FnDLRFvGRSGRGKsftltIt---v~t~PPqv-----At~---------------~~AIKVtvDGPRepRs~r  206 (258)
                      ||-.+..-.|++|+|++.+|..+.+---   -.-+|.++     +..               -+.|.|.|+|-|..-..+
T Consensus         1 m~~~~~w~~~~~f~~~~~~g~~i~~D~~G~~~g~~P~EllL~aLg~Ct~i~v~~~l~k~~~~~~~~~v~v~~~r~~~~p~   80 (134)
T PRK10738          1 MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERREEAPR   80 (134)
T ss_pred             CEEEEEEeCCcEEEEEcCCCCEEEEcCCCCCCCCCHHHHHHHHHcCchHHHHHHHHHHCCCCcccEEEEEEEEEcccCCC
Confidence            3444444568999999999987665421   01122121     110               167889999987643333


Q ss_pred             C-cceeeEEEeecC-CCceeeeccceee
Q psy9229         207 R-KSFTLTITISSS-PPQVTTYSKAIKV  232 (258)
Q Consensus       207 ~-KSf~lTItisTS-PPqvat~~~AIKV  232 (258)
                      . ..+.+++.+..+ -++ ....|++..
T Consensus        81 ~f~~I~~~~~~~g~~l~~-e~~~rav~l  107 (134)
T PRK10738         81 LFTHINLHFIVTGKDLKD-AAVARAVDL  107 (134)
T ss_pred             cccEEEEEEEEECCCCCH-HHHHHHHHH
Confidence            2 457777777542 333 445555543


No 8  
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=51.85  E-value=7.2  Score=28.97  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=11.9

Q ss_pred             ceeeeecCCCCCcc
Q psy9229         159 DLRFVGRSGRGKSF  172 (258)
Q Consensus       159 DLRFvGRSGRGKsf  172 (258)
                      |+-++|++|.|||=
T Consensus         1 ~i~i~G~~~~GKss   14 (159)
T cd04159           1 EITLVGLQNSGKTT   14 (159)
T ss_pred             CEEEEcCCCCCHHH
Confidence            56799999999974


No 9  
>COG0432 Uncharacterized conserved protein [Function unknown]
Probab=42.57  E-value=30  Score=29.85  Aligned_cols=32  Identities=31%  Similarity=0.475  Sum_probs=28.8

Q ss_pred             eEEEEEecCCCeeeeeeeeEEEeeeCCCCCCC
Q psy9229         173 TLTITISSSPPQVTTYSKAIKVTVDGPREPRS  204 (258)
Q Consensus       173 tltItv~t~PPqvAt~~~AIKVtvDGPRepRs  204 (258)
                      .++|=|.-..+.+.||+.-+.+-.||||..|+
T Consensus        99 S~~iPv~~GrL~LGTWQ~I~~~E~dg~r~~R~  130 (137)
T COG0432          99 SLTIPVINGRLVLGTWQGIFLVEFDGPRHRRR  130 (137)
T ss_pred             eEEEEEeCCeEceecccEEEEEEecCCCCccE
Confidence            47888888999999999999999999998775


No 10 
>TIGR03729 acc_ester putative phosphoesterase. Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system.
Probab=41.49  E-value=26  Score=30.20  Aligned_cols=42  Identities=26%  Similarity=0.488  Sum_probs=26.9

Q ss_pred             CeEEEEeccCCCcc----ceeccch--hhhhcccceee--cceeeeecCC
Q psy9229         126 GTIVTIRAGNDENY----CAELRNC--TAVMKNQVAKF--NDLRFVGRSG  167 (258)
Q Consensus       126 Gt~Vtv~AGNdEn~----~aeLRN~--~a~mknqvA~F--nDLRFvGRSG  167 (258)
                      +..|.+-.||-|.+    ..+++..  .-.+.+....|  +++||+|=.|
T Consensus        61 ~~pv~~v~GNHD~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~ig~~g  110 (239)
T TIGR03729        61 GIKVTFNAGNHDMLKDLTYEEIESNDSPLYLHNRFIDIPNTQWRIIGNNG  110 (239)
T ss_pred             CCcEEEECCCCCCCCCCCHHHHHhccchhhhcccccccCCCceEEEeecc
Confidence            35677889999976    2224431  11355566677  8999999654


No 11 
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=40.67  E-value=17  Score=29.57  Aligned_cols=44  Identities=16%  Similarity=0.171  Sum_probs=26.1

Q ss_pred             EEEEeccCCCccceeccchhhhhc-----ccceeec----ceeeeecCCCCCcc
Q psy9229         128 IVTIRAGNDENYCAELRNCTAVMK-----NQVAKFN----DLRFVGRSGRGKSF  172 (258)
Q Consensus       128 ~Vtv~AGNdEn~~aeLRN~~a~mk-----nqvA~Fn----DLRFvGRSGRGKsf  172 (258)
                      .+.|.|-++++ ..||++....+-     +.-+++.    .+.++|++|.|||=
T Consensus        78 vi~iSa~~~~g-i~~L~~~l~~~l~~~~~~~~~~~~~~~~~~~~~G~~~vGKst  130 (171)
T cd01856          78 VLFVNAKSGKG-VKKLLKAAKKLLKDIEKLKAKGLLPRGIRAMVVGIPNVGKST  130 (171)
T ss_pred             EEEEECCCccc-HHHHHHHHHHHHHHHhhhhhcccCCCCeEEEEECCCCCCHHH
Confidence            46677777665 455665544331     1111111    37899999999974


No 12 
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=39.12  E-value=14  Score=31.41  Aligned_cols=15  Identities=40%  Similarity=0.561  Sum_probs=12.0

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      -++|.+|.|||=.|.
T Consensus        32 ~i~G~NGsGKSTll~   46 (213)
T cd03279          32 LICGPTGAGKSTILD   46 (213)
T ss_pred             EEECCCCCCHHHHHH
Confidence            489999999986544


No 13 
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=38.69  E-value=67  Score=29.35  Aligned_cols=112  Identities=19%  Similarity=0.258  Sum_probs=63.6

Q ss_pred             hhhhhhcCCCceeecCCCceEeecCCCccccCCCCCcceEEEEeee--cCCCe-EEEEeccCCCcccee-----------
Q psy9229          77 LGDFLSEHPGELVRTGSPQFVCTVLPPHWRSNKTLPVAFKVVALGD--VMDGT-IVTIRAGNDENYCAE-----------  142 (258)
Q Consensus        77 ~~~~l~~~~~elv~T~sP~~lcs~LP~HWR~NKtLP~~FkVvalg~--v~DGt-~Vtv~AGNdEn~~ae-----------  142 (258)
                      +.+.|+...+.-+-.++|.+-|. ||          ...+|-+.++  .+.|+ .++|+--+..+++-+           
T Consensus        42 ~~~~l~~~~~~~l~~~~p~~~~~-l~----------~g~Rv~~~~~p~~~~~~~~i~IRk~~~~~~sl~~l~~~g~~~~~  110 (308)
T TIGR02788        42 LARAIASFSKQSISEENPILSAT-LP----------GGERVQIVIPPACENDTVSITIRKPSLVDFSLDDYEEKGFFDTV  110 (308)
T ss_pred             HHHHHHHHhCCcccCCCceEEEE-CC----------CCeEEEEECCCcccCCCceEEEECCCCCCCCHHHHHHcCCcccc
Confidence            34444555565566788988887 34          3456766653  45566 888988776655422           


Q ss_pred             -------------ccc------hhhhhcccceeecceeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCCCCCC
Q psy9229         143 -------------LRN------CTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPR  203 (258)
Q Consensus       143 -------------LRN------~~a~mknqvA~FnDLRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGPRepR  203 (258)
                                   |..      ....++..+..=.-+=++|.+|.||+=.+...+.--||.-      .-|+++-++|-.
T Consensus       111 ~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~v~~~~~ili~G~tGsGKTTll~al~~~~~~~~------~iv~ied~~El~  184 (308)
T TIGR02788       111 RAQSGTLSDNDEQLLELLDAGDIKEFLRLAIASRKNIIISGGTGSGKTTFLKSLVDEIPKDE------RIITIEDTREIF  184 (308)
T ss_pred             cccccccchhhHHHHHhhhhHHHHHHHHHHhhCCCEEEEECCCCCCHHHHHHHHHccCCccc------cEEEEcCccccC
Confidence                         110      0111222232334567999999999976654444445432      134667677754


Q ss_pred             CC
Q psy9229         204 SK  205 (258)
Q Consensus       204 s~  205 (258)
                      -.
T Consensus       185 ~~  186 (308)
T TIGR02788       185 LP  186 (308)
T ss_pred             CC
Confidence            43


No 14 
>PF10442 FIST_C:  FIST C domain;  InterPro: IPR019494  This entry represents a novel sensory domain, designated FIST C (short for F-box and intracellular signal transduction, C-terminal), which is present in signal transduction proteins from bacteria, archaea and eukaryotes. The chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids []. 
Probab=37.72  E-value=39  Score=26.43  Aligned_cols=33  Identities=21%  Similarity=0.311  Sum_probs=27.8

Q ss_pred             EEeeecCCCeEEEEeccCCCccceeccchhhhh
Q psy9229         118 VALGDVMDGTIVTIRAGNDENYCAELRNCTAVM  150 (258)
Q Consensus       118 valg~v~DGt~Vtv~AGNdEn~~aeLRN~~a~m  150 (258)
                      .-.++|+.|+.|.+|-+|.+.....++.....+
T Consensus        51 ~~~~~v~eG~~v~l~~~~~~~~~~~~~~~~~~~   83 (136)
T PF10442_consen   51 TFAGDVPEGSEVQLMEGDPEDIIESAEEALEKA   83 (136)
T ss_pred             EEeeecCCCCEEEEEcCCHHHHHHHHHHHHHhh
Confidence            445799999999999999988888887776666


No 15 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=37.63  E-value=16  Score=27.37  Aligned_cols=16  Identities=44%  Similarity=0.721  Sum_probs=12.7

Q ss_pred             ceeeeecCCCCCcceE
Q psy9229         159 DLRFVGRSGRGKSFTL  174 (258)
Q Consensus       159 DLRFvGRSGRGKsftl  174 (258)
                      |+-++|.+|.||+--+
T Consensus         1 ~i~l~G~~g~GKTtL~   16 (170)
T cd01876           1 EIAFAGRSNVGKSSLI   16 (170)
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            5678999999998533


No 16 
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=34.40  E-value=19  Score=29.84  Aligned_cols=14  Identities=57%  Similarity=0.866  Sum_probs=11.5

Q ss_pred             eeeeecCCCCCcce
Q psy9229         160 LRFVGRSGRGKSFT  173 (258)
Q Consensus       160 LRFvGRSGRGKsft  173 (258)
                      +-+|||+|.|||=.
T Consensus         3 i~lvG~~g~GKSsl   16 (196)
T cd01852           3 LVLVGKTGAGKSAT   16 (196)
T ss_pred             EEEECCCCCCHHHH
Confidence            45899999999853


No 17 
>TIGR00149 TIGR00149_YbjQ secondary thiamine-phosphate synthase enzyme. Members of this protein family have been studied extensively by crystallography. Members from several different species have been shown to have sufficient thiamin phosphate synthase activity (EC 2.5.1.3) to complement thiE mutants. However, it is presumed that this is a secondary activity, and the primary function of this enzyme remains unknown.
Probab=33.74  E-value=37  Score=28.50  Aligned_cols=28  Identities=21%  Similarity=0.386  Sum_probs=25.4

Q ss_pred             EEEEEecCCCeeeeeeeeEEEeeeCCCC
Q psy9229         174 LTITISSSPPQVTTYSKAIKVTVDGPRE  201 (258)
Q Consensus       174 ltItv~t~PPqvAt~~~AIKVtvDGPRe  201 (258)
                      ++|-|.-...++.+|+.-+.+--||||+
T Consensus        95 ~tipi~dG~L~LGtwQ~I~l~E~Dg~r~  122 (132)
T TIGR00149        95 QHVPVENGRLQLGTWQGIFFAEFDGPRT  122 (132)
T ss_pred             EEEEEeCCEEcccCccEEEEEECCCCCC
Confidence            6777778889999999999999999996


No 18 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=33.64  E-value=22  Score=26.46  Aligned_cols=24  Identities=25%  Similarity=0.411  Sum_probs=17.4

Q ss_pred             hhcccceeec----ceeeeecCCCCCcc
Q psy9229         149 VMKNQVAKFN----DLRFVGRSGRGKSF  172 (258)
Q Consensus       149 ~mknqvA~Fn----DLRFvGRSGRGKsf  172 (258)
                      ..+++...|+    ..-+.|.+|.|||=
T Consensus        11 ~f~~~~~~~~~~g~~tli~G~nGsGKST   38 (62)
T PF13555_consen   11 SFDGETIDFDPRGDVTLITGPNGSGKST   38 (62)
T ss_pred             ccCCeEEeecCCCcEEEEECCCCCCHHH
Confidence            3445666775    36689999999983


No 19 
>PF01894 UPF0047:  Uncharacterised protein family UPF0047;  InterPro: IPR001602 This family contains small uncharacterised proteins of 14 to 16 kDa mainly from bacteria although the signatures also occur in a hypothetical protein from archaea and from yeast.; PDB: 1VPH_E 2P6C_A 2CU5_A 1VMJ_A 1XBF_B 1VMH_A 1VE0_A 2P6H_B 1VMF_C.
Probab=32.77  E-value=23  Score=29.20  Aligned_cols=29  Identities=31%  Similarity=0.521  Sum_probs=22.0

Q ss_pred             eEEEEEecCCCeeeeeeeeEEEeeeCCCC
Q psy9229         173 TLTITISSSPPQVTTYSKAIKVTVDGPRE  201 (258)
Q Consensus       173 tltItv~t~PPqvAt~~~AIKVtvDGPRe  201 (258)
                      .++|-|.-...++.+|+.-+.+--||||+
T Consensus        82 S~~vpv~~G~L~LGtwQ~I~l~E~dgpr~  110 (118)
T PF01894_consen   82 SLTVPVHDGKLALGTWQGIYLVEFDGPRE  110 (118)
T ss_dssp             EEEEEEETTEE---TTEEEEEEESS-SSE
T ss_pred             eEEEEEECCEEccCCcCEEEEEECCCCCe
Confidence            37788888889999999999999999884


No 20 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=32.61  E-value=20  Score=27.39  Aligned_cols=16  Identities=44%  Similarity=0.650  Sum_probs=12.8

Q ss_pred             eeeeecCCCCCcceEE
Q psy9229         160 LRFVGRSGRGKSFTLT  175 (258)
Q Consensus       160 LRFvGRSGRGKsftlt  175 (258)
                      +-++|++|.|||=-|.
T Consensus        14 ~~i~G~nGsGKStLl~   29 (137)
T PF00005_consen   14 VAIVGPNGSGKSTLLK   29 (137)
T ss_dssp             EEEEESTTSSHHHHHH
T ss_pred             EEEEccCCCcccccee
Confidence            4689999999986554


No 21 
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=32.49  E-value=30  Score=30.57  Aligned_cols=51  Identities=22%  Similarity=0.327  Sum_probs=28.2

Q ss_pred             eEEEEeccCCCccc-------eeccchhhhhcccceeeccee----------eeecCCCCCcceEEEEE
Q psy9229         127 TIVTIRAGNDENYC-------AELRNCTAVMKNQVAKFNDLR----------FVGRSGRGKSFTLTITI  178 (258)
Q Consensus       127 t~Vtv~AGNdEn~~-------aeLRN~~a~mknqvA~FnDLR----------FvGRSGRGKsftltItv  178 (258)
                      |+|-|...|+|..-       =+++|.+-...+. ..|+|+-          .+|.||.|||=-|.+-.
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~-~il~~vsl~i~~Ge~~~I~G~nGsGKSTLl~~i~   71 (271)
T PRK14238          4 TVVNVQVKNEEKIETAPKKVVFDTQNLNLWYGED-HALKNINLDIHENEVTAIIGPSGCGKSTYIKTLN   71 (271)
T ss_pred             eEEEEEecchhhhccCCCceEEEEeeeEEEECCc-ceeeeeEEEEcCCCEEEEECCCCCCHHHHHHHHH
Confidence            56667777766432       2344443322221 2344443          57999999997555433


No 22 
>PF12846 AAA_10:  AAA-like domain
Probab=32.39  E-value=12  Score=31.51  Aligned_cols=15  Identities=33%  Similarity=0.660  Sum_probs=13.0

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      =++|.+|.|||+.+.
T Consensus         5 ~i~G~tGsGKT~~~~   19 (304)
T PF12846_consen    5 LILGKTGSGKTTLLK   19 (304)
T ss_pred             EEECCCCCcHHHHHH
Confidence            478999999998776


No 23 
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=30.00  E-value=25  Score=33.21  Aligned_cols=15  Identities=47%  Similarity=0.660  Sum_probs=11.3

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      -.+|+||.|||=-|.
T Consensus        34 aiIG~SGaGKSTLLR   48 (258)
T COG3638          34 AIIGPSGAGKSTLLR   48 (258)
T ss_pred             EEECCCCCcHHHHHH
Confidence            347999999995444


No 24 
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=29.95  E-value=20  Score=26.85  Aligned_cols=12  Identities=42%  Similarity=0.761  Sum_probs=10.4

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      .-++|++|.|||
T Consensus         2 V~iiG~~~~GKS   13 (116)
T PF01926_consen    2 VAIIGRPNVGKS   13 (116)
T ss_dssp             EEEEESTTSSHH
T ss_pred             EEEECCCCCCHH
Confidence            358999999998


No 25 
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=29.74  E-value=29  Score=30.10  Aligned_cols=32  Identities=25%  Similarity=0.335  Sum_probs=19.4

Q ss_pred             ccchhhhhcccceeecc-e-eeeecCCCCCcceEE
Q psy9229         143 LRNCTAVMKNQVAKFND-L-RFVGRSGRGKSFTLT  175 (258)
Q Consensus       143 LRN~~a~mknqvA~FnD-L-RFvGRSGRGKsftlt  175 (258)
                      |+|.... ++..-.|++ + -|+|++|.|||=-|.
T Consensus         8 i~nfr~~-~~~~i~~~~g~n~i~G~NgsGKS~lle   41 (213)
T cd03277           8 LENFVTY-DETEFRPGPSLNMIIGPNGSGKSSIVC   41 (213)
T ss_pred             EeCCCCc-ceeEEecCCCeEEEECCCCCCHHHHHH
Confidence            4444443 343445554 2 689999999985443


No 26 
>PF05356 Phage_Coat_B:  Phage Coat protein B ;  InterPro: IPR008020 The major coat protein in the capsid of filamentous bacteriophage forms a helical assembly of about 7000 identical protomers, with each protomer comprised of 46 amino acids, after the cleavage of the signal peptide. Each protomer forms a slightly curved helix that combines to form a tubular structure that encapsulates the viral DNA [].; PDB: 1QL1_A 2XKM_A 4IFM_A 1QL2_A 1IFM_A 2KLV_A 1IFN_A 2IFN_A 3IFM_A 2KSJ_A ....
Probab=29.45  E-value=18  Score=29.08  Aligned_cols=13  Identities=38%  Similarity=0.537  Sum_probs=0.0

Q ss_pred             hhcccceeeccee
Q psy9229         149 VMKNQVAKFNDLR  161 (258)
Q Consensus       149 ~mknqvA~FnDLR  161 (258)
                      -||||++|||-.+
T Consensus         3 ~mkq~i~kf~~v~   15 (83)
T PF05356_consen    3 GMKQAIAKFRPVP   15 (83)
T ss_dssp             -------------
T ss_pred             hHHHHHHhcCCcH
Confidence            5999999999875


No 27 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=29.20  E-value=12  Score=34.90  Aligned_cols=46  Identities=28%  Similarity=0.405  Sum_probs=28.3

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCCC--CCCCCCCccee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGPR--EPRSKTRKSFT  211 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGPR--epRs~r~KSf~  211 (258)
                      +-+||.||+|||=-|.|----..|+-..      |.+||..  +|...++--|+
T Consensus        32 vsilGpSGcGKSTLLriiAGL~~p~~G~------V~~~g~~v~~p~~~~~~vFQ   79 (248)
T COG1116          32 VAILGPSGCGKSTLLRLIAGLEKPTSGE------VLLDGRPVTGPGPDIGYVFQ   79 (248)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCCce------EEECCcccCCCCCCEEEEec
Confidence            4568999999997666554455555543      6666654  44444443333


No 28 
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=29.15  E-value=23  Score=28.72  Aligned_cols=18  Identities=28%  Similarity=0.241  Sum_probs=14.4

Q ss_pred             eeeeecCCCCCcceEEEE
Q psy9229         160 LRFVGRSGRGKSFTLTIT  177 (258)
Q Consensus       160 LRFvGRSGRGKsftltIt  177 (258)
                      +-++|.||.|||=.+.+.
T Consensus        18 v~I~GpSGsGKSTLl~~l   35 (107)
T cd00820          18 VLITGDSGIGKTELALEL   35 (107)
T ss_pred             EEEEcCCCCCHHHHHHHh
Confidence            468999999999766653


No 29 
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=28.99  E-value=22  Score=30.82  Aligned_cols=15  Identities=40%  Similarity=0.543  Sum_probs=11.9

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      =+||.||.|||=.|.
T Consensus        29 ~IvG~NGsGKStll~   43 (251)
T cd03273          29 AITGLNGSGKSNILD   43 (251)
T ss_pred             EEECCCCCCHHHHHH
Confidence            479999999985543


No 30 
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=28.70  E-value=19  Score=27.66  Aligned_cols=14  Identities=43%  Similarity=0.698  Sum_probs=0.0

Q ss_pred             eeecCCCCCcceEE
Q psy9229         162 FVGRSGRGKSFTLT  175 (258)
Q Consensus       162 FvGRSGRGKsftlt  175 (258)
                      +||.+|.|||--|.
T Consensus         4 iiG~N~sGKS~il~   17 (303)
T PF13304_consen    4 IIGPNGSGKSNILE   17 (303)
T ss_dssp             --------------
T ss_pred             cccccccccccccc
Confidence            79999999997665


No 31 
>PF02575 YbaB_DNA_bd:  YbaB/EbfC DNA-binding family;  InterPro: IPR004401 The function of this protein is unknown. It is restricted to bacteria and a few plants, such as Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A crystal structure of one member, YbaB from Haemophilus influenzae, revealed a core structure consisting of two layers, alpha/beta; YbaB forms a tight dimer with a 3-layer structure, beta/alpha/beta []. YbaB is co-transcribed with RecR, which appears to protect DNA strands of the replilcation fork when it is blocked by DNA damage. A deletion of the YbaB operon resulted in increased sensitivity to DNA-damaging agents compared with the wild-type strain.; PDB: 1PUG_B 3F42_B 1YBX_B 1J8B_A.
Probab=28.67  E-value=19  Score=27.11  Aligned_cols=26  Identities=19%  Similarity=0.449  Sum_probs=18.4

Q ss_pred             cchhhhhcccceeecceeeeecCCCC
Q psy9229         144 RNCTAVMKNQVAKFNDLRFVGRSGRG  169 (258)
Q Consensus       144 RN~~a~mknqvA~FnDLRFvGRSGRG  169 (258)
                      ++..+.|+.--.++..++|.|.|+.|
T Consensus         5 ~~~~~~~~~~~~~l~~~~~~~~s~~g   30 (93)
T PF02575_consen    5 QEMQEKMEEAQEELAEIEVTGTSGDG   30 (93)
T ss_dssp             HHHHHHHHHHHHHHHHSEEEEEETCC
T ss_pred             HHHHHHHHHHHHHHhcCEEEEEECCC
Confidence            33444455555667789999999998


No 32 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=28.56  E-value=25  Score=27.13  Aligned_cols=13  Identities=46%  Similarity=0.705  Sum_probs=11.5

Q ss_pred             ceeeeecCCCCCc
Q psy9229         159 DLRFVGRSGRGKS  171 (258)
Q Consensus       159 DLRFvGRSGRGKs  171 (258)
                      |+-+||++|.|||
T Consensus         2 ~v~ivG~~~~GKS   14 (170)
T cd01898           2 DVGLVGLPNAGKS   14 (170)
T ss_pred             CeEEECCCCCCHH
Confidence            5679999999997


No 33 
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=28.40  E-value=36  Score=26.92  Aligned_cols=44  Identities=23%  Similarity=0.193  Sum_probs=28.9

Q ss_pred             EEEEeccCCCccceeccchhhhhcccceeecceeeeecCCCCCcc
Q psy9229         128 IVTIRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF  172 (258)
Q Consensus       128 ~Vtv~AGNdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsf  172 (258)
                      .+.+.|-+.++ ..||++....+-..-++.-..-++|.+|.|||=
T Consensus        73 ~~~iSa~~~~g-i~~L~~~l~~~~~~~~~~~~~~~ig~~~~Gkss  116 (156)
T cd01859          73 VVYVSAKERLG-TKILRRTIKELAKIDGKEGKVGVVGYPNVGKSS  116 (156)
T ss_pred             EEEEEcccccc-HHHHHHHHHHHHhhcCCCcEEEEECCCCCCHHH
Confidence            45666655554 467777665543333445556899999999974


No 34 
>PRK13159 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=28.17  E-value=71  Score=27.98  Aligned_cols=32  Identities=38%  Similarity=0.621  Sum_probs=27.0

Q ss_pred             CCCcceE----EEEeeecCCCeEE--EEeccCCCccce
Q psy9229         110 TLPVAFK----VVALGDVMDGTIV--TIRAGNDENYCA  141 (258)
Q Consensus       110 tLP~~Fk----Vvalg~v~DGt~V--tv~AGNdEn~~a  141 (258)
                      -||..||    ||+-|..-||+.+  +|.|--||||-.
T Consensus        92 ilPDlFrEGqgVVaeG~~~~g~F~A~~vLAKHde~YmP  129 (155)
T PRK13159         92 ILPDLFRDNQSVIANGRMQGGRFVANEVLAKHDETYMP  129 (155)
T ss_pred             CCCccccCCCeEEEEEEEcCCEEEEeEEEecCCCcCCC
Confidence            5788887    9999988889844  899999999973


No 35 
>KOG1068|consensus
Probab=27.81  E-value=36  Score=31.90  Aligned_cols=37  Identities=27%  Similarity=0.311  Sum_probs=21.7

Q ss_pred             cceEEEEEecCCCeeeeee-eeEEE--eeeCCCCCCCCCC
Q psy9229         171 SFTLTITISSSPPQVTTYS-KAIKV--TVDGPREPRSKTR  207 (258)
Q Consensus       171 sftltItv~t~PPqvAt~~-~AIKV--tvDGPRepRs~r~  207 (258)
                      .|...|-+.++.--.|-++ .-.||  .|.||||+|.+..
T Consensus        25 ~i~~~~g~~~~a~GSay~E~GnTKVl~aV~GPre~~~~~~   64 (245)
T KOG1068|consen   25 RIYARIGVLTQADGSAYMEQGNTKVLCAVYGPREIRGKSA   64 (245)
T ss_pred             hhhhhcCccccCCccchhhcCCeEEEEEEeCCcccccccc
Confidence            3444455555554333332 12344  8999999998665


No 36 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=27.69  E-value=30  Score=26.78  Aligned_cols=15  Identities=27%  Similarity=0.587  Sum_probs=12.4

Q ss_pred             cceeeeecCCCCCcc
Q psy9229         158 NDLRFVGRSGRGKSF  172 (258)
Q Consensus       158 nDLRFvGRSGRGKsf  172 (258)
                      -.+-++|.+|.|||=
T Consensus         8 ~~v~v~G~~~~GKSs   22 (169)
T cd04114           8 FKIVLIGNAGVGKTC   22 (169)
T ss_pred             eEEEEECCCCCCHHH
Confidence            457899999999973


No 37 
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=26.98  E-value=26  Score=29.70  Aligned_cols=12  Identities=58%  Similarity=0.805  Sum_probs=10.4

Q ss_pred             eeeecCCCCCcc
Q psy9229         161 RFVGRSGRGKSF  172 (258)
Q Consensus       161 RFvGRSGRGKsf  172 (258)
                      =++|++|.|||=
T Consensus        27 ~i~GpNGsGKSt   38 (243)
T cd03272          27 VVVGRNGSGKSN   38 (243)
T ss_pred             EEECCCCCCHHH
Confidence            489999999984


No 38 
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=26.88  E-value=21  Score=27.61  Aligned_cols=10  Identities=50%  Similarity=0.687  Sum_probs=9.1

Q ss_pred             eeecCCCCCc
Q psy9229         162 FVGRSGRGKS  171 (258)
Q Consensus       162 FvGRSGRGKs  171 (258)
                      |+|++|.|||
T Consensus         1 iiG~~~~GKS   10 (176)
T cd01881           1 LVGLPNVGKS   10 (176)
T ss_pred             CCCCCCCcHH
Confidence            6899999998


No 39 
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=26.84  E-value=24  Score=34.26  Aligned_cols=10  Identities=70%  Similarity=1.022  Sum_probs=9.3

Q ss_pred             eeecCCCCCc
Q psy9229         162 FVGRSGRGKS  171 (258)
Q Consensus       162 FvGRSGRGKs  171 (258)
                      +||+||.|||
T Consensus       360 iVG~sGsGKS  369 (567)
T COG1132         360 IVGPSGSGKS  369 (567)
T ss_pred             EECCCCCCHH
Confidence            7999999996


No 40 
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=26.68  E-value=25  Score=26.82  Aligned_cols=14  Identities=43%  Similarity=0.631  Sum_probs=11.3

Q ss_pred             eeeeecCCCCCcce
Q psy9229         160 LRFVGRSGRGKSFT  173 (258)
Q Consensus       160 LRFvGRSGRGKsft  173 (258)
                      +-++|++|.||+=-
T Consensus         3 v~v~G~~~~GKTtl   16 (164)
T smart00175        3 IILIGDSGVGKSSL   16 (164)
T ss_pred             EEEECCCCCCHHHH
Confidence            35899999999753


No 41 
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=26.33  E-value=26  Score=36.61  Aligned_cols=26  Identities=42%  Similarity=0.603  Sum_probs=16.8

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQV  185 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqv  185 (258)
                      .-.|||||+|||==+.+-.--..|+.
T Consensus       502 vaIvG~SGsGKSTL~KLL~gly~p~~  527 (709)
T COG2274         502 VAIVGRSGSGKSTLLKLLLGLYKPQQ  527 (709)
T ss_pred             EEEECCCCCCHHHHHHHHhcCCCCCC
Confidence            35799999999954444444445543


No 42 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=25.71  E-value=25  Score=30.35  Aligned_cols=30  Identities=30%  Similarity=0.407  Sum_probs=19.6

Q ss_pred             CCCccceeccchhhhhcccceeecceeeeecCCCCCcc
Q psy9229         135 NDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF  172 (258)
Q Consensus       135 NdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsf  172 (258)
                      ++..-..||+..   +++     .-.-|+|-||.|||=
T Consensus        21 ~~~~g~~~l~~~---l~~-----k~~vl~G~SGvGKSS   50 (161)
T PF03193_consen   21 KTGEGIEELKEL---LKG-----KTSVLLGQSGVGKSS   50 (161)
T ss_dssp             TTTTTHHHHHHH---HTT-----SEEEEECSTTSSHHH
T ss_pred             CCCcCHHHHHHH---hcC-----CEEEEECCCCCCHHH
Confidence            345555666644   333     345799999999983


No 43 
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=24.94  E-value=27  Score=31.39  Aligned_cols=14  Identities=43%  Similarity=0.705  Sum_probs=11.3

Q ss_pred             eeeeecCCCCCcce
Q psy9229         160 LRFVGRSGRGKSFT  173 (258)
Q Consensus       160 LRFvGRSGRGKsft  173 (258)
                      +=++|++|.|||=.
T Consensus        34 IllvG~tGvGKSSl   47 (249)
T cd01853          34 ILVLGKTGVGKSST   47 (249)
T ss_pred             EEEECCCCCcHHHH
Confidence            35899999999843


No 44 
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=23.82  E-value=30  Score=29.48  Aligned_cols=12  Identities=50%  Similarity=0.686  Sum_probs=10.6

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      +=|.|.||.|||
T Consensus        17 vLi~G~sG~GKS   28 (149)
T cd01918          17 VLITGPSGIGKS   28 (149)
T ss_pred             EEEEcCCCCCHH
Confidence            458999999999


No 45 
>TIGR02695 azurin azurin. Azurin is a blue copper-binding protein in the plastocyanin/azurin family (see Pfam model pfam00127). It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The most closely related copper-binding proteins to this family are auracyanins, as in Chloroflexus aurantiacus, which have similar redox activities.
Probab=23.44  E-value=36  Score=28.97  Aligned_cols=13  Identities=38%  Similarity=1.058  Sum_probs=10.6

Q ss_pred             CceEeecCCCcccc
Q psy9229          94 PQFVCTVLPPHWRS  107 (258)
Q Consensus        94 P~~lcs~LP~HWR~  107 (258)
                      =-|+||. |.||+-
T Consensus       106 Y~f~CSF-PGH~~~  118 (125)
T TIGR02695       106 YTFFCSF-PGHWAM  118 (125)
T ss_pred             ceEEEcC-CCcHHh
Confidence            4589997 999973


No 46 
>PF00988 CPSase_sm_chain:  Carbamoyl-phosphate synthase small chain, CPSase domain;  InterPro: IPR002474 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the N-terminal domain of the small subunit of carbamoyl phosphate synthase. The small subunit has a 3-layer beta/beta/alpha structure, and is thought to be mobile in most proteins that carry it. The C-terminal domain of the small subunit of CPSase has glutamine amidotransferase activity.; GO: 0006807 nitrogen compound metabolic process; PDB: 1CE8_B 1KEE_B 1CS0_D 1T36_D 1M6V_H 1A9X_F 1JDB_I 1BXR_F 1C3O_B 1C30_F ....
Probab=23.34  E-value=17  Score=30.88  Aligned_cols=24  Identities=29%  Similarity=0.601  Sum_probs=12.6

Q ss_pred             cCCCccccCCCCCcce---EEEEeeec
Q psy9229         100 VLPPHWRSNKTLPVAF---KVVALGDV  123 (258)
Q Consensus       100 ~LP~HWR~NKtLP~~F---kVvalg~v  123 (258)
                      ..|+||||.++|..-.   ||.++-.|
T Consensus        85 ~~~s~~~~~~sL~~~L~~~~ipgi~gv  111 (131)
T PF00988_consen   85 DIPSHWRSEMSLDEWLKEHGIPGISGV  111 (131)
T ss_dssp             SS---TT-SB-HHHHHHHTT-EEEESS
T ss_pred             CCCccccccCCHHHHHHHCCCeeeeCC
Confidence            3499999999998755   57776544


No 47 
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=23.07  E-value=24  Score=33.18  Aligned_cols=49  Identities=27%  Similarity=0.340  Sum_probs=31.7

Q ss_pred             eeecceeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCCCCCCCCCCcc
Q psy9229         155 AKFNDLRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGPREPRSKTRKS  209 (258)
Q Consensus       155 A~FnDLRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGPRepRs~r~KS  209 (258)
                      ++=.-|=.||.||+|||=-..+-+--..|.-.      .|++||..-++-+|.+.
T Consensus        31 ~~Ge~lgivGeSGsGKSTL~r~l~Gl~~p~~G------~I~~~G~~~~~~~~~~~   79 (252)
T COG1124          31 ERGETLGIVGESGSGKSTLARLLAGLEKPSSG------SILLDGKPLAPKKRAKA   79 (252)
T ss_pred             cCCCEEEEEcCCCCCHHHHHHHHhcccCCCCc------eEEECCcccCccccchh
Confidence            34445667999999999655555555555433      57899965555555443


No 48 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=22.89  E-value=35  Score=26.66  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=11.2

Q ss_pred             eeeeecCCCCCcc
Q psy9229         160 LRFVGRSGRGKSF  172 (258)
Q Consensus       160 LRFvGRSGRGKsf  172 (258)
                      +-++|.+|.|||=
T Consensus        17 v~i~G~~g~GKSt   29 (173)
T cd04155          17 ILILGLDNAGKTT   29 (173)
T ss_pred             EEEEccCCCCHHH
Confidence            5789999999973


No 49 
>PRK12289 GTPase RsgA; Reviewed
Probab=22.87  E-value=65  Score=30.75  Aligned_cols=36  Identities=25%  Similarity=0.159  Sum_probs=23.8

Q ss_pred             EEEEeccCCCccceeccchhhhhcccceeecceeeeecCCCCCcc
Q psy9229         128 IVTIRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF  172 (258)
Q Consensus       128 ~Vtv~AGNdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsf  172 (258)
                      .+.+.|-+.++. .||++...   +.     -+-|+|.||.|||=
T Consensus       152 v~~iSA~tg~GI-~eL~~~L~---~k-----i~v~iG~SgVGKSS  187 (352)
T PRK12289        152 PLFISVETGIGL-EALLEQLR---NK-----ITVVAGPSGVGKSS  187 (352)
T ss_pred             EEEEEcCCCCCH-HHHhhhhc---cc-----eEEEEeCCCCCHHH
Confidence            455677777663 45555432   22     26899999999973


No 50 
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=22.77  E-value=35  Score=29.45  Aligned_cols=16  Identities=38%  Similarity=0.551  Sum_probs=12.5

Q ss_pred             eeeeecCCCCCcceEE
Q psy9229         160 LRFVGRSGRGKSFTLT  175 (258)
Q Consensus       160 LRFvGRSGRGKsftlt  175 (258)
                      .=|+|++|.|||=.+.
T Consensus        28 ~~ivGpNGaGKSTll~   43 (212)
T cd03274          28 SAIVGPNGSGKSNVID   43 (212)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3589999999986554


No 51 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=22.70  E-value=33  Score=28.70  Aligned_cols=12  Identities=50%  Similarity=0.819  Sum_probs=10.6

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      +-++|++|.|||
T Consensus         4 I~i~G~~g~GKS   15 (197)
T cd04104           4 IAVTGESGAGKS   15 (197)
T ss_pred             EEEECCCCCCHH
Confidence            468999999997


No 52 
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=22.53  E-value=32  Score=32.91  Aligned_cols=28  Identities=29%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             ceeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         159 DLRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       159 DLRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      =.-+||.||.|||=-+.+-.--.+|+-.
T Consensus       363 ~vaIvG~SGsGKSTLl~lL~g~~~p~~G  390 (529)
T TIGR02868       363 RVAILGPSGSGKSTLLMLLTGLLDPLQG  390 (529)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCc
Confidence            3467999999999444333344556544


No 53 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=22.32  E-value=41  Score=31.55  Aligned_cols=38  Identities=34%  Similarity=0.406  Sum_probs=24.5

Q ss_pred             eeecceeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeC
Q psy9229         155 AKFNDLRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDG  198 (258)
Q Consensus       155 A~FnDLRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDG  198 (258)
                      .+=.-+.++|.||+|||=-|..-..-.+|+..      .|+|||
T Consensus        26 ~~Gevv~iiGpSGSGKSTlLRclN~LE~~~~G------~I~i~g   63 (240)
T COG1126          26 EKGEVVVIIGPSGSGKSTLLRCLNGLEEPDSG------SITVDG   63 (240)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHHCCcCCCCc------eEEECC
Confidence            33445678999999999766544444555544      255666


No 54 
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=22.27  E-value=34  Score=28.63  Aligned_cols=27  Identities=26%  Similarity=0.474  Sum_probs=18.7

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      +-++|.||.|||=-+.+-.--.+|.-.
T Consensus        31 ~~i~G~nGsGKSTLl~~l~Gl~~~~~G   57 (220)
T cd03263          31 FGLLGHNGAGKTTTLKMLTGELRPTSG   57 (220)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCCc
Confidence            457899999999666555445566443


No 55 
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=22.26  E-value=35  Score=30.26  Aligned_cols=35  Identities=31%  Similarity=0.371  Sum_probs=21.8

Q ss_pred             EEEeccCCCccceeccchhhhhcccceeecceeeeecCCCCCcc
Q psy9229         129 VTIRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSF  172 (258)
Q Consensus       129 Vtv~AGNdEn~~aeLRN~~a~mknqvA~FnDLRFvGRSGRGKsf  172 (258)
                      +.+.|-+.++ -.||.+..+   +     .-.-|+|.||.|||=
T Consensus       101 ~~~SAktg~g-i~eLf~~l~---~-----~~~~~~G~sgvGKSt  135 (245)
T TIGR00157       101 LMTSSKNQDG-LKELIEALQ---N-----RISVFAGQSGVGKSS  135 (245)
T ss_pred             EEEecCCchh-HHHHHhhhc---C-----CEEEEECCCCCCHHH
Confidence            4566666655 345554332   2     235699999999974


No 56 
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=21.90  E-value=36  Score=28.98  Aligned_cols=15  Identities=40%  Similarity=0.621  Sum_probs=11.9

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      -++|+||.|||=-+.
T Consensus        26 ~i~G~nGsGKStll~   40 (197)
T cd03278          26 AIVGPNGSGKSNIID   40 (197)
T ss_pred             EEECCCCCCHHHHHH
Confidence            589999999985444


No 57 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=21.81  E-value=35  Score=27.43  Aligned_cols=13  Identities=46%  Similarity=0.593  Sum_probs=10.8

Q ss_pred             eeeeecCCCCCcc
Q psy9229         160 LRFVGRSGRGKSF  172 (258)
Q Consensus       160 LRFvGRSGRGKsf  172 (258)
                      +-++|.||.||+=
T Consensus         4 i~l~G~~GsGKsT   16 (180)
T TIGR03263         4 IVISGPSGVGKST   16 (180)
T ss_pred             EEEECCCCCCHHH
Confidence            3579999999985


No 58 
>TIGR00296 uncharacterized protein, PH0010 family. Members of this functionally uncharacterized protein family have been crystallized from Pyrococcus Horikoshii, Methanosarcina Mazei, and Sulfolobus Tokodaii.
Probab=21.52  E-value=50  Score=29.47  Aligned_cols=58  Identities=21%  Similarity=0.398  Sum_probs=38.1

Q ss_pred             CCCeEEEEeccCCCccceeccchh-----------hhhcccc-eeecceeeeecCCC-CCcceEEEEEecCCCee
Q psy9229         124 MDGTIVTIRAGNDENYCAELRNCT-----------AVMKNQV-AKFNDLRFVGRSGR-GKSFTLTITISSSPPQV  185 (258)
Q Consensus       124 ~DGt~Vtv~AGNdEn~~aeLRN~~-----------a~mknqv-A~FnDLRFvGRSGR-GKsftltItv~t~PPqv  185 (258)
                      +-|+-||+...++    .+||.|.           ++.+|-+ |.|+|=||-==+=. =+..++.|+|.+.|=.+
T Consensus        43 ~~g~FVTl~~~~~----~~LRGCIGs~~p~~pL~~~v~~~A~~AA~~DpRF~Pl~~~EL~~l~ieVSvL~~~e~i  113 (200)
T TIGR00296        43 KRGVFITLKKKGN----KHLRGCIGTPEPVMPLIEAIEEAAISAATEDPRFPPVQLEELDDIKVEVSILTPPETI  113 (200)
T ss_pred             cccEEEEEEECCC----cCCCcccccCCCcccHHHHHHHHHHHHHcCCCCCCCCChHHhCCcEEEEEeCCCCEEc
Confidence            6788999975433    2588874           3445554 89999999431111 14677888888877444


No 59 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=21.47  E-value=36  Score=28.27  Aligned_cols=27  Identities=30%  Similarity=0.348  Sum_probs=18.5

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      +=++|.||.|||=-|.+-.--.+|.-.
T Consensus        30 ~~l~G~nGsGKSTLl~~l~G~~~~~~G   56 (211)
T cd03225          30 VLIVGPNGSGKSTLLRLLNGLLGPTSG   56 (211)
T ss_pred             EEEECCCCCCHHHHHHHHhcCCCCCCc
Confidence            457899999999766654444556433


No 60 
>KOG0951|consensus
Probab=21.46  E-value=70  Score=36.86  Aligned_cols=81  Identities=23%  Similarity=0.388  Sum_probs=51.8

Q ss_pred             ecCCCceEeecCCCccccCCC-CCcceEEEEee--ecCCCeEEE-----EeccCCCccceeccchhhhhcccceee----
Q psy9229          90 RTGSPQFVCTVLPPHWRSNKT-LPVAFKVVALG--DVMDGTIVT-----IRAGNDENYCAELRNCTAVMKNQVAKF----  157 (258)
Q Consensus        90 ~T~sP~~lcs~LP~HWR~NKt-LP~~FkVvalg--~v~DGt~Vt-----v~AGNdEn~~aeLRN~~a~mknqvA~F----  157 (258)
                      -+.-|+++-.++-.||-|.-+ ||+.|+=++|-  -.|++-..-     ++|=+..++..-.-+.   .+-|+.-|    
T Consensus      1080 ~~~pP~~fi~lvSd~wl~s~~~~Pvsfr~l~lpek~p~pt~lld~~~~~~~~l~N~~~~~lf~~~---n~iqtqVf~~~y 1156 (1674)
T KOG0951|consen 1080 FEPPPQYFIRLVSDRWLHSETVLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNPSFETLFQDF---NPIQTQVFTSLY 1156 (1674)
T ss_pred             CCCCCceEEEEeeccccCCCcccccchhhccCcccCCCCchhhhccccchhccCCcchhhhcccc---CCceEEEEeeee
Confidence            345788888888888877655 89999988885  345554332     2332222222222222   44455555    


Q ss_pred             --cceeeee-cCCCCCcce
Q psy9229         158 --NDLRFVG-RSGRGKSFT  173 (258)
Q Consensus       158 --nDLRFvG-RSGRGKsft  173 (258)
                        ||+-||| +.|.||.|-
T Consensus      1157 ~~nd~v~vga~~gsgkt~~ 1175 (1674)
T KOG0951|consen 1157 NTNDNVLVGAPNGSGKTAC 1175 (1674)
T ss_pred             cccceEEEecCCCCchhHH
Confidence              7999999 999999873


No 61 
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=21.37  E-value=36  Score=27.96  Aligned_cols=26  Identities=35%  Similarity=0.381  Sum_probs=17.9

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQV  185 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqv  185 (258)
                      +-++|+||.|||=-|.+-.--.+|.-
T Consensus        21 ~~i~G~nGsGKSTLl~~i~G~~~~~~   46 (190)
T TIGR01166        21 LALLGANGAGKSTLLLHLNGLLRPQS   46 (190)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCc
Confidence            45789999999976655444445543


No 62 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=21.32  E-value=36  Score=25.82  Aligned_cols=12  Identities=50%  Similarity=0.664  Sum_probs=10.3

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      +-++|++|.||+
T Consensus         3 i~~vG~~~vGKT   14 (168)
T cd04119           3 VISMGNSGVGKS   14 (168)
T ss_pred             EEEECCCCCCHH
Confidence            458999999996


No 63 
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=21.26  E-value=36  Score=28.38  Aligned_cols=27  Identities=30%  Similarity=0.583  Sum_probs=18.9

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      +-++|.||.|||=-|.+-.--.+|+-.
T Consensus        29 ~~i~G~nGsGKSTLl~~l~Gl~~~~~G   55 (222)
T cd03224          29 VALLGRNGAGKTTLLKTIMGLLPPRSG   55 (222)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCCc
Confidence            457899999999766655445566543


No 64 
>PF14564 Membrane_bind:  Membrane binding; PDB: 1YHP_A 2B1O_A.
Probab=21.03  E-value=93  Score=25.55  Aligned_cols=24  Identities=29%  Similarity=0.484  Sum_probs=18.4

Q ss_pred             ceeee-ecCCCCCcceEEEEEecCC
Q psy9229         159 DLRFV-GRSGRGKSFTLTITISSSP  182 (258)
Q Consensus       159 DLRFv-GRSGRGKsftltItv~t~P  182 (258)
                      |+||+ ..++-++.|.|+|......
T Consensus         3 ~irlv~~~~~~~~~Y~l~i~~~~v~   27 (110)
T PF14564_consen    3 DIRLVDNTGGPAGKYSLTIKPYGVD   27 (110)
T ss_dssp             EEEEEESS-TT-TTEEEEEEETT--
T ss_pred             EEEEEEcCCCCCcEEEEEEEeeecC
Confidence            78999 8999999999999988755


No 65 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=20.96  E-value=47  Score=25.64  Aligned_cols=13  Identities=23%  Similarity=0.416  Sum_probs=10.9

Q ss_pred             eeeeecCCCCCcc
Q psy9229         160 LRFVGRSGRGKSF  172 (258)
Q Consensus       160 LRFvGRSGRGKsf  172 (258)
                      +-++|++|.|||=
T Consensus         2 i~~vG~~~~GKst   14 (167)
T cd04160           2 VLILGLDNAGKTT   14 (167)
T ss_pred             EEEEecCCCCHHH
Confidence            4589999999973


No 66 
>PF12568 DUF3749:  Acetyltransferase (GNAT) domain;  InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length. It contains two completely conserved residues (D and I) that may be functionally important. Proteins having this domain are frequently annotated as acetyltransferases of the GNAT family; however there is little accompanying annotation to confirm this.; PDB: 2K5T_A.
Probab=20.89  E-value=51  Score=28.13  Aligned_cols=10  Identities=60%  Similarity=1.192  Sum_probs=8.9

Q ss_pred             ceeecceeeee
Q psy9229         154 VAKFNDLRFVG  164 (258)
Q Consensus       154 vA~FnDLRFvG  164 (258)
                      +|+||| |.+|
T Consensus        42 aArFNd-RlLg   51 (128)
T PF12568_consen   42 AARFND-RLLG   51 (128)
T ss_dssp             EEEETT-EEEE
T ss_pred             EEEech-heee
Confidence            699999 8887


No 67 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=20.83  E-value=37  Score=25.29  Aligned_cols=11  Identities=45%  Similarity=0.676  Sum_probs=9.1

Q ss_pred             eeecCCCCCcc
Q psy9229         162 FVGRSGRGKSF  172 (258)
Q Consensus       162 FvGRSGRGKsf  172 (258)
                      ..|.||.|||-
T Consensus         4 I~G~~gsGKST   14 (121)
T PF13207_consen    4 ISGPPGSGKST   14 (121)
T ss_dssp             EEESTTSSHHH
T ss_pred             EECCCCCCHHH
Confidence            57999999984


No 68 
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=20.73  E-value=48  Score=27.69  Aligned_cols=31  Identities=35%  Similarity=0.434  Sum_probs=19.2

Q ss_pred             eccchhhhh-cccceeecc--eeeeecCCCCCcc
Q psy9229         142 ELRNCTAVM-KNQVAKFND--LRFVGRSGRGKSF  172 (258)
Q Consensus       142 eLRN~~a~m-knqvA~FnD--LRFvGRSGRGKsf  172 (258)
                      +|.|..... ++..-.|..  .-|+|.+|.|||=
T Consensus         6 ~i~nFr~~~~~~~~~~~~~~~~~i~G~NGsGKS~   39 (220)
T PF02463_consen    6 EIENFRNFKGKNAELSFSPGLNVIVGPNGSGKSN   39 (220)
T ss_dssp             EEESBTTC-SCEEEEETTSSEEEEEESTTSSHHH
T ss_pred             EEcCceEEecCeEEEecCCCCEEEEcCCCCCHHH
Confidence            344544444 444445555  5789999999984


No 69 
>PRK13150 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=20.70  E-value=1.2e+02  Score=26.68  Aligned_cols=35  Identities=34%  Similarity=0.557  Sum_probs=26.8

Q ss_pred             CCCcceE----EEEeeecC-CCeE--EEEeccCCCccc-eecc
Q psy9229         110 TLPVAFK----VVALGDVM-DGTI--VTIRAGNDENYC-AELR  144 (258)
Q Consensus       110 tLP~~Fk----Vvalg~v~-DGt~--Vtv~AGNdEn~~-aeLR  144 (258)
                      -||..||    ||+-|..- ||+.  =+|.|.-||+|. .|+-
T Consensus        98 ilPDlFrEG~gVVveG~~~~~g~F~A~evLAKhdekYmPpEv~  140 (159)
T PRK13150         98 ILPDLFREGQGVVVQGTLEKGNHVLAHEVLAKHDENYTPPEVE  140 (159)
T ss_pred             cCCccccCCCeEEEEEEECCCCEEEEeEEEeCCCCCCCCHHHH
Confidence            4777776    99999875 5665  379999999997 4543


No 70 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=20.62  E-value=27  Score=29.49  Aligned_cols=15  Identities=40%  Similarity=0.625  Sum_probs=12.7

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      =.+|.+|.|||+++.
T Consensus        27 ~I~G~TGsGKS~~~~   41 (229)
T PF01935_consen   27 AIFGTTGSGKSNTVK   41 (229)
T ss_pred             EEECCCCCCHHHHHH
Confidence            357899999999887


No 71 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=20.60  E-value=38  Score=28.26  Aligned_cols=25  Identities=36%  Similarity=0.502  Sum_probs=17.3

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCe
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQ  184 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPq  184 (258)
                      +-.+|+||.|||=-|.+-.--.+|+
T Consensus        28 ~~l~G~nGsGKSTLl~~l~G~~~p~   52 (213)
T cd03235          28 LAIVGPNGAGKSTLLKAILGLLKPT   52 (213)
T ss_pred             EEEECCCCCCHHHHHHHHcCCCCCC
Confidence            3578999999997666544444554


No 72 
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=20.59  E-value=38  Score=28.20  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=17.5

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCe
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQ  184 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPq  184 (258)
                      +-++|.||.|||=-|.+-.--.+|.
T Consensus        28 ~~i~G~nGsGKSTLl~~l~Gl~~~~   52 (211)
T cd03264          28 YGLLGPNGAGKTTLMRILATLTPPS   52 (211)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCC
Confidence            5689999999997665444444554


No 73 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=20.57  E-value=41  Score=25.17  Aligned_cols=12  Identities=42%  Similarity=0.675  Sum_probs=10.5

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      +-++|.+|.|||
T Consensus         4 i~l~G~~~~GKs   15 (157)
T cd04164           4 VVIVGKPNVGKS   15 (157)
T ss_pred             EEEECCCCCCHH
Confidence            458999999998


No 74 
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=20.50  E-value=38  Score=33.16  Aligned_cols=15  Identities=47%  Similarity=0.631  Sum_probs=11.9

Q ss_pred             eeeecCCCCCcceEE
Q psy9229         161 RFVGRSGRGKSFTLT  175 (258)
Q Consensus       161 RFvGRSGRGKsftlt  175 (258)
                      =.+|+||.|||==|.
T Consensus        36 GIIG~SGAGKSTLiR   50 (339)
T COG1135          36 GIIGYSGAGKSTLLR   50 (339)
T ss_pred             EEEcCCCCcHHHHHH
Confidence            469999999995544


No 75 
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=20.49  E-value=39  Score=28.74  Aligned_cols=27  Identities=33%  Similarity=0.508  Sum_probs=18.8

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      +-++|.||.|||=-|.+-.--.+|.-.
T Consensus        29 ~~l~G~nGsGKSTLl~~l~G~~~p~~G   55 (235)
T cd03261          29 LAIIGPSGSGKSTLLRLIVGLLRPDSG   55 (235)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCce
Confidence            457899999999655555455566544


No 76 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=20.41  E-value=39  Score=28.03  Aligned_cols=34  Identities=35%  Similarity=0.521  Sum_probs=21.7

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeeeeeeeeEEEeeeCC
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVTTYSKAIKVTVDGP  199 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvAt~~~AIKVtvDGP  199 (258)
                      +-.+|.||.|||=-|.+-.--.+|+-..      |++||-
T Consensus        30 ~~i~G~nGsGKSTLl~~l~G~~~~~~G~------i~~~g~   63 (214)
T cd03292          30 VFLVGPSGAGKSTLLKLIYKEELPTSGT------IRVNGQ   63 (214)
T ss_pred             EEEECCCCCCHHHHHHHHhcCCCCCceE------EEECCE
Confidence            3568999999996555444445665442      455663


No 77 
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=20.29  E-value=39  Score=31.36  Aligned_cols=17  Identities=47%  Similarity=0.571  Sum_probs=13.3

Q ss_pred             eeeeecCCCCCcceEEE
Q psy9229         160 LRFVGRSGRGKSFTLTI  176 (258)
Q Consensus       160 LRFvGRSGRGKsftltI  176 (258)
                      +-++|++|.|||=-|.+
T Consensus       111 v~IvG~~GsGKSTLl~~  127 (329)
T PRK14257        111 TAFIGPSGCGKSTFLRN  127 (329)
T ss_pred             EEEECCCCCCHHHHHHH
Confidence            46799999999965553


No 78 
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=20.28  E-value=46  Score=25.09  Aligned_cols=13  Identities=23%  Similarity=0.424  Sum_probs=11.1

Q ss_pred             eeeeecCCCCCcc
Q psy9229         160 LRFVGRSGRGKSF  172 (258)
Q Consensus       160 LRFvGRSGRGKsf  172 (258)
                      +-++|.+|.|||=
T Consensus         3 i~i~G~~~~GKSt   15 (162)
T cd04123           3 VVLLGEGRVGKTS   15 (162)
T ss_pred             EEEECCCCCCHHH
Confidence            4689999999985


No 79 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=20.20  E-value=46  Score=25.24  Aligned_cols=12  Identities=50%  Similarity=0.720  Sum_probs=10.6

Q ss_pred             eeeeecCCCCCc
Q psy9229         160 LRFVGRSGRGKS  171 (258)
Q Consensus       160 LRFvGRSGRGKs  171 (258)
                      +-++|.+|.||+
T Consensus         3 i~~~G~~~~GKT   14 (164)
T cd04139           3 VIVVGAGGVGKS   14 (164)
T ss_pred             EEEECCCCCCHH
Confidence            468999999998


No 80 
>PF09547 Spore_IV_A:  Stage IV sporulation protein A (spore_IV_A);  InterPro: IPR014201 This entry is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. 
Probab=20.20  E-value=67  Score=32.93  Aligned_cols=64  Identities=27%  Similarity=0.332  Sum_probs=47.6

Q ss_pred             HhhhhcCCcccccCCccccccCCcccc--ccc-cccccchhhhhhhhhhhhhhcCCCceeecCCCceE
Q psy9229          33 LAERTLGDFLSEHPGELVRTEGNTGNL--LND-TYSKMTSDILAERTLGDFLSEHPGELVRTGSPQFV   97 (258)
Q Consensus        33 laert~g~~~sehpGelvrtg~~~~~~--~~~-~~~~~~~~~~~e~~~~~~l~~~~~elv~T~sP~~l   97 (258)
                      +|+||.||..=-++| -||||-+|-.-  ++- -...|....-.||...|+=|.-.|..+-|.-|-|+
T Consensus        10 Ia~RT~GdIYiGVVG-PVRTGKSTFIKRFMel~VlPnI~d~~~reRa~DELPQS~aGktImTTEPKFi   76 (492)
T PF09547_consen   10 IAERTGGDIYIGVVG-PVRTGKSTFIKRFMELLVLPNIEDEYERERARDELPQSGAGKTIMTTEPKFI   76 (492)
T ss_pred             HHHhcCCceEEEeec-CcccCchhHHHHHHHHhcCCCCCCHHHHHHhhhcCCcCCCCCceeccCCccc
Confidence            689999998777777 58999998311  110 11234445567899999999999999999999875


No 81 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=20.11  E-value=40  Score=28.07  Aligned_cols=27  Identities=30%  Similarity=0.416  Sum_probs=18.5

Q ss_pred             eeeeecCCCCCcceEEEEEecCCCeee
Q psy9229         160 LRFVGRSGRGKSFTLTITISSSPPQVT  186 (258)
Q Consensus       160 LRFvGRSGRGKsftltItv~t~PPqvA  186 (258)
                      +=++|.||.|||=-+.+-.---+|+-.
T Consensus        31 ~~l~G~nGsGKSTLl~~i~Gl~~~~~G   57 (214)
T TIGR02673        31 LFLTGPSGAGKTTLLKLLYGALTPSRG   57 (214)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCCCCc
Confidence            347899999999766654444456543


Done!