RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy9232
         (119 letters)



>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) like
          proteins is composed of two C4-type zinc fingers.
          DNA-binding domain of the photoreceptor cell-specific
          nuclear receptor (PNR) like proteins is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. PNR interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation.  PNR is a member of nuclear
          receptor superfamily of the ligand-activated
          transcription factors. PNR is expressed only in the
          outer layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. It
          most likely binds to DNA as a homodimer. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, PNR  has  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 78

 Score = 71.7 bits (176), Expect = 7e-18
 Identities = 32/39 (82%), Positives = 33/39 (84%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          RNL YVCKE G C+VDV RRNQCQACRF KCLQV MNRD
Sbjct: 31 RNLAYVCKENGSCVVDVARRNQCQACRFKKCLQVNMNRD 69


>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of nuclear receptors is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. It
          interacts with a specific DNA site upstream of the
          target gene and modulates the rate of transcriptional
          initiation. Nuclear receptors form a superfamily of
          ligand-activated transcription regulators, which
          regulate various physiological functions, from
          development, reproduction, to homeostasis and
          metabolism in animals (metazoans). The family contains
          not only receptors for known ligands but also orphan
          receptors for which ligands do not exist or have not
          been identified. NRs share a common structural
          organization with a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Most nuclear receptors bind as homodimers or
          heterodimers to their target sites, which consist of
          two hexameric half-sites. Specificity is determined by
          the half-site sequence, the relative orientation of the
          half-sites and the number of spacer nucleotides between
          the half-sites. However, a growing number of nuclear
          receptors have been reported to bind to DNA as
          monomers.
          Length = 72

 Score = 59.9 bits (146), Expect = 2e-13
 Identities = 22/42 (52%), Positives = 28/42 (66%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          RNLEY C   G+C++D   RN+CQACR  KCL V M ++  R
Sbjct: 31 RNLEYTCPAGGNCVIDKRNRNRCQACRLKKCLAVGMRKEAVR 72


>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR)
          nuclear receptor-like family.  The DNA-binding domain
          of the photoreceptor cell-specific nuclear receptor
          (PNR) nuclear receptor-like family is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which coordinates a single zinc
          atom. PNR interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. This family includes
          nuclear receptor Tailless (TLX), photoreceptor
          cell-specific nuclear receptor (PNR) and related
          receptors. TLX is an orphan receptor that plays a key
          role in neural development by regulating cell cycle
          progression and exit of neural stem cells in the
          developing brain. PNR is expressed only in the outer
          layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, PNR-like
          receptors have a central well-conserved DNA-binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 57.2 bits (138), Expect = 2e-12
 Identities = 26/43 (60%), Positives = 30/43 (69%), Gaps = 1/43 (2%)

Query: 20 RNLEYVCK-ERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          RNL Y CK   G C+VD  RRNQCQACR  KCL+V MN+D  +
Sbjct: 31 RNLLYTCKAGNGSCVVDKARRNQCQACRLKKCLEVSMNKDAVQ 73


>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of Tailless (TLX) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. TLX
          interacts with specific DNA sites upstream of the
          target gene and modulates the rate of transcriptional
          initiation.  TLX is an orphan receptor that is
          expressed by neural stem/progenitor cells in the adult
          brain of the subventricular zone (SVZ) and the dentate
          gyrus (DG). It plays a key role in neural development
          by promoting cell cycle progression and preventing
          apoptosis in the developing brain. Like other members
          of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, TLX has a
          central well conserved DNA-binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 92

 Score = 56.0 bits (135), Expect = 1e-11
 Identities = 24/41 (58%), Positives = 29/41 (70%), Gaps = 2/41 (4%)

Query: 20 RNLEYVCKER--GHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          RN +YVCK +  G C VD T RNQC+ACR  KC +V MN+D
Sbjct: 39 RNRQYVCKSKGQGGCPVDKTHRNQCRACRLKKCFEVGMNKD 79


>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains).  In nearly
          all cases, this is the DNA binding domain of a nuclear
          hormone receptor. The alignment contains two Zinc
          finger domains that are too dissimilar to be aligned
          with each other.
          Length = 70

 Score = 54.1 bits (131), Expect = 3e-11
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNR 57
          +N+ Y C     C++D   RN+CQ CR  KCL+V M++
Sbjct: 33 KNIVYTCPFNKDCVIDKRNRNRCQYCRLKKCLEVGMSK 70


>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone
          receptors (TRs) is composed of two C4-type zinc
          fingers.  DNA-binding domain of thyroid hormone
          receptors (TRs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. TR
          interacts with the thyroid response element, which is a
          DNA site with direct repeats of the consensus sequence
          5'-AGGTCA-3' separated by one to five base pairs,
          upstream of target genes and modulates the rate of
          transcriptional initiation. Thyroid hormone receptor
          (TR) mediates the actions of thyroid hormones, which
          play critical roles in growth, development, and
          homeostasis in mammals. They regulate overall metabolic
          rate, cholesterol and triglyceride levels, and heart
          rate, and affect mood. TRs are expressed from two
          separate genes (alpha and beta) in human and each gene
          generates two isoforms of the receptor through
          differential promoter usage or splicing. TRalpha
          functions in the heart to regulate heart rate and
          rhythm and TRbeta is active in the liver and other
          tissues. The unliganded TRs function as transcription
          repressors, by binding to thyroid hormone response
          elements (TRE) predominantly as homodimers, or as
          heterodimers with retinoid X-receptors (RXR), and being
          associated with a complex of proteins containing
          corepressor proteins. Ligand binding promotes
          corepressor dissociation and binding of a coactivator
          to activate transcription. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, TR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 85

 Score = 53.2 bits (128), Expect = 1e-10
 Identities = 20/42 (47%), Positives = 25/42 (59%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          + L Y CK  G C +D   RNQCQ CRF KC+ V M +D+  
Sbjct: 32 KKLSYSCKGEGKCEIDKVTRNQCQECRFKKCIAVGMAKDLVL 73


>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors. 
          Length = 70

 Score = 47.1 bits (113), Expect = 2e-08
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 9  CGVVSCQ--FVF-----VRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
           GV SC+    F         +Y C  + +C ++   R +C+ACR  KCL V M+ +
Sbjct: 14 FGVCSCRACKAFFRRTVNLRYKYRCDRKNNCSINKRYRCRCRACRLKKCLGVGMDPE 70


>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear
          factor 4 (HNF4) is composed of two C4-type zinc
          fingers.  DNA-binding domain of hepatocyte nuclear
          factor 4 (HNF4) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. HNF4
          interacts with a DNA site, composed of two direct
          repeats of AGTTCA with 1 bp spacer, which is upstream
          of target genes and modulates the rate of
          transcriptional initiation. HNF4 is a member of the
          nuclear receptor superfamily. HNF4 plays a key role in
          establishing and maintenance of hepatocyte
          differentiation in the liver. It is also expressed in
          gut, kidney, and pancreatic beta cells. HNF4 was
          originally classified as an orphan receptor, but later
          it is found that HNF4 binds with very high affinity to
          a variety of fatty acids. However, unlike other nuclear
          receptors, the ligands do not act as a molecular switch
          for HNF4. They seem to constantly bind to the receptor,
          which is constitutively active as a transcription
          activator. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, HNF4  has a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 76

 Score = 46.8 bits (112), Expect = 3e-08
 Identities = 18/40 (45%), Positives = 27/40 (67%)

Query: 19 VRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
           +N  Y C+  G+C+VD  +RN C+ CRF KCL+V M+ +
Sbjct: 30 RKNRTYTCRFGGNCVVDKDKRNACRYCRFKKCLEVGMDPE 69


>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear
          receptor, nerve growth factor-induced-B.  DNA-binding
          domain (DBD) of the orphan nuclear receptor, nerve
          growth factor-induced-B (NGFI-B) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. NGFI-B interacts with specific DNA sites upstream
          of the target gene and modulates the rate of
          transcriptional initiation. NGFI-B is a member of the
          nuclear-steroid receptor superfamily. NGFI-B is
          classified as an orphan receptor because no ligand has
          yet been identified. NGFI-B is an early immediate gene
          product of embryo development that is rapidly produced
          in response to a variety of cellular signals including
          nerve growth factor. It is involved in T-cell-mediated
          apoptosis, as well as neuronal differentiation and
          function. NGFI-B regulates transcription by binding to
          a specific DNA target upstream of its target genes and
          regulating the rate of transcriptional initiation.
          NGFI-B binds to the NGFI-B response element (NBRE)
          5'-(A/T)AAAGGTCA as a monomer. Like other members of
          the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, NGFI-B has  a
          central well-conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 75

 Score = 46.7 bits (111), Expect = 3e-08
 Identities = 23/42 (54%), Positives = 29/42 (69%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          +N +YVC    +C VD  RRN+CQ CRF KCLQV M ++V R
Sbjct: 33 KNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLQVGMVKEVVR 74


>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin
          upstream promoter transcription factors (COUP-TFs) is
          composed of two C4-type zinc fingers.  DNA-binding
          domain of chicken ovalbumin upstream promoter
          transcription factors (COUP-TFs) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. COUP-TFs are orphan members of the
          steroid/thyroid hormone receptor superfamily. They are
          expressed in many tissues and are involved in the
          regulation of several important biological processes,
          such as neurogenesis, organogenesis, cell fate
          determination, and metabolic homeostasis. COUP-TFs
          homodimerize or heterodimerize with retinoid X receptor
          (RXR) and a few other nuclear receptors and bind to a
          variety of response elements that are composed of
          imperfect AGGTCA direct or inverted repeats with
          various spacings. COUP-TFs are generally considered to
          be repressors of transcription for other nuclear
          hormone receptors such as retinoic acid receptor (RAR),
          thyroid hormone receptor (TR), vitamin D receptor
          (VDR), peroxisome proliferator activated receptor
          (PPAR), and hepatocyte nuclear factor 4 (HNF4). Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, COUP-TFs
          have a central well conserved DNA binding domain (DBD),
          a variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 46.8 bits (111), Expect = 4e-08
 Identities = 20/42 (47%), Positives = 26/42 (61%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          RNL Y C+   +C +D   RNQCQ CR  KCL+V M R+  +
Sbjct: 31 RNLTYTCRGNRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ 72


>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor
          cell-specific nuclear receptor (PNR) is composed of two
          C4-type zinc fingers.  DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PNR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  PNR
          is a member of the nuclear receptor superfamily of the
          ligand-activated transcription factors. PNR is
          expressed only in the outer layer of retinal
          photoreceptor cells. It may be involved in the
          signaling pathway regulating photoreceptor
          differentiation and/or maintenance. It most likely
          binds to DNA as a homodimer. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, PNR  has  a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 92

 Score = 46.9 bits (111), Expect = 4e-08
 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 20 RNLEYVCKE-RGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          R L Y C+   G C VD   RNQCQACR  KCLQ  MN+D
Sbjct: 39 RKLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKD 78


>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila
          ecdysone-induced protein 78 (E78) like is composed of
          two C4-type zinc fingers.  DNA-binding domain of
          proteins similar to Drosophila ecdysone-induced protein
          78 (E78) is composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          coordinates a single zinc atom. E78 interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.
          Drosophila ecdysone-induced protein 78 (E78) is a
          transcription factor belonging to the nuclear receptor
          superfamily.  E78 is a product of the
          ecdysone-inducible gene found in an early late puff
          locus at position 78C during the onset of Drosophila
          metamorphosis. An E78 orthologue from the Platyhelminth
          Schistosoma mansoni (SmE78) has also been identified.
          It is the first E78 orthologue known outside of the
          molting animals--the Ecdysozoa. The SmE78 may be
          involved in transduction of an ecdysone signal in S.
          mansoni, consistent with its function in Drosophila.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          E78-like receptors have a central well conserved
          DNA-binding domain (DBD), a variable N-terminal domain,
          a non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 81

 Score = 46.8 bits (111), Expect = 4e-08
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRLG 63
          + +EY C   G C +    RN+CQ CRF KCL   M++D  R G
Sbjct: 31 KQIEYRCLRDGKCEIIRLNRNRCQYCRFKKCLAAGMSKDSVRYG 74


>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like
          nuclear receptor family like is composed of two C4-type
          zinc fingers.  The DNA-binding domain of Lrh-1 like
          nuclear receptor family like is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom.
          This domain interacts with specific DNA sites upstream
          of the target gene and modulates the rate of
          transcriptional initiation. This nuclear receptor
          family includes at least three subgroups of receptors
          that function in embryo development and
          differentiation, and other processes. FTZ-F1 interacts
          with the cis-acting DNA motif of ftz gene, which is
          required at several stages of development.
          Particularly, FTZ-F1 regulated genes are strongly
          linked to steroid biosynthesis and sex-determination;
          LRH-1 is a regulator of bile-acid homeostasis,
          steroidogenesis, reverse cholesterol transport and the
          initial stages of embryonic development; SF-1 is an
          essential regulator of endocrine development and
          function and is considered a master regulator of
          reproduction; SF-1 functions cooperatively with other
          transcription factors to modulate gene expression.
          Phospholipids have been identified as potential ligand
          for LRH-1 and steroidogenic factor-1 (SF-1). However,
          the ligand for FTZ-F1 has not yet been identified. Most
          nuclear receptors function as homodimer or
          heterodimers. However, LRH-1 and SF-1 bind to DNA as
          monomers. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, receptors in this family  have  a central well
          conserved DNA-binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 93

 Score = 46.7 bits (111), Expect = 4e-08
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 13 SCQFVFVR----NLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          SC+  F R       Y C E  +C +D T+R +C  CRF KCL V M  +  R
Sbjct: 20 SCKGFFKRTVQNKKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVR 72


>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid
          receptor (GR) is composed of two C4-type zinc fingers. 
          DNA-binding domains of glucocorticoid receptor (GR) and
          progesterone receptor (PR) are composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinate  a single zinc atom. The
          DBD from both receptors interact with the same hormone
          response element (HRE), which is an imperfect
          palindrome GGTACAnnnTGTTCT, upstream of target genes
          and modulates the rate of transcriptional initiation.
          GR is a transcriptional regulator that mediates the
          biological effects of glucocorticoids and PR regulates
          genes controlled by progesterone. GR is expressed in
          almost every cell in the body and regulates genes
          controlling a wide variety of processes including the
          development, metabolism, and immune response of the
          organism. PR functions in a variety of biological
          processes including development of the mammary gland,
          regulating cell cycle progression, protein processing,
          and metabolism. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, GR and PR have  a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 78

 Score = 45.2 bits (107), Expect = 1e-07
 Identities = 25/52 (48%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 9  CGVVSCQFVFVRNLE----YVCKERGHCIVDVTRRNQCQACRFSKCLQVKMN 56
          CG  SC+  F R +E    Y+C  R  CI+D  RR  C ACR  KCLQ  MN
Sbjct: 22 CG--SCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCLQAGMN 71


>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related
          receptors (ERR) is composed of two C4-type zinc
          fingers.  DNA-binding domain of estrogen related
          receptors (ERRs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. ERR
          interacts with the palindromic inverted repeat,
          5'GGTCAnnnTGACC-3', upstream of the target gene and
          modulates the rate of transcriptional initiation. The
          estrogen receptor-related receptors (ERRs) are
          transcriptional regulators, which are closely related
          to the estrogen receptor (ER) family.  Although ERRs
          lack the ability to bind to estrogen and are so-called
          orphan receptors, they share target genes,
          co-regulators and promoters with the estrogen receptor
          (ER) family. By targeting the same set of genes, ERRs
          seem to interfere with the classic ER-mediated estrogen
          response in various ways. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, ERR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 97

 Score = 45.2 bits (107), Expect = 2e-07
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 13 SCQFVFVR----NLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRL 62
          +C+  F R    N+EY C     C +   RR  CQACRF KCL+V M ++  RL
Sbjct: 26 ACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL 79


>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related
          orphan receptors (RORs) is composed of two C4-type zinc
          fingers.  DNA-binding domain of Retinoid-related orphan
          receptors (RORs) is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. ROR
          interacts with specific DNA sites upstream of the
          target gene and modulates the rate of transcriptional
          initiation.  RORS are key regulators of many
          physiological processes during embryonic development.
          RORs bind as monomers to specific ROR response elements
          (ROREs) consisting of the consensus core motif AGGTCA
          preceded by a 5-bp A/T-rich sequence. There are three
          subtypes of retinoid-related orphan receptors (RORs),
          alpha, beta, and gamma, which differ only in N-terminal
          sequence and are distributed in distinct tissues.
          RORalpha plays a key role in the development of the
          cerebellum particularly in the regulation of the
          maturation and survival of Purkinje cells. RORbeta
          expression is largely restricted to several regions of
          the brain, the retina, and pineal gland. RORgamma is
          essential for lymph node organogenesis. Recently, it
          has been suggested that cholesterol or a cholesterol
          derivative are the natural ligands of RORalpha. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors,
          retinoid-related orphan receptors have a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 95

 Score = 44.8 bits (106), Expect = 2e-07
 Identities = 19/43 (44%), Positives = 28/43 (65%)

Query: 21 NLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRLG 63
          N+ Y C  + +C++D T RN+CQ CR  KCL + M+RD  + G
Sbjct: 39 NVSYSCPRQKNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFG 81


>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor
          (RAR) is composed of two C4-type zinc fingers.
          DNA-binding domain of retinoic acid receptor (RAR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. RAR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. RARs
          mediate the biological effect of retinoids, including
          both natural dietary vitamin A (retinol) metabolites
          and active synthetic analogs. Retinoids play key roles
          in a wide variety of essential biological processes,
          such as vertebrate embryonic morphogenesis and
          organogenesis, differentiation and apoptosis, and
          homeostasis. RAR function as a heterodimer with
          retinoic X receptor by binding to specific RAR response
          elements (RAREs), which are composed of two direct
          repeats of the consensus sequence 5'-AGGTCA-3'
          separated by one to five base pair and found in the
          promoter regions of retinoid target genes. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, retinoic acid
          receptors have a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 85

 Score = 44.9 bits (106), Expect = 2e-07
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          +N+ Y C    +CI++   RN+CQ CR  KC +V M+++  R
Sbjct: 37 KNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVR 78


>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor
          (RXR) is composed of two C4-type zinc fingers.
          DNA-binding domain of retinoid X receptor (RXR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. RXR functions as a DNA
          binding partner by forming heterodimers with other
          nuclear receptors including CAR, FXR, LXR, PPAR, PXR,
          RAR, TR, and VDR. All RXR heterodimers preferentially
          bind response elements composed of direct repeats of
          two AGGTCA sites with a 1-5 bp spacer.  RXRs can play
          different roles in these heterodimers. RXR  acts either
          as a structural component of the heterodimer complex,
          required for DNA binding but not acting as a receptor,
          or as both a structural and a functional component of
          the heterodimer, allowing 9-cis RA to signal through
          the corresponding heterodimer. In addition, RXR can
          also form homodimers, functioning as a receptor for
          9-cis RA, independently of other nuclear receptors.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          RXR has a central well conserved DNA binding domain
          (DBD), a variable N-terminal domain, a flexible hinge
          and a C-terminal ligand binding domain (LBD).
          Length = 77

 Score = 44.1 bits (104), Expect = 3e-07
 Identities = 16/39 (41%), Positives = 27/39 (69%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          ++L Y C++   C++D  +RN+CQ CR+ KCL + M R+
Sbjct: 33 KDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE 71


>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER)
          is composed of two C4-type zinc fingers.  DNA-binding
          domain of estrogen receptors (ER) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which coordinates a single zinc
          atom. ER interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. Estrogen receptor is a
          transcription regulator that mediates the biological
          effects of hormone estrogen. The binding of estrogen to
          the receptor triggers the dimerization and the binding
          of the receptor dimer to estrogen response element,
          which is a palindromic inverted repeat:
          5'GGTCAnnnTGACC-3', of target genes. Through ER,
          estrogen regulates development, reproduction and
          homeostasis. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, ER  has  a central well-conserved DNA binding
          domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 82

 Score = 43.7 bits (103), Expect = 5e-07
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 14 CQFVFVRNLE----YVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          C+  F R+++    Y+C     C +D  RR  CQACR  KC +V M +   R
Sbjct: 26 CKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIR 77


>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell
          nuclear factor (GCNF) F1 is composed of two C4-type
          zinc fingers.  DNA-binding domain of Germ cell nuclear
          factor (GCNF) F1 is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which coordinates a single zinc atom. This
          domain interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. GCNF is a transcription
          factor expressed in post-meiotic stages of developing
          male germ cells. In vitro, GCNF has the ability to bind
          to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as
          well as to an extended half-site sequence
          5'-TCA.AGGTCA-3'. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, GCNF has  a central well
          conserved DNA-binding domain (DBD), a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain (LBD).
          Length = 90

 Score = 44.1 bits (104), Expect = 6e-07
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 24 YVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
          Y C    +C++   +RN+CQ CR  KCLQ+ MNR   R
Sbjct: 43 YRCSRDKNCVMSRKQRNRCQYCRLLKCLQMGMNRKAIR 80


>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) is composed of
          two C4-type zinc fingers.  DNA-binding domain of
          peroxisome proliferator-activated receptors (PPAR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PPAR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.
          Peroxisome proliferator-activated receptors (PPARs) are
          members of the nuclear receptor superfamily of
          ligand-activated transcription factors. PPARs play
          important roles in regulating cellular differentiation,
          development and lipid metabolism. Activated PPAR forms
          a heterodimer with the retinoid X receptor (RXR) that
          binds to the hormone response elements, which are
          composed of two direct repeats of the consensus
          sequence 5'-AGGTCA-3' separated by one to five base
          pair located upstream of the peroxisome proliferator
          responsive genes, and interacts with co-activators.
          Several essential fatty acids, oxidized lipids and
          prostaglandin J derivatives can bind and activate PPAR.
           Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          PPAR has a central well conserved DNA binding domain
          (DBD), a variable N-terminal regulatory domain, a
          flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 84

 Score = 42.5 bits (100), Expect = 2e-06
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 32 CIVDVTRRNQCQACRFSKCLQVKMNRDVTRLG 63
          C +    RN+CQ CRF KCL V M+ +  R G
Sbjct: 43 CKIHKKSRNKCQYCRFQKCLNVGMSHNAIRFG 74


>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like
          nuclear receptors is composed of two C4-type zinc
          fingers.  The DNA binding domain of GR_like nuclear
          receptors is composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. It interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. This
          family of NRs includes four types of nuclear hormone
          receptors: glucocorticoid receptor (GR),
          mineralocorticoid receptor (MR), progesterone receptor
          (PR), and androgen receptor (AR). The receptors bind to
          common DNA elements containing a partial palindrome of
          the core sequence 5'-TGTTCT-3' with a 3bp spacer. These
          four receptors regulate some of the most fundamental
          physiological functions such as the stress response,
          metabolism, electrolyte homeostasis, immune function,
          growth, development, and reproduction. The NRs in this
          family have high sequence homology and share similar
          functional mechanisms.  The dominant mechanism of
          function is by direct DNA binding and transcriptional
          regulation of target genes . The GR, MR, PR, and AR
          exhibit same modular structure. They have a central
          highly conserved DNA binding domain (DBD), a
          non-conserved N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 42.2 bits (99), Expect = 2e-06
 Identities = 23/52 (44%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 9  CGVVSCQFVFVRNLE----YVCKERGHCIVDVTRRNQCQACRFSKCLQVKMN 56
          CG  SC+  F R  E    Y+C  R  CI+D  RR  C ACR  KC Q  M 
Sbjct: 18 CG--SCKVFFKRAAEGQHNYLCAGRNDCIIDKIRRKNCPACRLRKCYQAGMT 67


>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the
          photoreceptor cell-specific nuclear receptor (PNR) like
          is composed of two C4-type zinc fingers.  The
          DNA-binding domain of the photoreceptor cell-specific
          nuclear receptor (PNR) nuclear receptor-like family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. PNR interacts with specific DNA
          sites upstream of the target gene and modulates the
          rate of transcriptional initiation. This family
          includes nuclear receptor Tailless (TLX), photoreceptor
          cell-specific nuclear receptor (PNR) and related
          receptors. TLX is an orphan receptor that plays a key
          role in neural development by regulating cell cycle
          progression and exit of neural stem cells in the
          developing brain. PNR is expressed only in the outer
          layer of retinal photoreceptor cells. It may be
          involved in the signaling pathway regulating
          photoreceptor differentiation and/or maintenance. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, PNR-like
          receptors have a central well-conserved DNA-binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 82

 Score = 42.1 bits (99), Expect = 2e-06
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 20 RNLEYVC-KERGHCIVDVTRRNQCQACRFSKCLQVKMNR 57
          + + Y C    G+C+VD  RRN C  CR  KC  V MNR
Sbjct: 31 KGIIYTCIAGNGNCVVDKARRNWCPFCRLQKCFAVGMNR 69


>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor
          (ER) and estrogen related receptors (ERR) is composed
          of two C4-type zinc fingers.  DNA-binding domains of
          estrogen receptor (ER) and estrogen related receptors
          (ERR) are composed of two C4-type zinc fingers. Each
          zinc finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. ER and ERR interact
          with the palindromic inverted repeat,
          5'GGTCAnnnTGACC-3', upstream of the target gene and
          modulate the rate of transcriptional initiation. ERR
          and ER are closely related and share sequence
          similarity, target genes, co-regulators and promoters.
          While ER is activated by endogenous estrogen, ERR lacks
          the ability to bind to estrogen. Estrogen receptor
          mediates the biological effects of hormone estrogen by
          the binding of the receptor dimer to estrogen response
          element of target genes.  However, ERRs seem to
          interfere with the classic ER-mediated estrogen
          responsive signaling by targeting the same set of
          genes. ERRs and ERs exhibit the common modular
          structure with other nuclear receptors. They have a
          central highly conserved DNA binding domain (DBD), a
          non-conserved N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 75

 Score = 40.5 bits (95), Expect = 9e-06
 Identities = 21/42 (50%), Positives = 24/42 (57%)

Query: 21 NLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRL 62
          NL Y C     C VD  RR  CQACR  KCL+V M ++  RL
Sbjct: 32 NLGYSCPSTSECEVDKKRRKSCQACRLQKCLKVGMLKEGVRL 73


>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4
          (human testicular receptor 2 and 4) is composed of two
          C4-type zinc fingers.  DNA-binding domain of the TR2
          and TR4 (human testicular receptor 2 and 4) is composed
          of two C4-type zinc fingers. Each zinc finger contains
          a group of four Cys residues which coordinates a single
          zinc atom. TR2 and TR4 interact with specific DNA sites
          upstream of the target gene and modulate the rate of
          transcriptional initiation. TR4 and TR2 are orphan
          nuclear receptors; the physiological ligand is as yet
          unidentified. TR2 is abundantly expressed in the
          androgen-sensitive prostate. TR4 transcripts are
          expressed in many tissues, including central nervous
          system, adrenal gland, spleen, thyroid gland, and
          prostate. It has been shown that human TR2 binds to a
          wide spectrum of natural hormone response elements
          (HREs) with distinct affinities suggesting that TR2 may
          cross-talk with other gene expression regulation
          systems. The genes responding to TR2 or TR4 include
          genes that are regulated by retinoic acid receptor,
          vitamin D receptor, and peroxisome
          proliferator-activated receptor. TR4/2 binds to HREs as
          dimers. Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          TR2-like receptors  have  a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 87

 Score = 40.5 bits (95), Expect = 9e-06
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          +NL Y C+    C+++   RN+CQ CR  KCL + M  D
Sbjct: 36 KNLGYSCRGSKDCVINKHHRNRCQYCRLQKCLAMGMKSD 74


>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) like nuclear
          receptor family.  The DNA-binding domain of peroxisome
          proliferator-activated receptors (PPAR) like nuclear
          receptor family is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. These
          domains interact with specific DNA sites upstream of
          the target gene and modulate the rate of
          transcriptional initiation. This family includes three
          known types of nuclear receptors: peroxisome
          proliferator-activated receptors (PPAR), REV-ERB
          receptors and Drosophila ecdysone-induced protein 78
          (E78). Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          PPAR-like receptors have a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          non-conserved hinge and a C-terminal ligand binding
          domain (LBD).
          Length = 73

 Score = 40.2 bits (94), Expect = 1e-05
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 20 RNLEYV-CKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTR 61
           NL Y  C   G C++    RN+CQ CRF KCL V M+R+  R
Sbjct: 31 HNLTYRRCLNGGKCVIQRKNRNRCQYCRFKKCLSVGMSRNAVR 73


>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the
          2DBD nuclear receptors is composed of two C4-type zinc
          fingers.  The first DNA-binding domain (DBD) of the
          2DBD nuclear receptors(NRs) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. NRs
          interact with specific DNA sites upstream of the target
          gene and modulate the rate of transcriptional
          initiation. Theses proteins contain two DBDs in tandem,
          probably resulted from an ancient recombination event.
          The 2DBD-NRs are found only in flatworm species,
          mollusks and arthropods.  Their biological function is
          unknown.
          Length = 86

 Score = 39.8 bits (93), Expect = 2e-05
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 23 EYVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
             C   G CI+D   R +CQACR+ KCL V M
Sbjct: 38 ISECPNGGKCIIDKKNRTKCQACRYRKCLNVGM 70


>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB
          receptor-like is composed of two C4-type zinc fingers. 
          DNA-binding domain of REV-ERB receptor- like is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. This domain interacts with specific
          DNA sites upstream of the target gene and modulates the
          rate of transcriptional initiation. REV-ERB receptors
          are transcriptional regulators belonging to the nuclear
          receptor superfamily. They regulate a number of
          physiological functions including the circadian rhythm,
          lipid metabolism, and cellular differentiation. REV-ERB
          receptors bind as a monomer to a (A/G)GGTCA half-site
          with a 5' AT-rich extension or as a homodimer to a
          direct repeat 2 element (AGGTCA sequence with a 2-bp
          spacer), indicating functional diversity. When bound to
          the DNA, they recruit corepressors (NcoR/histone
          deacetylase 3) to the promoter, resulting in repression
          of the target genes. The porphyrin heme has been
          demonstrated to function as a ligand for REV-ERB
          receptor. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, REV-ERB receptors have a central well
          conserved DNA binding domain (DBD), a variable
          N-terminal domain, a non-conserved hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 89

 Score = 39.8 bits (93), Expect = 2e-05
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 20 RNLEY-VCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRLG 63
          + ++Y  C +   C +    RN+CQ CRF KCL V M+RD  R G
Sbjct: 36 QKIQYRKCTKNETCSIMRINRNRCQYCRFKKCLAVGMSRDAVRFG 80


>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the
          2DBD nuclear receptor is composed of two C4-type zinc
          fingers.  The second DNA-binding domain (DBD) of the
          2DBD nuclear receptor (NR) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. NRs
          interact with specific DNA sites upstream of the target
          gene and modulate the rate of transcriptional
          initiation. The proteins contain two DBDs in tandem,
          probably resulting from an ancient recombination event.
           The 2DBD-NRs are found only in flatworm species,
          mollusks and arthropods.  Their biological function is
          unknown.
          Length = 74

 Score = 39.0 bits (91), Expect = 3e-05
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 21 NLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRLG 63
          +  YVC    +C +    RN C++CRF +CL V M++  +R+G
Sbjct: 32 SNSYVCPGGQNCAITPATRNACKSCRFRRCLAVGMSKTGSRIG 74


>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D
          receptors (VDR) like nuclear receptor family is
          composed of two C4-type zinc fingers.  The DNA-binding
          domain of vitamin D receptors (VDR) like nuclear
          receptor family is composed of two C4-type zinc
          fingers. Each zinc finger contains a group of four Cys
          residues which co-ordinates a single zinc atom. This
          domain interacts with specific DNA site upstream of the
          target gene and modulates the rate of transcriptional
          initiation. This family includes three types of nuclear
          receptors: vitamin D receptors (VDR), constitutive
          androstane receptor (CAR) and pregnane X receptor
          (PXR). VDR regulates calcium metabolism, cellular
          proliferation and differentiation.  PXR and CAR
          function as sensors of toxic byproducts of cell
          metabolism and of exogenous chemicals, to facilitate
          their elimination. The DNA binding activity is
          regulated by their corresponding ligands. VDR is
          activated by Vitamin D; CAR and PXR respond to a
          diverse array of chemically distinct ligands, including
          many endogenous compounds and clinical drugs. Like
          other nuclear receptors, xenobiotic receptors have a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 72

 Score = 38.9 bits (91), Expect = 3e-05
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          R   + C   G C +    R  CQACR  KCL + M ++
Sbjct: 31 RKARFTCPFNGDCEITKDNRRHCQACRLKKCLDIGMKKE 69


>gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors
          (LXRs) family is composed of two C4-type zinc fingers. 
          DNA-binding domain of Liver X receptors (LXRs) family
          is composed of two C4-type zinc fingers. Each zinc
          finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. LXR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  LXR
          operates as cholesterol sensor which protects cells
          from cholesterol overload by stimulating reverse
          cholesterol transport from peripheral tissues to the
          liver and its excretion in the bile. Oxidized
          cholesterol derivatives or oxysterols were identified
          as specific ligands for LXRs. LXR functions as a
          heterodimer with the retinoid X receptor (RXR) which
          may be activated by either LXR agonist or 9-cis
          retinoic acid, a specific RXR ligand. The LXR/RXR
          complex binds to a liver X receptor response element
          (LXRE) in the promoter region of target genes. The
          ideal LXRE sequence is a direct repeat-4 (DR-4) DNA
          fragment consisting of two AGGTCA hexameric half-sites
          separated by a 4-nucleotide spacer. LXR has typical NR
          modular structure with a central well conserved DNA
          binding domain (DBD), a variable N-terminal domain, a
          flexible hinge and the ligand binding domain (LBD) at
          the C-terminal.
          Length = 101

 Score = 38.3 bits (89), Expect = 8e-05
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 19 VRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
          ++  +YVCK  G C +D+  R +CQ CR  KC +  M
Sbjct: 50 IKGAQYVCKNGGKCQMDMYMRRKCQECRLRKCREAGM 86


>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor
          (PXRs) is composed of two C4-type zinc fingers.
          DNA-binding domain (DBD)of pregnane X receptor (PXR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. PXR DBD interacts with
          the PXR response element, a perfect repeat of two
          AGTTCA motifs with a 4 bp spacer upstream of the target
          gene, and modulates the rate of transcriptional
          initiation. The pregnane X receptor (PXR) is a
          ligand-regulated transcription factor that responds to
          a diverse array of chemically distinct ligands,
          including many endogenous compounds and clinical drugs.
          PXR functions as a heterodimer with retinoic X
          receptor-alpha (RXRa) and binds to a variety of
          promoter regions of a diverse set of target genes
          involved in the metabolism, transport, and ultimately,
          elimination of these molecules from the body. Like
          other nuclear receptors, PXR has a central well
          conserved DNA-binding domain, a variable N-terminal
          domain, a flexible hinge and a C-terminal ligand
          binding domain.
          Length = 87

 Score = 38.0 bits (88), Expect = 8e-05
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDV 59
          RN    C  +  C++  + R QCQACR  KCL + M +++
Sbjct: 32 RNARLCCPFQKGCVITKSNRRQCQACRLRKCLSIGMKKEL 71


>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor
          (FXR) family is composed of two C4-type zinc fingers.
          DNA-binding domain of Farnesoid X receptor (FXR) family
          is composed of two C4-type zinc fingers. Each zinc
          finger contains a group of four Cys residues which
          co-ordinates a single zinc atom. FXR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation.  FXR
          is a member of the nuclear receptor family of ligand
          activated transcription factors. Bile acids are
          endogenous ligands for FXRs. Upon binding of a ligand,
          FXR binds to FXR response element (FXRE), which is an
          inverted repeat of TGACCT spaced by one nucleotide,
          either as a monomer or as a heterodimer with retinoid X
          receptor (RXR), to regulate the expression of various
          genes involved in bile acid, lipid, and glucose
          metabolism. Like other members of the nuclear receptor
          (NR) superfamily of ligand-activated transcription
          factors, FXR has a central well conserved DNA binding
          domain (DBD), a variable N-terminal domain, a flexible
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 84

 Score = 37.3 bits (86), Expect = 2e-04
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
          +N  Y CK  G+C +D+  R +CQ CR  KC ++ M
Sbjct: 34 KNAVYKCKNGGNCEMDMYMRRKCQECRLRKCKEMGM 69


>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR)
          is composed of two C4-type zinc fingers.  DNA-binding
          domain of androgen receptor (AR) is composed of two
          C4-type zinc fingers. Each zinc finger contains a group
          of four Cys residues which co-ordinates a single zinc
          atom. To regulate gene expression, AR interacts with a
          palindrome of the core sequence 5'-TGTTCT-3' with a
          3-bp spacer. It also binds to the direct repeat
          5'-TGTTCT-3' hexamer in some androgen controlled genes.
          AR is activated by the androgenic hormones,
          testosterone or dihydrotestosterone, which are
          responsible for primary and for secondary male
          characteristics, respectively. The primary mechanism of
          action of ARs is by direct regulation of gene
          transcription. The binding of androgen results in a
          conformational change in the androgen receptor which
          causes its transport from the cytosol into the cell
          nucleus, and dimerization. The receptor dimer binds to
          a hormone response element of AR regulated genes and
          modulates their expression. Another mode of action of
          androgen receptor is independent of their interactions
          with DNA. The receptor interacts directly with signal
          transduction proteins in the cytoplasm, causing rapid
          changes in cell function, such as ion transport. Like
          other members of the nuclear receptor (NR) superfamily
          of ligand-activated transcription factors, AR has  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 82

 Score = 36.1 bits (83), Expect = 4e-04
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 9  CGVVSCQFVFVRNLE----YVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
          CG  SC+  F R  E    Y+C  R  C +D  RR  C +CR  KC +  M
Sbjct: 23 CG--SCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCFEAGM 71


>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced
          DHR4 orphan nuclear receptor is composed of two C4-type
          zinc fingers.  DNA-binding domain of ecdysone-induced
          DHR4 orphan nuclear receptor is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which coordinates a single zinc atom. This
          domain interacts with specific DNA sites upstream of
          the target gene and modulates the rate of
          transcriptional initiation. Ecdysone-induced orphan
          receptor DHR4 is a member of the nuclear receptor
          family. DHR4 is expressed during the early Drosophila
          larval development and is induced by ecdysone. DHR4
          coordinates growth and maturation in Drosophila by
          mediating endocrine response to the attainment of
          proper body size during larval development. Mutations
          in DHR4 result in shorter larval development which
          translates into smaller and lighter flies. Like other
          members of the nuclear receptor (NR) superfamily of
          ligand-activated transcription factors, DHR4  has a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 90

 Score = 36.4 bits (84), Expect = 4e-04
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 14 CQFVFVRNLE----YVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
          C+  F R ++    Y C   G C +   +RN+CQ CRF KC++  M
Sbjct: 29 CKGFFKRTVQNKRVYTCVGDGRCEITKAQRNRCQYCRFRKCIRKGM 74


>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor
          (ECR) family is composed of two C4-type zinc fingers.
          DNA-binding domain of Ecdysone receptor (EcR) family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. EcR interacts with
          highly degenerate pseudo-palindromic response elements,
          resembling inverted repeats of 5'-AGGTCA-3' separated
          by 1 bp, upstream of the target gene and modulates the
          rate of transcriptional initiation. EcR is present only
          in invertebrates and regulates the expression of a
          large number of genes during development and
          reproduction. EcR functions as a heterodimer by
          partnering with ultraspiracle protein (USP), the
          ortholog of the vertebrate retinoid X receptor (RXR).
          The natural ligands of EcR are ecdysteroids, the
          endogenous steroidal hormones found in invertebrates.
          Like other members of the nuclear receptor (NR)
          superfamily of ligand-activated transcription factors,
          EcRs have a central well conserved DNA binding domain
          (DBD), a variable N-terminal domain, a non-conserved
          hinge and a C-terminal ligand binding domain (LBD).
          Length = 91

 Score = 36.4 bits (84), Expect = 4e-04
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKM 55
          ++  Y CK    C +D+  R +CQ CR  KCL V M
Sbjct: 34 KSAVYHCKYGRACEMDMYMRRKCQECRLKKCLSVGM 69


>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive
          androstane receptor (CAR) is composed of two C4-type
          zinc fingers.  DNA-binding domain (DBD) of constitutive
          androstane receptor (CAR) is composed of two C4-type
          zinc fingers. Each zinc finger contains a group of four
          Cys residues which co-ordinates a single zinc atom. CAR
          DBD interacts with CAR response element, a perfect
          repeat of two AGTTCA motifs with a 4 bp spacer upstream
          of the target gene, and modulates the rate of
          transcriptional initiation. The constitutive androstane
          receptor (CAR) is a ligand-regulated transcription
          factor that responds to a diverse array of chemically
          distinct ligands, including many endogenous compounds
          and clinical drugs. It functions as a heterodimer with
          RXR. The CAR/RXR heterodimer binds many common response
          elements in the promoter regions of a diverse set of
          target genes involved in the metabolism, transport, and
          ultimately, elimination of these molecules from the
          body. CAR is a closest mammalian relative of PXR and is
          activated by some of the same ligands as PXR and
          regulates a subset of common genes. The sequence
          homology and functional similarity suggests that the
          CAR gene arose from a duplication of an ancestral PXR
          gene. Like other nuclear receptors, CAR has a central
          well conserved DNA binding domain, a variable
          N-terminal domain, a flexible hinge and a C-terminal
          ligand binding domain.
          Length = 94

 Score = 35.1 bits (81), Expect = 0.001
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 13 SCQFVFVRNL----EYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          SC+  F RN     E+ C     C ++V  R  CQ CR  KC  + M ++
Sbjct: 22 SCKAFFRRNALKNKEFKCPFNESCEINVVTRRFCQKCRLDKCFAIGMKKE 71


>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone
          receptor (EcR) like nuclear receptor family is composed
          of two C4-type zinc fingers.  The DNA-binding domain of
          Ecdysone receptor (EcR) like nuclear receptor family is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which
          co-ordinates a single zinc atom. EcR interacts with
          specific DNA sites upstream of the target gene and
          modulates the rate of transcriptional initiation. This
          family includes three types of nuclear receptors:
          Ecdysone receptor (EcR), Liver X receptor (LXR) and
          Farnesoid X receptor (FXR). The DNA binding activity is
          regulated by their corresponding ligands. The ligands
          for EcR are ecdysteroids; LXR is regulated by oxidized
          cholesterol derivatives or oxysterols; and bile acids
          control FXR's activities. Like other members of the
          nuclear receptor (NR) superfamily of ligand-activated
          transcription factors, EcR-like receptors have  a
          central well conserved DNA binding domain (DBD), a
          variable N-terminal domain, a flexible hinge and a
          C-terminal ligand binding domain (LBD).
          Length = 73

 Score = 33.2 bits (76), Expect = 0.005
 Identities = 14/39 (35%), Positives = 18/39 (46%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          +   Y CK    C +D+  R +CQ CR  KC    M  D
Sbjct: 32 KGAVYACKFGNKCEMDMYMRRKCQECRLRKCKAAGMRPD 70


>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors
          (VDR) is composed of two C4-type zinc fingers.
          DNA-binding domain of vitamin D receptors (VDR) is
          composed of two C4-type zinc fingers. Each zinc finger
          contains a group of four Cys residues which coordinates
          a single zinc atom. VDR interacts with a VDR response
          element, a direct repeat of GGTTCA DNA site with 3 bp
          spacer upstream of the target gene, and modulates the
          rate of transcriptional initiation.  VDR is a member of
          the nuclear receptor (NR) superfamily that functions as
          classical endocrine receptors. VDR controls a wide
          range of biological activities including calcium
          metabolism, cell proliferation and differentiation, and
          immunomodulation. VDR is a high-affinity receptor for
          the biologically most active Vitamin D metabolite,
          1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The
          binding of the ligand to the receptor induces a
          conformational change of the ligand binding domain
          (LBD) with consequent dissociation of corepressors.
          Upon ligand binding, VDR forms a heterodimer with the
          retinoid X receptor (RXR) that binds to vitamin D
          response elements (VDREs), recruits coactivators. This
          leads to the expression of a large number of genes.
          Approximately 200 human genes are considered to be
          primary targets of VDR and even more genes are
          regulated indirectly. Like other members of the nuclear
          receptor (NR) superfamily of ligand-activated
          transcription factors, VDR has a central well conserved
          DNA binding domain (DBD), a variable N-terminal domain,
          a flexible hinge and a C-terminal ligand binding domain
          (LBD).
          Length = 107

 Score = 31.1 bits (70), Expect = 0.053
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 20 RNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRD 58
          R   + C   G C +    R  CQACR  +C+ + M ++
Sbjct: 39 RKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKE 77


>gnl|CDD|185060 PRK15105, PRK15105, peptidoglycan synthase FtsI; Provisional.
          Length = 578

 Score = 29.4 bits (66), Expect = 0.36
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%)

Query: 30  GHCIVDVTRRNQCQACRFSKCLQVKMNRDVTRLGFWYPSFLLRVVSSRFLFGQ 82
           GH I DV R ++      +  LQ   N  V++L    PS  L    SRF  G+
Sbjct: 337 GHEIKDVARYSELT---LTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGK 386


>gnl|CDD|216786 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K).  This family
           includes only lysyl tRNA synthetases from prokaryotes.
          Length = 357

 Score = 28.7 bits (65), Expect = 0.67
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 6/38 (15%)

Query: 6   CPDCGVVSCQFVFVRN-----LEYVCKERGHCI-VDVT 37
           CP CG V    V   +     + Y C E GH   VD+T
Sbjct: 174 CPKCGRVLTTPVVEYDAEGGTITYKCDECGHEGEVDIT 211


>gnl|CDD|236103 PRK07810, PRK07810, O-succinylhomoserine sulfhydrylase;
           Provisional.
          Length = 403

 Score = 28.2 bits (63), Expect = 0.92
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 6/25 (24%)

Query: 72  RVVSSRFLFGQESPAWMCFVRCVEI 96
           R+V++R LFG       CFV C EI
Sbjct: 111 RLVAARSLFGS------CFVVCNEI 129


>gnl|CDD|236330 PRK08665, PRK08665, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 752

 Score = 28.4 bits (64), Expect = 0.98
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 20/45 (44%)

Query: 6   CPDCGVVSCQFVFVRNLEYVCKERGHCIVDVTRRNQCQACRFSKC 50
           CP+CG +         LE+   E G C+V       C +C +SKC
Sbjct: 727 CPECGSI---------LEH---EEG-CVV-------CHSCGYSKC 751


>gnl|CDD|179937 PRK05101, PRK05101, galactokinase; Provisional.
          Length = 382

 Score = 28.0 bits (63), Expect = 1.2
 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 4/25 (16%)

Query: 37  TRRNQC-QACRFSKCLQVKMNRDVT 60
           TRR QC  A RF     VK  RDVT
Sbjct: 225 TRRQQCETAARF---FGVKALRDVT 246


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 25.8 bits (57), Expect = 2.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)

Query: 17 VFVRNLEYVCKE 28
          +F+RNL Y C E
Sbjct: 5  LFIRNLAYTCTE 16


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 25.8 bits (57), Expect = 3.0
 Identities = 9/12 (75%), Positives = 10/12 (83%)

Query: 17 VFVRNLEYVCKE 28
          +FVRNL Y CKE
Sbjct: 5  LFVRNLPYSCKE 16


>gnl|CDD|188707 cd08753, RGS_PDZRhoGEF, Regulator of G protein signaling (RGS)
           domain found in the PDZ-Rho guanine nucleotide exchange
           factor (RhoGEF) protein.  The RGS domain is an essential
           part of the PDZ-RhoGEF (PDZ:Postsynaptic density 95,
           Disk large, Zona occludens-1; RhoGEF: Rho guanine
           nucleotide exchange factor; alias PRG) protein, a member
           of RhoGEFs subfamily of the RGS protein family. The
           RhoGEFs are peripheral membrane proteins that regulate
           essential cellular processes, including cell shape, cell
           migration, and cell cycle progression, as well as gene
           transcription by linking signals from heterotrimeric
           G-alpha12/13 protein-coupled receptors to Rho GTPase
           activation, leading to various cellular responses, such
           as actin reorganization and gene expression. RhoGEFs
           subfamily includes leukemia-associated RhoGEF protein
           (LARG), p115RhoGEF, PDZ-RhoGEF and its rat specific
           splice variant GTRAP48. The RGS domain of RhoGEFs has
           very little sequence similarity with the canonical RGS
           domain of the RGS proteins and is often refered to as RH
           (RGS Homology) domain. In contrast to p115RhoGEF and
           LARG, PDZ-RhoGEF cannot serve as a GTPase-activating
           protein (GAP), due to the mutation of sites in the RGS
           domain region that are crucial for GAP activity. RGS
           proteins play critical regulatory role as GTPase
           activating proteins (GAPs) of the heterotrimeric
           G-protein G-alpha-subunits. RGS proteins play critical
           regulatory role as GTPase activating proteins (GAPs) of
           the heterotrimeric G-protein G-alpha-subunits. RGS
           proteins regulate many aspects of embryonic development
           such as glial differentiation, embryonic axis formation,
           skeletal and muscle development, cell migration during
           early embryogenesis, as well as apoptosis, cell
           proliferation, and modulation of cardiac development.
          Length = 145

 Score = 26.4 bits (58), Expect = 3.3
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%)

Query: 67  PSFLLRVVSSRFLFGQESPAWMCFVRCVEIRLQVN 101
           P+ L  VV  R++F Q  P  + F  C E+  Q +
Sbjct: 32  PAHL--VVFLRYIFSQADPGPLLFYLCSEVYQQTS 64


>gnl|CDD|237798 PRK14714, PRK14714, DNA polymerase II large subunit; Provisional.
          Length = 1337

 Score = 26.6 bits (59), Expect = 4.5
 Identities = 13/46 (28%), Positives = 17/46 (36%), Gaps = 6/46 (13%)

Query: 6   CPDCGVVS----CQFVFVR-NLEYVCKERGH-CIVDVTRRNQCQAC 45
           CP CG  +    C          YVC + G     D + R +C  C
Sbjct: 670 CPSCGTETYENRCPDCGTHTEPVYVCPDCGAEVPPDESGRVECPRC 715


>gnl|CDD|100083 cd06162, S2P-M50_PDZ_SREBP, Sterol regulatory element-binding
          protein (SREBP) Site-2 protease (S2P), a zinc
          metalloprotease (MEROPS family M50A), regulates
          intramembrane proteolysis (RIP) of SREBP and is part of
          a signal transduction mechanism involved in sterol and
          lipid metabolism. In sterol-depleted mammalian cells, a
          two-step proteolytic process releases the N-terminal
          domains of SREBPs from membranes of the endoplasmic
          reticulum (ER). These domains translocate into the
          nucleus, where they activate genes of cholesterol and
          fatty acid biosynthesis. The first cleavage occurs at
          Site-1 within the ER lumen to generate an intermediate
          that is subsequently released from the membrane by
          cleavage at Site-2, which lies within the first
          transmembrane domain. It is the second proteolytic step
          that is carried out by the SREBP Site-2 protease (S2P)
          which is present in this CD family.  This group appears
          to be limited to eumetazoan proteins and contains one
          PDZ domain.
          Length = 277

 Score = 25.4 bits (56), Expect = 8.1
 Identities = 9/27 (33%), Positives = 10/27 (37%)

Query: 55 MNRDVTRLGFWYPSFLLRVVSSRFLFG 81
           NR   R G   P  L    S   +FG
Sbjct: 52 FNRLFYRWGRAKPRLLYLWFSLGVVFG 78


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.332    0.139    0.466 

Gapped
Lambda     K      H
   0.267   0.0820    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,574,340
Number of extensions: 445183
Number of successful extensions: 446
Number of sequences better than 10.0: 1
Number of HSP's gapped: 444
Number of HSP's successfully gapped: 56
Length of query: 119
Length of database: 10,937,602
Length adjustment: 82
Effective length of query: 37
Effective length of database: 7,300,574
Effective search space: 270121238
Effective search space used: 270121238
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 53 (24.0 bits)