Query         psy9235
Match_columns 317
No_of_seqs    260 out of 387
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:19:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9235.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9235hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1140|consensus               99.9 1.3E-22 2.8E-27  223.5   8.1  159    1-177  1039-1205(1738)
  2 PF13639 zf-RING_2:  Ring finge  97.0 0.00035 7.5E-09   48.2   1.7   22  113-134    14-35  (44)
  3 KOG1139|consensus               96.9  0.0012 2.6E-08   69.7   5.4   77    1-95    648-724 (784)
  4 KOG1139|consensus               96.7  0.0011 2.4E-08   70.0   3.1   69  240-317   644-719 (784)
  5 cd00162 RING RING-finger (Real  96.2  0.0031 6.7E-08   41.8   2.0   21  114-134    12-32  (45)
  6 PF12861 zf-Apc11:  Anaphase-pr  95.9  0.0053 1.2E-07   49.1   2.2   24  113-136    45-68  (85)
  7 KOG1940|consensus               95.2   0.014 3.1E-07   55.9   2.9   73  113-236   173-248 (276)
  8 PF13923 zf-C3HC4_2:  Zinc fing  94.9   0.015 3.2E-07   39.1   1.5   22  114-135    11-32  (39)
  9 smart00184 RING Ring finger. E  94.8   0.026 5.7E-07   35.8   2.6   22  113-134     9-30  (39)
 10 COG5243 HRD1 HRD ubiquitin lig  94.8   0.021 4.4E-07   56.8   2.9   17  118-134   316-332 (491)
 11 PF12678 zf-rbx1:  RING-H2 zinc  94.6   0.018   4E-07   44.2   1.6   21  114-134    44-64  (73)
 12 PF00097 zf-C3HC4:  Zinc finger  94.5   0.022 4.7E-07   38.3   1.6   20  116-135    13-32  (41)
 13 PLN03208 E3 ubiquitin-protein   93.8   0.074 1.6E-06   48.6   4.0   55  115-176    31-87  (193)
 14 PF14634 zf-RING_5:  zinc-RING   93.5   0.073 1.6E-06   36.7   2.8   21  113-133    13-33  (44)
 15 PF11793 FANCL_C:  FANCL C-term  92.8   0.042   9E-07   42.1   0.7   39  118-168    26-64  (70)
 16 PF09538 FYDLN_acid:  Protein o  92.4   0.068 1.5E-06   44.5   1.5   26  261-286     8-36  (108)
 17 PF13240 zinc_ribbon_2:  zinc-r  92.4    0.07 1.5E-06   32.5   1.2   22  264-285     1-22  (23)
 18 PF13920 zf-C3HC4_3:  Zinc fing  92.3    0.15 3.3E-06   35.9   3.0   36  113-171    13-49  (50)
 19 PF10571 UPF0547:  Uncharacteri  91.9   0.077 1.7E-06   33.3   1.0   24  263-286     1-24  (26)
 20 PHA02929 N1R/p28-like protein;  91.8    0.11 2.4E-06   48.9   2.3   36  116-174   196-231 (238)
 21 PHA02926 zinc finger-like prot  90.4    0.22 4.8E-06   46.6   2.9   45  114-175   191-235 (242)
 22 KOG4445|consensus               90.3   0.054 1.2E-06   52.5  -1.3   51  114-167   130-183 (368)
 23 PF13248 zf-ribbon_3:  zinc-rib  89.7    0.18 3.9E-06   31.3   1.1   24  262-285     2-25  (26)
 24 TIGR02300 FYDLN_acid conserved  88.5    0.25 5.4E-06   42.3   1.6   26  261-286     8-36  (129)
 25 PRK00415 rps27e 30S ribosomal   88.4     0.2 4.2E-06   37.6   0.8   30  259-288     8-42  (59)
 26 PF01667 Ribosomal_S27e:  Ribos  87.6    0.27 5.9E-06   36.3   1.1   30  259-288     4-38  (55)
 27 PF13764 E3_UbLigase_R4:  E3 ub  87.6    0.86 1.9E-05   49.8   5.4   66   54-135   465-530 (802)
 28 COG2051 RPS27A Ribosomal prote  87.4    0.31 6.7E-06   37.3   1.4   31  259-289    16-51  (67)
 29 PTZ00083 40S ribosomal protein  85.6    0.39 8.6E-06   38.4   1.1   30  260-289    33-67  (85)
 30 PF15227 zf-C3HC4_4:  zinc fing  85.3    0.65 1.4E-05   32.0   2.0   24  111-134     7-30  (42)
 31 COG5194 APC11 Component of SCF  84.9    0.72 1.6E-05   36.7   2.3   23  113-135    47-69  (88)
 32 KOG2930|consensus               81.8     1.2 2.5E-05   37.1   2.4   22  114-135    75-96  (114)
 33 PLN00209 ribosomal protein S27  81.3    0.75 1.6E-05   36.9   1.1   31  259-289    33-68  (86)
 34 COG5432 RAD18 RING-finger-cont  80.1     1.3 2.7E-05   43.2   2.4   23  111-133    34-56  (391)
 35 KOG0823|consensus               79.5     1.7 3.7E-05   40.7   3.0   47  110-176    55-103 (230)
 36 KOG1428|consensus               78.9    0.94   2E-05   52.2   1.3  104  118-270  3505-3610(3738)
 37 PF02148 zf-UBP:  Zn-finger in   78.1     1.4 2.9E-05   32.8   1.6   25  265-290     1-25  (63)
 38 KOG0802|consensus               77.3     1.3 2.9E-05   46.1   1.8   19  117-135   311-329 (543)
 39 KOG0827|consensus               76.8     1.4 3.1E-05   44.3   1.8   20  116-135    22-41  (465)
 40 KOG1493|consensus               71.9     1.9 4.2E-05   34.0   1.1   34  114-167    45-78  (84)
 41 KOG4172|consensus               69.6     2.1 4.5E-05   31.9   0.8   21  113-133    18-39  (62)
 42 smart00744 RINGv The RING-vari  69.2     5.8 0.00013   28.2   3.0   22  115-136    14-40  (49)
 43 PRK02935 hypothetical protein;  68.4     2.2 4.8E-05   35.6   0.8   30  258-288    66-98  (110)
 44 smart00504 Ubox Modified RING   67.9     4.1 8.8E-05   29.3   2.0   22  113-134    12-33  (63)
 45 PF08746 zf-RING-like:  RING-li  67.5     3.5 7.6E-05   28.6   1.5   17  119-135    18-34  (43)
 46 PF10367 Vps39_2:  Vacuolar sor  65.0     1.7 3.7E-05   34.4  -0.5   15  117-131    95-109 (109)
 47 TIGR00599 rad18 DNA repair pro  64.9     3.9 8.4E-05   41.4   1.9   18  116-133    40-57  (397)
 48 smart00290 ZnF_UBP Ubiquitin C  63.1     5.7 0.00012   27.6   1.9   24  264-289     1-24  (50)
 49 KOG1941|consensus               62.9     3.1 6.8E-05   42.0   0.8   22  113-134   380-401 (518)
 50 KOG4628|consensus               62.3     4.7  0.0001   40.1   1.9   34  112-167   242-275 (348)
 51 PF12773 DZR:  Double zinc ribb  62.3     3.8 8.3E-05   28.6   0.9   24  262-285    12-38  (50)
 52 PF08271 TF_Zn_Ribbon:  TFIIB z  60.4     5.4 0.00012   27.3   1.4   24  263-286     1-29  (43)
 53 PF06221 zf-C2HC5:  Putative zi  60.1       3 6.6E-05   31.0   0.1   15  275-289    17-31  (57)
 54 PF14599 zinc_ribbon_6:  Zinc-r  58.5     2.8   6E-05   31.6  -0.4   36  197-236     9-44  (61)
 55 KOG0828|consensus               58.4     5.4 0.00012   41.5   1.5   22  114-135   600-621 (636)
 56 TIGR00570 cdk7 CDK-activating   58.1     6.8 0.00015   38.4   2.1   18  116-133    22-39  (309)
 57 PF11023 DUF2614:  Protein of u  57.1     3.6 7.9E-05   34.6   0.1   30  258-288    65-97  (114)
 58 COG2888 Predicted Zn-ribbon RN  55.6     5.1 0.00011   30.1   0.7   26  258-283    23-57  (61)
 59 PF07800 DUF1644:  Protein of u  55.2      11 0.00023   33.7   2.7   53  123-175    36-96  (162)
 60 PF05191 ADK_lid:  Adenylate ki  55.1     3.6 7.7E-05   27.7  -0.2   24  262-285     1-30  (36)
 61 PRK14890 putative Zn-ribbon RN  54.3     5.5 0.00012   29.9   0.7   13  259-271    22-34  (59)
 62 PF13445 zf-RING_UBOX:  RING-ty  52.8      10 0.00023   26.3   1.8   21  115-135    14-34  (43)
 63 PF07754 DUF1610:  Domain of un  51.7     6.3 0.00014   24.4   0.5   12  259-270    13-24  (24)
 64 PF15616 TerY-C:  TerY-C metal   50.3      12 0.00025   32.4   2.1   38  263-303    78-121 (131)
 65 smart00154 ZnF_AN1 AN1-like Zi  50.3      12 0.00025   25.5   1.7   25  265-289     1-25  (39)
 66 PF12773 DZR:  Double zinc ribb  50.2      11 0.00023   26.3   1.5   25  259-283    26-50  (50)
 67 COG4530 Uncharacterized protei  48.3     9.5 0.00021   32.2   1.2   26  261-286     8-36  (129)
 68 COG5219 Uncharacterized conser  47.5      11 0.00024   42.2   1.9   24  113-136  1487-1510(1525)
 69 PF14446 Prok-RING_1:  Prokaryo  44.3      14  0.0003   27.3   1.4   26  260-285     3-30  (54)
 70 KOG0309|consensus               43.2      12 0.00026   40.9   1.3   24  112-135  1040-1063(1081)
 71 PF15353 HECA:  Headcase protei  43.2      15 0.00033   30.6   1.7   18  120-137    40-57  (107)
 72 COG2093 DNA-directed RNA polym  42.9     9.2  0.0002   29.1   0.3   23  262-284     4-26  (64)
 73 PRK12286 rpmF 50S ribosomal pr  42.4      15 0.00033   27.1   1.4   24  261-285    26-49  (57)
 74 PF11331 DUF3133:  Protein of u  38.8     5.1 0.00011   28.6  -1.5   29  244-272    13-41  (46)
 75 KOG0317|consensus               37.9      23  0.0005   34.4   2.2   23  112-134   249-271 (293)
 76 COG5540 RING-finger-containing  37.1      24 0.00052   34.8   2.2   20  114-133   338-357 (374)
 77 PRK00398 rpoP DNA-directed RNA  37.0      25 0.00054   24.3   1.8   25  262-286     3-31  (46)
 78 PF03604 DNA_RNApol_7kD:  DNA d  35.7      23 0.00049   23.3   1.3   21  264-284     2-25  (32)
 79 PF01428 zf-AN1:  AN1-like Zinc  35.2      24 0.00052   24.2   1.4   23  266-289     4-26  (43)
 80 KOG2114|consensus               34.1      19 0.00042   39.7   1.2   29  113-167   852-880 (933)
 81 TIGR01031 rpmF_bact ribosomal   33.6      26 0.00055   25.7   1.4   24  261-285    25-48  (55)
 82 KOG0320|consensus               33.6      28 0.00061   31.7   1.9   21  115-135   146-166 (187)
 83 COG4855 Uncharacterized protei  33.4      22 0.00047   27.6   1.0   23  265-288    13-35  (76)
 84 TIGR02098 MJ0042_CXXC MJ0042 f  33.1      30 0.00064   22.7   1.6   25  262-286     2-35  (38)
 85 KOG0287|consensus               32.1      34 0.00073   34.3   2.4   21  113-133    34-54  (442)
 86 PRK00420 hypothetical protein;  31.7      32 0.00069   28.9   1.9   25  262-286    23-50  (112)
 87 KOG2845|consensus               31.1      17 0.00038   37.7   0.2   13  278-290   172-184 (505)
 88 cd00350 rubredoxin_like Rubred  30.0      29 0.00063   22.5   1.1   22  263-284     2-25  (33)
 89 KOG1734|consensus               29.1      26 0.00056   34.0   1.0   21  113-133   245-265 (328)
 90 KOG0269|consensus               28.2      33 0.00071   37.6   1.6   21  115-135   794-814 (839)
 91 smart00647 IBR In Between Ring  27.8      46   0.001   23.6   2.0   29  261-289    17-53  (64)
 92 COG4830 RPS26B Ribosomal prote  26.6      34 0.00074   28.3   1.2   19  263-281    21-39  (108)
 93 KOG1814|consensus               26.2      34 0.00074   34.9   1.3   31  262-295   368-402 (445)
 94 KOG3268|consensus               26.0      48   0.001   30.4   2.1   40  116-167   186-225 (234)
 95 PF01363 FYVE:  FYVE zinc finge  25.8      42 0.00091   24.7   1.4   32  261-294     8-41  (69)
 96 TIGR00354 polC DNA polymerase,  25.7      27 0.00058   39.3   0.5   25  260-286   623-647 (1095)
 97 PF09889 DUF2116:  Uncharacteri  25.7      22 0.00047   26.6  -0.1   14  262-275     3-16  (59)
 98 PRK14714 DNA polymerase II lar  25.6      31 0.00068   39.8   1.0   23  262-286   667-689 (1337)
 99 PF05883 Baculo_RING:  Baculovi  25.1      68  0.0015   27.9   2.8   22  112-133    39-66  (134)
100 PRK14715 DNA polymerase II lar  24.7      30 0.00066   40.2   0.7   24  260-285   672-695 (1627)
101 PRK09335 30S ribosomal protein  23.9      48   0.001   27.2   1.5   21  262-282    20-40  (95)
102 cd00729 rubredoxin_SM Rubredox  23.8      35 0.00076   22.4   0.6   22  263-284     3-26  (34)
103 PRK12495 hypothetical protein;  23.4      70  0.0015   30.1   2.7   27  260-286    40-68  (226)
104 PF04423 Rad50_zn_hook:  Rad50   23.2      31 0.00067   24.6   0.3    7  161-167    22-28  (54)
105 COG0333 RpmF Ribosomal protein  22.8      49  0.0011   24.6   1.3   23  261-284    26-48  (57)
106 smart00659 RPOLCX RNA polymera  22.7      51  0.0011   23.0   1.3   22  263-284     3-27  (44)
107 KOG1785|consensus               22.7      41 0.00088   34.4   1.1   43  112-175   379-421 (563)
108 PHA00626 hypothetical protein   22.3      64  0.0014   24.2   1.7    8  264-271     2-9   (59)
109 KOG0804|consensus               22.2      46   0.001   34.4   1.4   24  110-133   187-210 (493)
110 PF14206 Cys_rich_CPCC:  Cystei  22.2      44 0.00096   26.4   1.0   22  262-283     1-27  (78)
111 KOG1002|consensus               22.2      62  0.0014   34.3   2.3   72  112-207   546-621 (791)
112 PF01783 Ribosomal_L32p:  Ribos  22.1      35 0.00076   24.9   0.4   23  261-284    25-47  (56)
113 PF04641 Rtf2:  Rtf2 RING-finge  22.1      68  0.0015   30.3   2.4   21  112-132   127-147 (260)
114 KOG2164|consensus               21.3      55  0.0012   34.2   1.7   46  113-176   197-244 (513)
115 KOG0804|consensus               20.9      45 0.00098   34.5   1.0   25  262-288   228-252 (493)
116 COG2023 RPR2 RNase P subunit R  20.3      84  0.0018   26.2   2.3   24  262-285    56-91  (105)
117 PRK14892 putative transcriptio  20.2      45 0.00097   27.4   0.7   23  261-285    20-51  (99)
118 PRK12496 hypothetical protein;  20.1      53  0.0012   29.0   1.2   24  262-285   127-152 (164)

No 1  
>KOG1140|consensus
Probab=99.87  E-value=1.3e-22  Score=223.49  Aligned_cols=159  Identities=28%  Similarity=0.429  Sum_probs=110.0

Q ss_pred             CHHHHHHHHHHhHHhhhhhhcccccccCCcCccCCCCCC-------ccccCCCCCCCCCCCCCccceeecCCCccccc-C
Q psy9235           1 MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEH-------PVALGPNQTPRPNTGPVYYTCILCQEEQALTK-Q   72 (317)
Q Consensus         1 ms~~Qk~Fm~~N~~l~~~~~~~~~e~~~~~~~~md~~~~-------~valGp~~~~~~~~~~~~~tCILCqE~~~~~~-~   72 (317)
                      |++||.+||++|.+-|++.. +..++..+ ......+..       .-.+-+..+..........+|++|++...+.. .
T Consensus      1039 ~s~qq~kfm~~~e~e~d~~~-~~~~~~~~-~~~~~~d~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~i~~e~e~~~~~~ 1116 (1738)
T KOG1140|consen 1039 FSNQQTKFMAENEDEFDEQE-NQTPSSGS-KTYEEEDFTCALCQDNSCTDFQVKPASHLVKPIFRECIICDENEDVPNWD 1116 (1738)
T ss_pred             HHHHHHHHHHhcccccCccc-ccCccccc-cchhhhhccchhhhccchhccccccchhhhcccccccccCChhccCCCcc
Confidence            68999999999976665521 11111111 000000000       00001111222212345679999999998865 5


Q ss_pred             CCcEEEEEeeecCcccccccCCCCCCCcccccccCCCCCCCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCc
Q psy9235          73 NDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTS  152 (317)
Q Consensus        73 ~~p~g~~a~vQ~S~Vl~~~~~~~~~~~~D~~l~~~~~~~~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~  152 (317)
                      +..++..+|+|+++....            +++.+. ....|+++++|||.||+.||++|+++.+.+++.+....+.+..
T Consensus      1117 ~~~~v~~~f~~~s~~~sd------------~l~~p~-~~~~~~~~s~c~h~mh~~c~~~~~~a~r~~~n~~~~~l~~~~s 1183 (1738)
T KOG1140|consen 1117 GRYSVSSAFAQKSDDVSD------------ALTEPG-SLSCGTVLSSCGHHMHYGCFKRYVQAKRFRENARTAPLCQHYS 1183 (1738)
T ss_pred             ccchhhhHhhhhcccccc------------cccCCC-CCcccceeeccCCcchHHHHHHHHHHHHHHHHhhhcCcccccc
Confidence            689999999999987751            344454 6778999999999999999999999999888887776666544


Q ss_pred             cCCCCCeeeccCCccccceEeccCC
Q psy9235         153 FDIEKNEFLCPLCECLSNAALPLIP  177 (317)
Q Consensus       153 ~d~~~~EFlCPLCrsLsN~vLP~ip  177 (317)
                         ++++|+||+|++|+|+.||.++
T Consensus      1184 ---e~~l~lCp~c~slsn~~lp~~~ 1205 (1738)
T KOG1140|consen 1184 ---ENGLFLCPLCKSLSNVSLPMFL 1205 (1738)
T ss_pred             ---cCCcccCCchHhhhhccCCcCC
Confidence               7899999999999999999654


No 2  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=97.01  E-value=0.00035  Score=48.19  Aligned_cols=22  Identities=27%  Similarity=0.718  Sum_probs=18.6

Q ss_pred             CCceeecCCchhhHHHHHHHhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      ..++.-.|||..|.+|+++|++
T Consensus        14 ~~~~~l~C~H~fh~~Ci~~~~~   35 (44)
T PF13639_consen   14 EKVVKLPCGHVFHRSCIKEWLK   35 (44)
T ss_dssp             SCEEEETTSEEEEHHHHHHHHH
T ss_pred             CeEEEccCCCeeCHHHHHHHHH
Confidence            3566777999999999999984


No 3  
>KOG1139|consensus
Probab=96.92  E-value=0.0012  Score=69.75  Aligned_cols=77  Identities=13%  Similarity=0.232  Sum_probs=49.6

Q ss_pred             CHHHHHHHHHHhHHhhhhhhcccccccCCcCccCCCCCCccccCCCCCCCCCCCCCccceeecCCCcccccCCCcEEEEE
Q psy9235           1 MQAQQNSFMKENAQLFEANATIKLEEEEPESSCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAA   80 (317)
Q Consensus         1 ms~~Qk~Fm~~N~~l~~~~~~~~~e~~~~~~~~md~~~~~valGp~~~~~~~~~~~~~tCILCqE~~~~~~~~~p~g~~a   80 (317)
                      |+++|+-||.+|..-=.. .   .       ..|+ +....-+||.+     ..+..|.|++|+.... .+.++|+|+++
T Consensus       648 fa~~~~~~~~q~~a~~s~-~---~-------~g~e-d~~~~~~~~~q-----~~~k~y~C~icg~n~p-~T~~np~G~~~  709 (784)
T KOG1139|consen  648 FAKRRMEAIMQNSAKKSA-Q---T-------EGME-DAEVNKVDPSQ-----QNRKVYECPICGQNAP-NTVENPFGMLA  709 (784)
T ss_pred             HHHHHHHHHHHHHHHhhh-c---c-------cCCC-hHHHhhhCccc-----CCccCCcCCcCCCCCC-cccCCCceEEE
Confidence            567888888888542111 0   1       1121 11112236665     3456899999995544 47899999999


Q ss_pred             eeecCcccccccCCC
Q psy9235          81 FVQQSTVMFRNRNAD   95 (317)
Q Consensus        81 ~vQ~S~Vl~~~~~~~   95 (317)
                      ++.++.|+.+.....
T Consensus       710 l~~~~~I~~~r~~~~  724 (784)
T KOG1139|consen  710 LLSTNFICEERIDAS  724 (784)
T ss_pred             EEeecchHHHHHhhc
Confidence            999999998766543


No 4  
>KOG1139|consensus
Probab=96.69  E-value=0.0011  Score=69.99  Aligned_cols=69  Identities=6%  Similarity=-0.103  Sum_probs=58.1

Q ss_pred             ccccccccCCChhHHHHHHhhccccCCCCCCCCCCCceeeceeCceecC--CCccccccc-----cccccceEEEEEeee
Q psy9235         240 PLEINRLINLPDDYSELINTVSLFTCPNSDREDSRNPALCLICGDMLCS--QSYCCQTEL-----FFKMSARSFFTVNKT  312 (317)
Q Consensus       240 p~~~~~l~~LP~~y~~L~~~~~~~~C~~c~~~~~~~P~lCL~CG~~~C~--~~~CC~~~~-----~~~~~~~~~~~~~~~  312 (317)
                      |+..|.+..+|--|+++.++..+.       +.+ +|+.|+.||. .|.  +.|||...+     .|++|+|+|++|.++
T Consensus       644 ~~~~fa~~~~~~~~q~~a~~s~~~-------~g~-ed~~~~~~~~-~q~~~k~y~C~icg~n~p~T~~np~G~~~l~~~~  714 (784)
T KOG1139|consen  644 AAKEFAKRRMEAIMQNSAKKSAQT-------EGM-EDAEVNKVDP-SQQNRKVYECPICGQNAPNTVENPFGMLALLSTN  714 (784)
T ss_pred             HhHHHHHHHHHHHHHHHHHhhhcc-------cCC-ChHHHhhhCc-ccCCccCCcCCcCCCCCCcccCCCceEEEEEeec
Confidence            888899999999999999976554       434 8999999998 566  899997543     599999999999999


Q ss_pred             EEeeC
Q psy9235         313 LFLVH  317 (317)
Q Consensus       313 ~~~~~  317 (317)
                      +|+-|
T Consensus       715 ~I~~~  719 (784)
T KOG1139|consen  715 FICEE  719 (784)
T ss_pred             chHHH
Confidence            99754


No 5  
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=96.20  E-value=0.0031  Score=41.76  Aligned_cols=21  Identities=29%  Similarity=0.672  Sum_probs=16.9

Q ss_pred             CceeecCCchhhHHHHHHHhh
Q psy9235         114 APHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      ...+..|||.+|..|++.|++
T Consensus        12 ~~~~~~C~H~~c~~C~~~~~~   32 (45)
T cd00162          12 PVVLLPCGHVFCRSCIDKWLK   32 (45)
T ss_pred             ceEecCCCChhcHHHHHHHHH
Confidence            344555999999999999974


No 6  
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=95.88  E-value=0.0053  Score=49.06  Aligned_cols=24  Identities=21%  Similarity=0.383  Sum_probs=20.1

Q ss_pred             CCceeecCCchhhHHHHHHHhhhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDNI  136 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s~  136 (317)
                      ..++...|||.-|..|..+.+++.
T Consensus        45 Cplv~g~C~H~FH~hCI~kWl~~~   68 (85)
T PF12861_consen   45 CPLVWGKCSHNFHMHCILKWLSTQ   68 (85)
T ss_pred             CceeeccCccHHHHHHHHHHHccc
Confidence            356778899999999999998653


No 7  
>KOG1940|consensus
Probab=95.19  E-value=0.014  Score=55.85  Aligned_cols=73  Identities=22%  Similarity=0.498  Sum_probs=49.9

Q ss_pred             CCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEeccCCCCCCCCCCCCccccc
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSIQTTTPTENAE  192 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP~ip~~~~~~~~~~~e~~~  192 (317)
                      ..+.+-.|||.||+.||+.|..                      .+ |.||+|..+.|...                   
T Consensus       173 ~~~~~~~CgH~~h~~cf~e~~~----------------------~~-y~CP~C~~~~d~~~-------------------  210 (276)
T KOG1940|consen  173 EDAGVLKCGHYMHSRCFEEMIC----------------------EG-YTCPICSKPGDMSH-------------------  210 (276)
T ss_pred             ccCCccCcccchHHHHHHHHhc----------------------cC-CCCCcccchHHHHH-------------------
Confidence            5678889999999999999961                      24 99999987444332                   


Q ss_pred             cccccCHHHHHHHHHHHHHH---HHHhhhhccCCcccCCCCCCcccc
Q psy9235         193 VFVHMDFDAWLSIVEMVLEH---KKRLKKSKATSECQDSTSSKQVPQ  236 (317)
Q Consensus       193 ~~~~~~~~~w~~~~~~~~~~---~~~~~~~~~~~~~~~s~~~~~v~~  236 (317)
                               -.+.+.+.|++   --+...+++-..|+||.....++.
T Consensus       211 ---------~~~~~d~~l~~~~~p~~y~~~~~~i~cndC~~~~~~k~  248 (276)
T KOG1940|consen  211 ---------YFRKLDKELAGSPMPEEYKNKTQDILCNDCGSGTNVKY  248 (276)
T ss_pred             ---------HHHHHHHHHhcCCCCchhhchhheeeccCCCCCCccce
Confidence                     22334444443   122355777888999888777653


No 8  
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=94.88  E-value=0.015  Score=39.08  Aligned_cols=22  Identities=27%  Similarity=0.726  Sum_probs=19.0

Q ss_pred             CceeecCCchhhHHHHHHHhhh
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      ..++..|||....+|+++|++.
T Consensus        11 ~~~~~~CGH~fC~~C~~~~~~~   32 (39)
T PF13923_consen   11 PVVVTPCGHSFCKECIEKYLEK   32 (39)
T ss_dssp             EEEECTTSEEEEHHHHHHHHHC
T ss_pred             cCEECCCCCchhHHHHHHHHHC
Confidence            3478999999999999999843


No 9  
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=94.85  E-value=0.026  Score=35.78  Aligned_cols=22  Identities=27%  Similarity=0.723  Sum_probs=19.0

Q ss_pred             CCceeecCCchhhHHHHHHHhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      ..+.+..|||..|..|++.|++
T Consensus         9 ~~~~~~~C~H~~c~~C~~~~~~   30 (39)
T smart00184        9 KDPVVLPCGHTFCRSCIRKWLK   30 (39)
T ss_pred             CCcEEecCCChHHHHHHHHHHH
Confidence            4567778999999999999985


No 10 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=94.81  E-value=0.021  Score=56.80  Aligned_cols=17  Identities=29%  Similarity=1.021  Sum_probs=15.4

Q ss_pred             ecCCchhhHHHHHHHhh
Q psy9235         118 STCGHVMHSTCWSKYFD  134 (317)
Q Consensus       118 ssCGH~mH~~C~~~Y~~  134 (317)
                      -.|||..|.+|++.+++
T Consensus       316 LpCGHilHl~CLknW~E  332 (491)
T COG5243         316 LPCGHILHLHCLKNWLE  332 (491)
T ss_pred             ccccceeeHHHHHHHHH
Confidence            36999999999999985


No 11 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=94.58  E-value=0.018  Score=44.25  Aligned_cols=21  Identities=29%  Similarity=0.705  Sum_probs=17.2

Q ss_pred             CceeecCCchhhHHHHHHHhh
Q psy9235         114 APHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      .+....|||.-|..|..+.++
T Consensus        44 ~i~~~~C~H~FH~~Ci~~Wl~   64 (73)
T PF12678_consen   44 PIVWGPCGHIFHFHCISQWLK   64 (73)
T ss_dssp             -EEEETTSEEEEHHHHHHHHT
T ss_pred             ceEecccCCCEEHHHHHHHHh
Confidence            346678999999999999983


No 12 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=94.47  E-value=0.022  Score=38.25  Aligned_cols=20  Identities=30%  Similarity=0.735  Sum_probs=18.3

Q ss_pred             eeecCCchhhHHHHHHHhhh
Q psy9235         116 HTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~~s  135 (317)
                      .+..|||..+..|+.+|+++
T Consensus        13 ~~~~C~H~fC~~C~~~~~~~   32 (41)
T PF00097_consen   13 ILLPCGHSFCRDCLRKWLEN   32 (41)
T ss_dssp             EETTTSEEEEHHHHHHHHHH
T ss_pred             EEecCCCcchHHHHHHHHHh
Confidence            58999999999999999864


No 13 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=93.77  E-value=0.074  Score=48.57  Aligned_cols=55  Identities=24%  Similarity=0.533  Sum_probs=35.7

Q ss_pred             ceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcccc--ceEeccC
Q psy9235         115 PHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLS--NAALPLI  176 (317)
Q Consensus       115 ~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLs--N~vLP~i  176 (317)
                      +++..|||.-...|+.+|+....... .+.   +.   .+...+...||+||+.-  +.++|++
T Consensus        31 PVvT~CGH~FC~~CI~~wl~~s~~s~-~~~---~~---~~~~k~~~~CPvCR~~Is~~~LvPiy   87 (193)
T PLN03208         31 PVVTLCGHLFCWPCIHKWTYASNNSR-QRV---DQ---YDHKREPPKCPVCKSDVSEATLVPIY   87 (193)
T ss_pred             cEEcCCCchhHHHHHHHHHHhccccc-ccc---cc---ccccCCCCcCCCCCCcCChhcEEEee
Confidence            46678999999999999975432110 000   00   01135678999999865  4588886


No 14 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=93.55  E-value=0.073  Score=36.75  Aligned_cols=21  Identities=29%  Similarity=0.746  Sum_probs=18.9

Q ss_pred             CCceeecCCchhhHHHHHHHh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      ....+.+|||.+..+|+++..
T Consensus        13 ~~~~l~~CgH~~C~~C~~~~~   33 (44)
T PF14634_consen   13 RRPRLTSCGHIFCEKCLKKLK   33 (44)
T ss_pred             CCeEEcccCCHHHHHHHHhhc
Confidence            468999999999999999886


No 15 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=92.76  E-value=0.042  Score=42.06  Aligned_cols=39  Identities=33%  Similarity=0.645  Sum_probs=19.6

Q ss_pred             ecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccc
Q psy9235         118 STCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECL  168 (317)
Q Consensus       118 ssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsL  168 (317)
                      ..||+..|..|+.+|+.+....        |.  .|++-.|  .||.|+..
T Consensus        26 ~~C~~~fH~~CL~~wf~~~~~~--------~~--~~~~~~G--~CP~C~~~   64 (70)
T PF11793_consen   26 PSCGKKFHLLCLSEWFLSLEKS--------RQ--SFIPIFG--ECPYCSSP   64 (70)
T ss_dssp             TT----B-SGGGHHHHHHHHSS--------S---TTT--EE--E-TTT-SE
T ss_pred             cccCCHHHHHHHHHHHHHcccC--------Ce--eeccccc--CCcCCCCe
Confidence            3799999999999999877532        11  1233233  49999863


No 16 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.42  E-value=0.068  Score=44.54  Aligned_cols=26  Identities=27%  Similarity=0.706  Sum_probs=22.7

Q ss_pred             ccccCCCCCCC---CCCCceeeceeCcee
Q psy9235         261 SLFTCPNSDRE---DSRNPALCLICGDML  286 (317)
Q Consensus       261 ~~~~C~~c~~~---~~~~P~lCL~CG~~~  286 (317)
                      .+|.||+||+-   +.++|++|-.||+.+
T Consensus         8 tKR~Cp~CG~kFYDLnk~PivCP~CG~~~   36 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNKDPIVCPKCGTEF   36 (108)
T ss_pred             CcccCCCCcchhccCCCCCccCCCCCCcc
Confidence            68999999975   678999999999865


No 17 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=92.36  E-value=0.07  Score=32.49  Aligned_cols=22  Identities=32%  Similarity=0.705  Sum_probs=19.9

Q ss_pred             cCCCCCCCCCCCceeeceeCce
Q psy9235         264 TCPNSDREDSRNPALCLICGDM  285 (317)
Q Consensus       264 ~C~~c~~~~~~~P~lCL~CG~~  285 (317)
                      +||+||.+++++-..|..||+-
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCCc
Confidence            5999999999999999999974


No 18 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=92.30  E-value=0.15  Score=35.87  Aligned_cols=36  Identities=19%  Similarity=0.526  Sum_probs=28.0

Q ss_pred             CCceeecCCch-hhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccce
Q psy9235         113 PAPHTSTCGHV-MHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNA  171 (317)
Q Consensus       113 ~g~~vssCGH~-mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~  171 (317)
                      ..+.+..|||. +-..|+.++++.                       .-.||+||+--+.
T Consensus        13 ~~~~~~pCgH~~~C~~C~~~~~~~-----------------------~~~CP~Cr~~i~~   49 (50)
T PF13920_consen   13 RDVVLLPCGHLCFCEECAERLLKR-----------------------KKKCPICRQPIES   49 (50)
T ss_dssp             SSEEEETTCEEEEEHHHHHHHHHT-----------------------TSBBTTTTBB-SE
T ss_pred             CceEEeCCCChHHHHHHhHHhccc-----------------------CCCCCcCChhhcC
Confidence            35788899999 999999999851                       1179999986553


No 19 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=91.90  E-value=0.077  Score=33.33  Aligned_cols=24  Identities=29%  Similarity=0.617  Sum_probs=21.2

Q ss_pred             ccCCCCCCCCCCCceeeceeCcee
Q psy9235         263 FTCPNSDREDSRNPALCLICGDML  286 (317)
Q Consensus       263 ~~C~~c~~~~~~~P~lCL~CG~~~  286 (317)
                      ++||.|++++|..-..|-.||-.+
T Consensus         1 K~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    1 KTCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             CcCCCCcCCchhhcCcCCCCCCCC
Confidence            479999999999999999999654


No 20 
>PHA02929 N1R/p28-like protein; Provisional
Probab=91.78  E-value=0.11  Score=48.90  Aligned_cols=36  Identities=22%  Similarity=0.469  Sum_probs=27.7

Q ss_pred             eeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEec
Q psy9235         116 HTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALP  174 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP  174 (317)
                      ++..|||..|..|+..+++..                       =.||+||..--.|++
T Consensus       196 vl~~C~H~FC~~CI~~Wl~~~-----------------------~tCPlCR~~~~~v~~  231 (238)
T PHA02929        196 ILSNCNHVFCIECIDIWKKEK-----------------------NTCPVCRTPFISVIK  231 (238)
T ss_pred             ecCCCCCcccHHHHHHHHhcC-----------------------CCCCCCCCEeeEEee
Confidence            566899999999999986311                       169999987666665


No 21 
>PHA02926 zinc finger-like protein; Provisional
Probab=90.37  E-value=0.22  Score=46.56  Aligned_cols=45  Identities=16%  Similarity=0.282  Sum_probs=34.8

Q ss_pred             CceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEecc
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPL  175 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP~  175 (317)
                      ..++..|||.-...|..+..++...                 ...+-.||+||.-...++|-
T Consensus       191 FGIL~~CnHsFCl~CIr~Wr~~r~~-----------------~~~~rsCPiCR~~f~~I~pS  235 (242)
T PHA02926        191 FGLLDSCNHIFCITCINIWHRTRRE-----------------TGASDNCPICRTRFRNITMS  235 (242)
T ss_pred             ccccCCCCchHHHHHHHHHHHhccc-----------------cCcCCcCCCCcceeeeeccc
Confidence            3478899999999999999754210                 12356899999999988874


No 22 
>KOG4445|consensus
Probab=90.28  E-value=0.054  Score=52.52  Aligned_cols=51  Identities=29%  Similarity=0.603  Sum_probs=33.4

Q ss_pred             CceeecCCchhhHHHHHHHhhhhhhhccCC---ccccCCCCccCCCCCeeeccCCcc
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDNILAKENRR---PYRLRQPTSFDIEKNEFLCPLCEC  167 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr---~q~~R~~~~~d~~~~EFlCPLCrs  167 (317)
                      ...++-|-|+||+.||.+|+......-+.-   .+.-|.|.-   +.-+-+||.||-
T Consensus       130 ~ft~T~C~Hy~H~~ClaRyl~~~~~~lrqe~q~~~~~~qh~~---~~~eavcpVcre  183 (368)
T KOG4445|consen  130 AFTVTACDHYMHFACLARYLTECLTGLRQEIQDAQKERQHMK---EQVEAVCPVCRE  183 (368)
T ss_pred             ceeeehhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh---hhHhhhhhHhhh
Confidence            467889999999999999998764322110   112233332   345667999985


No 23 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=89.67  E-value=0.18  Score=31.35  Aligned_cols=24  Identities=29%  Similarity=0.631  Sum_probs=21.0

Q ss_pred             cccCCCCCCCCCCCceeeceeCce
Q psy9235         262 LFTCPNSDREDSRNPALCLICGDM  285 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P~lCL~CG~~  285 (317)
                      .+.||+||..++.+-..|-.||+-
T Consensus         2 ~~~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             cCCCcccCCcCCcccccChhhCCC
Confidence            467999999988899999999974


No 24 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.45  E-value=0.25  Score=42.35  Aligned_cols=26  Identities=27%  Similarity=0.535  Sum_probs=22.7

Q ss_pred             ccccCCCCCCC---CCCCceeeceeCcee
Q psy9235         261 SLFTCPNSDRE---DSRNPALCLICGDML  286 (317)
Q Consensus       261 ~~~~C~~c~~~---~~~~P~lCL~CG~~~  286 (317)
                      .+|.||+||+-   +.++|++|-.||+.+
T Consensus         8 tKr~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         8 TKRICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             ccccCCCcCccccccCCCCccCCCcCCcc
Confidence            68999999975   568999999999874


No 25 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=88.38  E-value=0.2  Score=37.56  Aligned_cols=30  Identities=27%  Similarity=0.678  Sum_probs=25.5

Q ss_pred             hhccccCCCCCCCC-----CCCceeeceeCceecC
Q psy9235         259 TVSLFTCPNSDRED-----SRNPALCLICGDMLCS  288 (317)
Q Consensus       259 ~~~~~~C~~c~~~~-----~~~P~lCL~CG~~~C~  288 (317)
                      ++.+.+||.|+.+-     +..++.|+.||+.++-
T Consensus         8 ~F~~VkCp~C~n~q~vFsha~t~V~C~~Cg~~L~~   42 (59)
T PRK00415          8 RFLKVKCPDCGNEQVVFSHASTVVRCLVCGKTLAE   42 (59)
T ss_pred             eEEEEECCCCCCeEEEEecCCcEEECcccCCCccc
Confidence            36788999999874     5689999999999975


No 26 
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=87.64  E-value=0.27  Score=36.31  Aligned_cols=30  Identities=20%  Similarity=0.533  Sum_probs=20.1

Q ss_pred             hhccccCCCCCCC-----CCCCceeeceeCceecC
Q psy9235         259 TVSLFTCPNSDRE-----DSRNPALCLICGDMLCS  288 (317)
Q Consensus       259 ~~~~~~C~~c~~~-----~~~~P~lCL~CG~~~C~  288 (317)
                      ++.+.+||.|+.+     -+..++.|+.||.++|-
T Consensus         4 ~Fm~VkCp~C~~~q~vFSha~t~V~C~~Cg~~L~~   38 (55)
T PF01667_consen    4 YFMDVKCPGCYNIQTVFSHAQTVVKCVVCGTVLAQ   38 (55)
T ss_dssp             -EEEEE-TTT-SEEEEETT-SS-EE-SSSTSEEEE
T ss_pred             cEEEEECCCCCCeeEEEecCCeEEEcccCCCEecC
Confidence            3678899999976     13579999999999985


No 27 
>PF13764 E3_UbLigase_R4:  E3 ubiquitin-protein ligase UBR4
Probab=87.59  E-value=0.86  Score=49.81  Aligned_cols=66  Identities=15%  Similarity=0.232  Sum_probs=46.4

Q ss_pred             CCCccceeecCCCcccccCCCcEEEEEeeecCcccccccCCCCCCCcccccccCCCCCCCCceeecCCchhhHHHHHHHh
Q psy9235          54 GPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus        54 ~~~~~tCILCqE~~~~~~~~~p~g~~a~vQ~S~Vl~~~~~~~~~~~~D~~l~~~~~~~~~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      ++.-.+|.+|+|.-.. ..++++|+-+|.-+.++-.....              . ....|.-+.|=..++|++|.++-.
T Consensus       465 ee~gl~C~ICrEGy~~-~p~~~lGiY~f~kr~~l~~~~~~--------------~-~~~~~~sTVs~fn~iH~~CH~~A~  528 (802)
T PF13764_consen  465 EEDGLTCCICREGYKF-RPDEVLGIYAFSKRVNLEEFEGK--------------S-RKTYGYSTVSHFNIIHFSCHQSAV  528 (802)
T ss_pred             ccCCCeEEEcCCcccc-CCccceeeEEEeecccchhhccC--------------C-CCCcceeeeeeeeeeeHHhhHHHH
Confidence            4556799999998754 35788999999987766431100              0 122466666777899999999887


Q ss_pred             hh
Q psy9235         134 DN  135 (317)
Q Consensus       134 ~s  135 (317)
                      ++
T Consensus       529 ra  530 (802)
T PF13764_consen  529 RA  530 (802)
T ss_pred             Hh
Confidence            64


No 28 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=87.45  E-value=0.31  Score=37.29  Aligned_cols=31  Identities=29%  Similarity=0.662  Sum_probs=25.0

Q ss_pred             hhccccCCCCCCC-----CCCCceeeceeCceecCC
Q psy9235         259 TVSLFTCPNSDRE-----DSRNPALCLICGDMLCSQ  289 (317)
Q Consensus       259 ~~~~~~C~~c~~~-----~~~~P~lCL~CG~~~C~~  289 (317)
                      ++.+.+||.|+.+     -+...+.|+.||++++-.
T Consensus        16 ~Fl~VkCpdC~N~q~vFshast~V~C~~CG~~l~~P   51 (67)
T COG2051          16 RFLRVKCPDCGNEQVVFSHASTVVTCLICGTTLAEP   51 (67)
T ss_pred             eEEEEECCCCCCEEEEeccCceEEEecccccEEEec
Confidence            4678899999976     245789999999999863


No 29 
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=85.57  E-value=0.39  Score=38.39  Aligned_cols=30  Identities=23%  Similarity=0.542  Sum_probs=24.9

Q ss_pred             hccccCCCCCCCC-----CCCceeeceeCceecCC
Q psy9235         260 VSLFTCPNSDRED-----SRNPALCLICGDMLCSQ  289 (317)
Q Consensus       260 ~~~~~C~~c~~~~-----~~~P~lCL~CG~~~C~~  289 (317)
                      +...+||.|+.+-     ...++.|+.||.++|--
T Consensus        33 Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~P   67 (85)
T PTZ00083         33 FMDVKCPGCSQITTVFSHAQTVVLCGGCSSQLCQP   67 (85)
T ss_pred             EEEEECCCCCCeeEEEecCceEEEccccCCEeecc
Confidence            6889999999871     24799999999999863


No 30 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=85.30  E-value=0.65  Score=31.96  Aligned_cols=24  Identities=21%  Similarity=0.555  Sum_probs=19.1

Q ss_pred             CCCCceeecCCchhhHHHHHHHhh
Q psy9235         111 QGPAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       111 ~~~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      ....+++-.|||..=.+|+.++.+
T Consensus         7 ~~~~Pv~l~CGH~FC~~Cl~~~~~   30 (42)
T PF15227_consen    7 LFKDPVSLPCGHSFCRSCLERLWK   30 (42)
T ss_dssp             B-SSEEE-SSSSEEEHHHHHHHHC
T ss_pred             hhCCccccCCcCHHHHHHHHHHHH
Confidence            345678899999999999999974


No 31 
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]
Probab=84.89  E-value=0.72  Score=36.71  Aligned_cols=23  Identities=22%  Similarity=0.550  Sum_probs=20.0

Q ss_pred             CCceeecCCchhhHHHHHHHhhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      .-++...|.|.-|..|..+++++
T Consensus        47 C~v~wG~CnHaFH~HCI~rWL~T   69 (88)
T COG5194          47 CPVVWGVCNHAFHDHCIYRWLDT   69 (88)
T ss_pred             ceEEEEecchHHHHHHHHHHHhh
Confidence            45677889999999999999865


No 32 
>KOG2930|consensus
Probab=81.84  E-value=1.2  Score=37.14  Aligned_cols=22  Identities=23%  Similarity=0.593  Sum_probs=18.2

Q ss_pred             CceeecCCchhhHHHHHHHhhh
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      -+.=..|.|.-|+.|..+++++
T Consensus        75 ~VaWG~CNHaFH~hCisrWlkt   96 (114)
T KOG2930|consen   75 TVAWGVCNHAFHFHCISRWLKT   96 (114)
T ss_pred             EEEeeecchHHHHHHHHHHHhh
Confidence            3455679999999999999854


No 33 
>PLN00209 ribosomal protein S27; Provisional
Probab=81.27  E-value=0.75  Score=36.88  Aligned_cols=31  Identities=19%  Similarity=0.375  Sum_probs=25.3

Q ss_pred             hhccccCCCCCCCC-----CCCceeeceeCceecCC
Q psy9235         259 TVSLFTCPNSDRED-----SRNPALCLICGDMLCSQ  289 (317)
Q Consensus       259 ~~~~~~C~~c~~~~-----~~~P~lCL~CG~~~C~~  289 (317)
                      ++...+||.|+.+-     +..++.|+.||.++|--
T Consensus        33 ~Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~P   68 (86)
T PLN00209         33 FFMDVKCQGCFNITTVFSHSQTVVVCGSCQTVLCQP   68 (86)
T ss_pred             EEEEEECCCCCCeeEEEecCceEEEccccCCEeecc
Confidence            36889999999871     34799999999999863


No 34 
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=80.06  E-value=1.3  Score=43.22  Aligned_cols=23  Identities=30%  Similarity=0.639  Sum_probs=20.0

Q ss_pred             CCCCceeecCCchhhHHHHHHHh
Q psy9235         111 QGPAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       111 ~~~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      ...-+..++|||.--+=|.++|+
T Consensus        34 ~i~ip~~TtCgHtFCslCIR~hL   56 (391)
T COG5432          34 RISIPCETTCGHTFCSLCIRRHL   56 (391)
T ss_pred             eeecceecccccchhHHHHHHHh
Confidence            33567899999999999999998


No 35 
>KOG0823|consensus
Probab=79.48  E-value=1.7  Score=40.75  Aligned_cols=47  Identities=21%  Similarity=0.563  Sum_probs=35.9

Q ss_pred             CCCCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccc--cceEeccC
Q psy9235         110 HQGPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECL--SNAALPLI  176 (317)
Q Consensus       110 ~~~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsL--sN~vLP~i  176 (317)
                      +....++++-|||.-=--|+.+++....+                    -=.||.||+-  ..+|||++
T Consensus        55 d~akdPVvTlCGHLFCWpClyqWl~~~~~--------------------~~~cPVCK~~Vs~~~vvPlY  103 (230)
T KOG0823|consen   55 DLAKDPVVTLCGHLFCWPCLYQWLQTRPN--------------------SKECPVCKAEVSIDTVVPLY  103 (230)
T ss_pred             cccCCCEEeecccceehHHHHHHHhhcCC--------------------CeeCCccccccccceEEeee
Confidence            45578999999999988888888744211                    1268999986  57899995


No 36 
>KOG1428|consensus
Probab=78.92  E-value=0.94  Score=52.18  Aligned_cols=104  Identities=21%  Similarity=0.413  Sum_probs=60.8

Q ss_pred             ecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEec--cCCCCCCCCCCCCcccccccc
Q psy9235         118 STCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALP--LIPALSSIQTTTPTENAEVFV  195 (317)
Q Consensus       118 ssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP--~ip~~~~~~~~~~~e~~~~~~  195 (317)
                      -.|||..|+.|-.+-++.-+.-           |  ....+...||+|+.--|-++-  ++.|...+             
T Consensus      3505 L~C~HiFHlqC~R~vLE~RW~G-----------P--RItF~FisCPiC~n~InH~~LkDLldPiKel------------- 3558 (3738)
T KOG1428|consen 3505 LDCSHIFHLQCCRRVLENRWLG-----------P--RITFGFISCPICKNKINHIVLKDLLDPIKEL------------- 3558 (3738)
T ss_pred             cCCccchhHHHHHHHHHhcccC-----------C--eeEEeeeecccccchhhhHHHHHHHHHHHHH-------------
Confidence            3699999999999998765421           1  124678899999986665431  11111111             


Q ss_pred             ccCHHHHHHHHHHHHHHHHHhhhhccCCcccCCCCCCcccccCCccccccccCCChhHHHHHHhhccccCCCCCC
Q psy9235         196 HMDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQDRKPLEINRLINLPDDYSELINTVSLFTCPNSDR  270 (317)
Q Consensus       196 ~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~v~~~~~p~~~~~l~~LP~~y~~L~~~~~~~~C~~c~~  270 (317)
                         +++-.+...|++|+. ++   .+            -|.+++|..  ++.+=|..|.  +++|....|-+|.+
T Consensus      3559 ---~edV~~KA~MRLEYe-GL---~k------------s~AiT~P~~--~FYNdPa~YA--mnRY~Y~vC~KCrK 3610 (3738)
T KOG1428|consen 3559 ---YEDVRRKALMRLEYE-GL---HK------------SEAITTPGV--RFYNDPAGYA--MNRYAYYVCYKCRK 3610 (3738)
T ss_pred             ---HHHHHHHHhhhhhhc-cc---cc------------cccccCCCc--eeccChhhhh--hhhhhhhhhhhhhh
Confidence               223333444455541 11   11            234454554  4566777775  78888888877754


No 37 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=78.12  E-value=1.4  Score=32.75  Aligned_cols=25  Identities=32%  Similarity=0.681  Sum_probs=18.7

Q ss_pred             CCCCCCCCCCCceeeceeCceecCCC
Q psy9235         265 CPNSDREDSRNPALCLICGDMLCSQS  290 (317)
Q Consensus       265 C~~c~~~~~~~P~lCL~CG~~~C~~~  290 (317)
                      |..|+.. .++.-+||.||.+.|...
T Consensus         1 C~~C~~~-~~~lw~CL~Cg~~~C~~~   25 (63)
T PF02148_consen    1 CSVCGST-NSNLWLCLTCGYVGCGRY   25 (63)
T ss_dssp             -SSSHTC-SSSEEEETTTS-EEETTT
T ss_pred             CCCCCCc-CCceEEeCCCCcccccCC
Confidence            5667765 568999999999999953


No 38 
>KOG0802|consensus
Probab=77.26  E-value=1.3  Score=46.05  Aligned_cols=19  Identities=32%  Similarity=1.041  Sum_probs=16.3

Q ss_pred             eecCCchhhHHHHHHHhhh
Q psy9235         117 TSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       117 vssCGH~mH~~C~~~Y~~s  135 (317)
                      .-.|||.-|..|++++++-
T Consensus       311 rL~C~Hifh~~CL~~W~er  329 (543)
T KOG0802|consen  311 RLPCGHIFHDSCLRSWFER  329 (543)
T ss_pred             eeecccchHHHHHHHHHHH
Confidence            3469999999999999953


No 39 
>KOG0827|consensus
Probab=76.84  E-value=1.4  Score=44.32  Aligned_cols=20  Identities=40%  Similarity=1.132  Sum_probs=17.5

Q ss_pred             eeecCCchhhHHHHHHHhhh
Q psy9235         116 HTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~~s  135 (317)
                      -+++|||+.|..|+..+++.
T Consensus        22 ~i~~cGhifh~~cl~qwfe~   41 (465)
T KOG0827|consen   22 PIGTCGHIFHTTCLTQWFEG   41 (465)
T ss_pred             cccchhhHHHHHHHHHHHcc
Confidence            36789999999999999954


No 40 
>KOG1493|consensus
Probab=71.86  E-value=1.9  Score=34.04  Aligned_cols=34  Identities=24%  Similarity=0.545  Sum_probs=26.3

Q ss_pred             CceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcc
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCEC  167 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrs  167 (317)
                      -++..-|-|..|..|..+.+.+..                    +.=+||+||+
T Consensus        45 PLv~G~C~h~fh~hCI~~wl~~~t--------------------sq~~CPmcRq   78 (84)
T KOG1493|consen   45 PLVWGYCLHAFHAHCILKWLNTPT--------------------SQGQCPMCRQ   78 (84)
T ss_pred             ccHHHHHHHHHHHHHHHHHhcCcc--------------------ccccCCcchh
Confidence            346678999999999999985432                    1248999996


No 41 
>KOG4172|consensus
Probab=69.58  E-value=2.1  Score=31.86  Aligned_cols=21  Identities=29%  Similarity=0.442  Sum_probs=15.9

Q ss_pred             CCceeecCCch-hhHHHHHHHh
Q psy9235         113 PAPHTSTCGHV-MHSTCWSKYF  133 (317)
Q Consensus       113 ~g~~vssCGH~-mH~~C~~~Y~  133 (317)
                      ...++-+|||. |-|.|--+..
T Consensus        18 vdsVlYtCGHMCmCy~Cg~rl~   39 (62)
T KOG4172|consen   18 VDSVLYTCGHMCMCYACGLRLK   39 (62)
T ss_pred             chHHHHHcchHHhHHHHHHHHH
Confidence            46678899996 7788876664


No 42 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=69.16  E-value=5.8  Score=28.19  Aligned_cols=22  Identities=23%  Similarity=0.694  Sum_probs=16.6

Q ss_pred             ceeecCC-----chhhHHHHHHHhhhh
Q psy9235         115 PHTSTCG-----HVMHSTCWSKYFDNI  136 (317)
Q Consensus       115 ~~vssCG-----H~mH~~C~~~Y~~s~  136 (317)
                      +.+.-|.     |++|.+|+++++...
T Consensus        14 ~l~~PC~C~G~~~~vH~~Cl~~W~~~~   40 (49)
T smart00744       14 PLVSPCRCKGSLKYVHQECLERWINES   40 (49)
T ss_pred             eeEeccccCCchhHHHHHHHHHHHHHc
Confidence            3455564     999999999998543


No 43 
>PRK02935 hypothetical protein; Provisional
Probab=68.39  E-value=2.2  Score=35.56  Aligned_cols=30  Identities=17%  Similarity=0.531  Sum_probs=23.6

Q ss_pred             HhhccccCCCCCCCCCC---CceeeceeCceecC
Q psy9235         258 NTVSLFTCPNSDREDSR---NPALCLICGDMLCS  288 (317)
Q Consensus       258 ~~~~~~~C~~c~~~~~~---~P~lCL~CG~~~C~  288 (317)
                      .++.+..||+|+++ .+   .--+|..|++.+=.
T Consensus        66 tkavqV~CP~C~K~-TKmLGrvD~CM~C~~PLTL   98 (110)
T PRK02935         66 TKAVQVICPSCEKP-TKMLGRVDACMHCNQPLTL   98 (110)
T ss_pred             ccceeeECCCCCch-hhhccceeecCcCCCcCCc
Confidence            45778899999987 54   46699999997644


No 44 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=67.89  E-value=4.1  Score=29.27  Aligned_cols=22  Identities=14%  Similarity=0.214  Sum_probs=19.1

Q ss_pred             CCceeecCCchhhHHHHHHHhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      ..+++..|||+.-..|+.+|++
T Consensus        12 ~~Pv~~~~G~v~~~~~i~~~~~   33 (63)
T smart00504       12 KDPVILPSGQTYERRAIEKWLL   33 (63)
T ss_pred             CCCEECCCCCEEeHHHHHHHHH
Confidence            3468889999999999999984


No 45 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=67.52  E-value=3.5  Score=28.62  Aligned_cols=17  Identities=35%  Similarity=1.005  Sum_probs=11.3

Q ss_pred             cCCchhhHHHHHHHhhh
Q psy9235         119 TCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       119 sCGH~mH~~C~~~Y~~s  135 (317)
                      .|+=-||..|+++|+..
T Consensus        18 ~C~~r~H~~C~~~y~r~   34 (43)
T PF08746_consen   18 DCNVRLHDDCFKKYFRH   34 (43)
T ss_dssp             -S--EE-HHHHHHHTTT
T ss_pred             ccCchHHHHHHHHHHhc
Confidence            57778999999999843


No 46 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=65.02  E-value=1.7  Score=34.42  Aligned_cols=15  Identities=40%  Similarity=0.988  Sum_probs=11.8

Q ss_pred             eecCCchhhHHHHHH
Q psy9235         117 TSTCGHVMHSTCWSK  131 (317)
Q Consensus       117 vssCGH~mH~~C~~~  131 (317)
                      +--|||++|+.|.++
T Consensus        95 ~~p~~~v~H~~C~~r  109 (109)
T PF10367_consen   95 VFPCGHVVHYSCIKR  109 (109)
T ss_pred             EeCCCeEEecccccC
Confidence            345899999999864


No 47 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=64.88  E-value=3.9  Score=41.38  Aligned_cols=18  Identities=22%  Similarity=0.602  Sum_probs=16.0

Q ss_pred             eeecCCchhhHHHHHHHh
Q psy9235         116 HTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~  133 (317)
                      ++..|||.-...|+..|+
T Consensus        40 vitpCgH~FCs~CI~~~l   57 (397)
T TIGR00599        40 VLTSCSHTFCSLCIRRCL   57 (397)
T ss_pred             cCCCCCCchhHHHHHHHH
Confidence            356899999999999997


No 48 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=63.08  E-value=5.7  Score=27.57  Aligned_cols=24  Identities=33%  Similarity=0.742  Sum_probs=19.2

Q ss_pred             cCCCCCCCCCCCceeeceeCceecCC
Q psy9235         264 TCPNSDREDSRNPALCLICGDMLCSQ  289 (317)
Q Consensus       264 ~C~~c~~~~~~~P~lCL~CG~~~C~~  289 (317)
                      +|..|+.. . +--+||.||.+.|..
T Consensus         1 ~C~~C~~~-~-~l~~CL~C~~~~c~~   24 (50)
T smart00290        1 RCSVCGTI-E-NLWLCLTCGQVGCGR   24 (50)
T ss_pred             CcccCCCc-C-CeEEecCCCCcccCC
Confidence            58899976 3 578999999888754


No 49 
>KOG1941|consensus
Probab=62.87  E-value=3.1  Score=42.02  Aligned_cols=22  Identities=18%  Similarity=0.590  Sum_probs=18.7

Q ss_pred             CCceeecCCchhhHHHHHHHhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      .....--|.|+.|..|.+.|++
T Consensus       380 e~LqALpCsHIfH~rCl~e~L~  401 (518)
T KOG1941|consen  380 ERLQALPCSHIFHLRCLQEILE  401 (518)
T ss_pred             ccccccchhHHHHHHHHHHHHH
Confidence            4566778999999999999983


No 50 
>KOG4628|consensus
Probab=62.32  E-value=4.7  Score=40.09  Aligned_cols=34  Identities=26%  Similarity=0.768  Sum_probs=27.6

Q ss_pred             CCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcc
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCEC  167 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrs  167 (317)
                      +..+.+=.|+|.-|..|...++-..           |.           .||+||+
T Consensus       242 GdklRiLPC~H~FH~~CIDpWL~~~-----------r~-----------~CPvCK~  275 (348)
T KOG4628|consen  242 GDKLRILPCSHKFHVNCIDPWLTQT-----------RT-----------FCPVCKR  275 (348)
T ss_pred             CCeeeEecCCCchhhccchhhHhhc-----------Cc-----------cCCCCCC
Confidence            3567788999999999999998332           32           7999999


No 51 
>PF12773 DZR:  Double zinc ribbon
Probab=62.27  E-value=3.8  Score=28.56  Aligned_cols=24  Identities=21%  Similarity=0.499  Sum_probs=13.3

Q ss_pred             cccCCCCCCCCC---CCceeeceeCce
Q psy9235         262 LFTCPNSDREDS---RNPALCLICGDM  285 (317)
Q Consensus       262 ~~~C~~c~~~~~---~~P~lCL~CG~~  285 (317)
                      ...|++||..++   ....+|-.||+.
T Consensus        12 ~~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   12 AKFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             ccCChhhcCChhhccCCCCCCcCCcCC
Confidence            344666666544   234566666664


No 52 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=60.42  E-value=5.4  Score=27.31  Aligned_cols=24  Identities=33%  Similarity=0.836  Sum_probs=16.0

Q ss_pred             ccCCCCCCCC----C-CCceeeceeCcee
Q psy9235         263 FTCPNSDRED----S-RNPALCLICGDML  286 (317)
Q Consensus       263 ~~C~~c~~~~----~-~~P~lCL~CG~~~  286 (317)
                      ++||+||...    + +--.+|-.||.++
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-BBE
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCCEe
Confidence            4799999751    1 2356899998875


No 53 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=60.13  E-value=3  Score=31.00  Aligned_cols=15  Identities=40%  Similarity=1.048  Sum_probs=12.8

Q ss_pred             CceeeceeCceecCC
Q psy9235         275 NPALCLICGDMLCSQ  289 (317)
Q Consensus       275 ~P~lCL~CG~~~C~~  289 (317)
                      ....||.||+|+|.+
T Consensus        17 ~~~NCl~CGkIiC~~   31 (57)
T PF06221_consen   17 YAPNCLNCGKIICEQ   31 (57)
T ss_pred             ccccccccChhhccc
Confidence            356899999999985


No 54 
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=58.46  E-value=2.8  Score=31.57  Aligned_cols=36  Identities=25%  Similarity=0.293  Sum_probs=12.7

Q ss_pred             cCHHHHHHHHHHHHHHHHHhhhhccCCcccCCCCCCcccc
Q psy9235         197 MDFDAWLSIVEMVLEHKKRLKKSKATSECQDSTSSKQVPQ  236 (317)
Q Consensus       197 ~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~v~~  236 (317)
                      ..||+.|....|.-++    ..++..+.||||+.++.|+.
T Consensus         9 ~~LD~~i~~~pmP~~Y----~~~~v~IlCNDC~~~s~v~f   44 (61)
T PF14599_consen    9 RMLDAEIAATPMPEEY----RNKKVWILCNDCNAKSEVPF   44 (61)
T ss_dssp             -----------------------EEEEEESSS--EEEEE-
T ss_pred             HHHHHHHHhCCCCHHH----hCCEEEEECCCCCCccceee
Confidence            4567777777777776    45688999999999998874


No 55 
>KOG0828|consensus
Probab=58.39  E-value=5.4  Score=41.49  Aligned_cols=22  Identities=23%  Similarity=0.656  Sum_probs=18.9

Q ss_pred             CceeecCCchhhHHHHHHHhhh
Q psy9235         114 APHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      ...++-|.|++|..|+++.++.
T Consensus       600 nYm~tPC~HifH~~CL~~WMd~  621 (636)
T KOG0828|consen  600 NYMLTPCHHIFHRQCLLQWMDT  621 (636)
T ss_pred             cccccchHHHHHHHHHHHHHhh
Confidence            4567789999999999999964


No 56 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=58.14  E-value=6.8  Score=38.40  Aligned_cols=18  Identities=28%  Similarity=0.763  Sum_probs=15.5

Q ss_pred             eeecCCchhhHHHHHHHh
Q psy9235         116 HTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~  133 (317)
                      .++.|||.|=-+|..+.+
T Consensus        22 ~i~~CGH~~C~sCv~~l~   39 (309)
T TIGR00570        22 MVNVCGHTLCESCVDLLF   39 (309)
T ss_pred             ccCCCCCcccHHHHHHHh
Confidence            344799999999999987


No 57 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=57.12  E-value=3.6  Score=34.64  Aligned_cols=30  Identities=20%  Similarity=0.567  Sum_probs=22.0

Q ss_pred             HhhccccCCCCCCCCCC---CceeeceeCceecC
Q psy9235         258 NTVSLFTCPNSDREDSR---NPALCLICGDMLCS  288 (317)
Q Consensus       258 ~~~~~~~C~~c~~~~~~---~P~lCL~CG~~~C~  288 (317)
                      .++...+||+|+++ ++   .--.|..||+.+=.
T Consensus        65 tkav~V~CP~C~K~-TKmLGr~D~CM~C~~pLTL   97 (114)
T PF11023_consen   65 TKAVQVECPNCGKQ-TKMLGRVDACMHCKEPLTL   97 (114)
T ss_pred             ccceeeECCCCCCh-HhhhchhhccCcCCCcCcc
Confidence            34677789999987 42   33599999987643


No 58 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=55.64  E-value=5.1  Score=30.15  Aligned_cols=26  Identities=42%  Similarity=0.773  Sum_probs=17.1

Q ss_pred             HhhccccCCCCCCC-CCC--------CceeeceeC
Q psy9235         258 NTVSLFTCPNSDRE-DSR--------NPALCLICG  283 (317)
Q Consensus       258 ~~~~~~~C~~c~~~-~~~--------~P~lCL~CG  283 (317)
                      +.|..+.||+||++ +-|        .|-.|--||
T Consensus        23 e~~v~F~CPnCGe~~I~Rc~~CRk~g~~Y~Cp~CG   57 (61)
T COG2888          23 ETAVKFPCPNCGEVEIYRCAKCRKLGNPYRCPKCG   57 (61)
T ss_pred             CceeEeeCCCCCceeeehhhhHHHcCCceECCCcC
Confidence            56788888888854 221        566666666


No 59 
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=55.19  E-value=11  Score=33.73  Aligned_cols=53  Identities=19%  Similarity=0.291  Sum_probs=28.8

Q ss_pred             hhhHHHHHHHhhhhhhhccCCcccc----CCC----CccCCCCCeeeccCCccccceEecc
Q psy9235         123 VMHSTCWSKYFDNILAKENRRPYRL----RQP----TSFDIEKNEFLCPLCECLSNAALPL  175 (317)
Q Consensus       123 ~mH~~C~~~Y~~s~~~~e~rr~q~~----R~~----~~~d~~~~EFlCPLCrsLsN~vLP~  175 (317)
                      +-|.+|+..|-++-........+..    +..    ..-.....+-.|||||.--.--..+
T Consensus        36 ~rhSNCLdqfkka~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~CPLCRG~V~GWtvv   96 (162)
T PF07800_consen   36 YRHSNCLDQFKKAYGKSSSSSSQSSSSAPSDSSSSESSESQEQPELACPLCRGEVKGWTVV   96 (162)
T ss_pred             cchhHHHHHHHHHhcCCCCccccccccCcCCCcccccccccccccccCccccCceeceEEc
Confidence            3589999999777543221111100    000    0012355689999999865544444


No 60 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=55.12  E-value=3.6  Score=27.68  Aligned_cols=24  Identities=25%  Similarity=0.542  Sum_probs=17.9

Q ss_pred             cccCCCCCCC------CCCCceeeceeCce
Q psy9235         262 LFTCPNSDRE------DSRNPALCLICGDM  285 (317)
Q Consensus       262 ~~~C~~c~~~------~~~~P~lCL~CG~~  285 (317)
                      ++.|++||++      -|+.+.+|-.||.-
T Consensus         1 Rr~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~   30 (36)
T PF05191_consen    1 RRICPKCGRIYHIEFNPPKVEGVCDNCGGE   30 (36)
T ss_dssp             EEEETTTTEEEETTTB--SSTTBCTTTTEB
T ss_pred             CcCcCCCCCccccccCCCCCCCccCCCCCe
Confidence            4679999965      26788999999974


No 61 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=54.34  E-value=5.5  Score=29.87  Aligned_cols=13  Identities=31%  Similarity=0.626  Sum_probs=9.3

Q ss_pred             hhccccCCCCCCC
Q psy9235         259 TVSLFTCPNSDRE  271 (317)
Q Consensus       259 ~~~~~~C~~c~~~  271 (317)
                      .+.++.||+||++
T Consensus        22 ~~~~F~CPnCG~~   34 (59)
T PRK14890         22 KAVKFLCPNCGEV   34 (59)
T ss_pred             ccCEeeCCCCCCe
Confidence            3677777777776


No 62 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=52.76  E-value=10  Score=26.34  Aligned_cols=21  Identities=33%  Similarity=0.713  Sum_probs=16.0

Q ss_pred             ceeecCCchhhHHHHHHHhhh
Q psy9235         115 PHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       115 ~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      +.+-.|||++=.+|.++..+.
T Consensus        14 P~~L~CGH~~c~~cl~~l~~~   34 (43)
T PF13445_consen   14 PMVLPCGHVFCKDCLQKLSKK   34 (43)
T ss_dssp             EEE-SSS-EEEHHHHHHHHHH
T ss_pred             CEEEeCccHHHHHHHHHHHhc
Confidence            556669999999999999864


No 63 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=51.68  E-value=6.3  Score=24.40  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=9.7

Q ss_pred             hhccccCCCCCC
Q psy9235         259 TVSLFTCPNSDR  270 (317)
Q Consensus       259 ~~~~~~C~~c~~  270 (317)
                      ++..+.||+||+
T Consensus        13 ~~v~f~CPnCG~   24 (24)
T PF07754_consen   13 QAVPFPCPNCGF   24 (24)
T ss_pred             cCceEeCCCCCC
Confidence            477889999984


No 64 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=50.32  E-value=12  Score=32.42  Aligned_cols=38  Identities=29%  Similarity=0.698  Sum_probs=27.7

Q ss_pred             ccCCCCCCCCCCCceeeceeCceecCCC----cc--ccccccccccc
Q psy9235         263 FTCPNSDREDSRNPALCLICGDMLCSQS----YC--CQTELFFKMSA  303 (317)
Q Consensus       263 ~~C~~c~~~~~~~P~lCL~CG~~~C~~~----~C--C~~~~~~~~~~  303 (317)
                      -.||.||..  .--++| -||+|+|...    .|  |-.+..++++.
T Consensus        78 PgCP~CGn~--~~fa~C-~CGkl~Ci~g~~~~~CPwCg~~g~~~~~~  121 (131)
T PF15616_consen   78 PGCPHCGNQ--YAFAVC-GCGKLFCIDGEGEVTCPWCGNEGSFGAGD  121 (131)
T ss_pred             CCCCCCcCh--hcEEEe-cCCCEEEeCCCCCEECCCCCCeeeecccC
Confidence            679999997  477999 8999999633    23  55555666654


No 65 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=50.27  E-value=12  Score=25.49  Aligned_cols=25  Identities=20%  Similarity=0.622  Sum_probs=19.8

Q ss_pred             CCCCCCCCCCCceeeceeCceecCC
Q psy9235         265 CPNSDREDSRNPALCLICGDMLCSQ  289 (317)
Q Consensus       265 C~~c~~~~~~~P~lCL~CG~~~C~~  289 (317)
                      |-.|++.+.-.|..|-.||..+|++
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~   25 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGE   25 (39)
T ss_pred             CcccCCcccccCeECCccCCccccc
Confidence            5568877563499999999999984


No 66 
>PF12773 DZR:  Double zinc ribbon
Probab=50.19  E-value=11  Score=26.30  Aligned_cols=25  Identities=36%  Similarity=0.703  Sum_probs=20.9

Q ss_pred             hhccccCCCCCCCCCCCceeeceeC
Q psy9235         259 TVSLFTCPNSDREDSRNPALCLICG  283 (317)
Q Consensus       259 ~~~~~~C~~c~~~~~~~P~lCL~CG  283 (317)
                      ......|++||...+.+-..|..||
T Consensus        26 ~~~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen   26 DQSKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             cCCCCCCcCCcCCCcCCcCccCccc
Confidence            3456789999999888888999888


No 67 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.31  E-value=9.5  Score=32.22  Aligned_cols=26  Identities=15%  Similarity=0.272  Sum_probs=22.2

Q ss_pred             ccccCCCCCCC---CCCCceeeceeCcee
Q psy9235         261 SLFTCPNSDRE---DSRNPALCLICGDML  286 (317)
Q Consensus       261 ~~~~C~~c~~~---~~~~P~lCL~CG~~~  286 (317)
                      .+|.||.||+.   +.|+|++|-.||+-.
T Consensus         8 tKridPetg~KFYDLNrdPiVsPytG~s~   36 (129)
T COG4530           8 TKRIDPETGKKFYDLNRDPIVSPYTGKSY   36 (129)
T ss_pred             ccccCccccchhhccCCCccccCcccccc
Confidence            57889999975   578999999999854


No 68 
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=47.47  E-value=11  Score=42.22  Aligned_cols=24  Identities=29%  Similarity=0.731  Sum_probs=20.0

Q ss_pred             CCceeecCCchhhHHHHHHHhhhh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDNI  136 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s~  136 (317)
                      +..--.||-|--|..|+-+++++.
T Consensus      1487 PskrC~TCknKFH~~CLyKWf~Ss 1510 (1525)
T COG5219        1487 PSKRCATCKNKFHTRCLYKWFASS 1510 (1525)
T ss_pred             CccccchhhhhhhHHHHHHHHHhc
Confidence            455567899999999999999775


No 69 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=44.29  E-value=14  Score=27.26  Aligned_cols=26  Identities=19%  Similarity=0.437  Sum_probs=22.1

Q ss_pred             hccccCCCCCCCC--CCCceeeceeCce
Q psy9235         260 VSLFTCPNSDRED--SRNPALCLICGDM  285 (317)
Q Consensus       260 ~~~~~C~~c~~~~--~~~P~lCL~CG~~  285 (317)
                      |...+|+-||+.+  .+|-++|--||+.
T Consensus         3 ~~~~~C~~Cg~~~~~~dDiVvCp~Cgap   30 (54)
T PF14446_consen    3 YEGCKCPVCGKKFKDGDDIVVCPECGAP   30 (54)
T ss_pred             ccCccChhhCCcccCCCCEEECCCCCCc
Confidence            5678899999987  5688999999985


No 70 
>KOG0309|consensus
Probab=43.22  E-value=12  Score=40.89  Aligned_cols=24  Identities=38%  Similarity=0.890  Sum_probs=19.4

Q ss_pred             CCCceeecCCchhhHHHHHHHhhh
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      +...+-.+|||+||.+|...+++.
T Consensus      1040 gss~~Cg~C~Hv~H~sc~~eWf~~ 1063 (1081)
T KOG0309|consen 1040 GSSNFCGTCGHVGHTSCMMEWFRT 1063 (1081)
T ss_pred             ccchhhccccccccHHHHHHHHhc
Confidence            345566789999999999999843


No 71 
>PF15353 HECA:  Headcase protein family homologue
Probab=43.21  E-value=15  Score=30.62  Aligned_cols=18  Identities=44%  Similarity=0.892  Sum_probs=15.3

Q ss_pred             CCchhhHHHHHHHhhhhh
Q psy9235         120 CGHVMHSTCWSKYFDNIL  137 (317)
Q Consensus       120 CGH~mH~~C~~~Y~~s~~  137 (317)
                      .|++||..||+.+=+++.
T Consensus        40 ~~~~MH~~CF~~wE~~iL   57 (107)
T PF15353_consen   40 FGQYMHRECFEKWEDSIL   57 (107)
T ss_pred             CCCchHHHHHHHHHHHHH
Confidence            399999999999977664


No 72 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=42.92  E-value=9.2  Score=29.06  Aligned_cols=23  Identities=26%  Similarity=0.703  Sum_probs=20.2

Q ss_pred             cccCCCCCCCCCCCceeeceeCc
Q psy9235         262 LFTCPNSDREDSRNPALCLICGD  284 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P~lCL~CG~  284 (317)
                      .+.|.+|+...+.|--+|-+||.
T Consensus         4 ~kAC~~Ck~l~~~d~e~CP~Cgs   26 (64)
T COG2093           4 EKACKNCKRLTPEDTEICPVCGS   26 (64)
T ss_pred             hHHHhhccccCCCCCccCCCCCC
Confidence            45799999998889999999996


No 73 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=42.41  E-value=15  Score=27.13  Aligned_cols=24  Identities=29%  Similarity=0.653  Sum_probs=18.5

Q ss_pred             ccccCCCCCCCCCCCceeeceeCce
Q psy9235         261 SLFTCPNSDREDSRNPALCLICGDM  285 (317)
Q Consensus       261 ~~~~C~~c~~~~~~~P~lCL~CG~~  285 (317)
                      ....||+||.. -.-=-+|+.||..
T Consensus        26 ~l~~C~~CG~~-~~~H~vC~~CG~Y   49 (57)
T PRK12286         26 GLVECPNCGEP-KLPHRVCPSCGYY   49 (57)
T ss_pred             cceECCCCCCc-cCCeEECCCCCcC
Confidence            44679999998 3356899999953


No 74 
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=38.84  E-value=5.1  Score=28.59  Aligned_cols=29  Identities=17%  Similarity=0.246  Sum_probs=24.0

Q ss_pred             ccccCCChhHHHHHHhhccccCCCCCCCC
Q psy9235         244 NRLINLPDDYSELINTVSLFTCPNSDRED  272 (317)
Q Consensus       244 ~~l~~LP~~y~~L~~~~~~~~C~~c~~~~  272 (317)
                      ++|+.||.++.-.=....+.+|-.|.+++
T Consensus        13 ~~lLqlP~~~~~~~k~~~klrCGaCs~vl   41 (46)
T PF11331_consen   13 FELLQLPAKFSLSKKNQQKLRCGACSEVL   41 (46)
T ss_pred             HHHHcCCCccCCCccceeEEeCCCCceeE
Confidence            89999999998775558888899998773


No 75 
>KOG0317|consensus
Probab=37.92  E-value=23  Score=34.45  Aligned_cols=23  Identities=22%  Similarity=0.681  Sum_probs=18.6

Q ss_pred             CCCceeecCCchhhHHHHHHHhh
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKYFD  134 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y~~  134 (317)
                      +..+-..-|||.-=-+|...+..
T Consensus       249 ~~~pSaTpCGHiFCWsCI~~w~~  271 (293)
T KOG0317|consen  249 RSNPSATPCGHIFCWSCILEWCS  271 (293)
T ss_pred             CCCCCcCcCcchHHHHHHHHHHc
Confidence            45677889999998888888863


No 76 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=37.12  E-value=24  Score=34.82  Aligned_cols=20  Identities=25%  Similarity=0.592  Sum_probs=18.4

Q ss_pred             CceeecCCchhhHHHHHHHh
Q psy9235         114 APHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       114 g~~vssCGH~mH~~C~~~Y~  133 (317)
                      ...+.-|.|.-|..|..+++
T Consensus       338 ~~~vlPC~H~FH~~Cv~kW~  357 (374)
T COG5540         338 RLRVLPCDHRFHVGCVDKWL  357 (374)
T ss_pred             eEEEeccCceechhHHHHHH
Confidence            47888999999999999998


No 77 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=37.04  E-value=25  Score=24.29  Aligned_cols=25  Identities=24%  Similarity=0.537  Sum_probs=17.4

Q ss_pred             cccCCCCCCCC---CC-CceeeceeCcee
Q psy9235         262 LFTCPNSDRED---SR-NPALCLICGDML  286 (317)
Q Consensus       262 ~~~C~~c~~~~---~~-~P~lCL~CG~~~  286 (317)
                      ..+|++||.+.   +. ...-|-.||.-+
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCeE
Confidence            46799999763   22 267888888643


No 78 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=35.72  E-value=23  Score=23.29  Aligned_cols=21  Identities=29%  Similarity=0.716  Sum_probs=15.2

Q ss_pred             cCCCCCCC---CCCCceeeceeCc
Q psy9235         264 TCPNSDRE---DSRNPALCLICGD  284 (317)
Q Consensus       264 ~C~~c~~~---~~~~P~lCL~CG~  284 (317)
                      .|..||.+   .+.+|.-|-.||-
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCC
Confidence            47788866   3458899999984


No 79 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=35.24  E-value=24  Score=24.19  Aligned_cols=23  Identities=30%  Similarity=0.752  Sum_probs=14.8

Q ss_pred             CCCCCCCCCCceeeceeCceecCC
Q psy9235         266 PNSDREDSRNPALCLICGDMLCSQ  289 (317)
Q Consensus       266 ~~c~~~~~~~P~lCL~CG~~~C~~  289 (317)
                      +.|++.+. .|..|-.||..+|..
T Consensus         4 ~~C~~~~~-~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen    4 PGCKKKDF-LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             TTT--BCT-SHEE-TTTS-EE-TT
T ss_pred             CcCcCccC-CCeECCCCCcccCcc
Confidence            34888766 899999999999984


No 80 
>KOG2114|consensus
Probab=34.11  E-value=19  Score=39.69  Aligned_cols=29  Identities=31%  Similarity=0.558  Sum_probs=23.0

Q ss_pred             CCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcc
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCEC  167 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrs  167 (317)
                      .-.+--.|||..|-.|+.                          .+|+-||-|+.
T Consensus       852 lP~VhF~CgHsyHqhC~e--------------------------~~~~~CP~C~~  880 (933)
T KOG2114|consen  852 LPFVHFLCGHSYHQHCLE--------------------------DKEDKCPKCLP  880 (933)
T ss_pred             cceeeeecccHHHHHhhc--------------------------cCcccCCccch
Confidence            345566799999999997                          13789999987


No 81 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=33.65  E-value=26  Score=25.70  Aligned_cols=24  Identities=29%  Similarity=0.623  Sum_probs=18.1

Q ss_pred             ccccCCCCCCCCCCCceeeceeCce
Q psy9235         261 SLFTCPNSDREDSRNPALCLICGDM  285 (317)
Q Consensus       261 ~~~~C~~c~~~~~~~P~lCL~CG~~  285 (317)
                      ....|++||+. -.-=-+|+.||..
T Consensus        25 ~l~~C~~cG~~-~~~H~vc~~cG~Y   48 (55)
T TIGR01031        25 TLVVCPNCGEF-KLPHRVCPSCGYY   48 (55)
T ss_pred             cceECCCCCCc-ccCeeECCccCeE
Confidence            34679999997 3356899999953


No 82 
>KOG0320|consensus
Probab=33.57  E-value=28  Score=31.72  Aligned_cols=21  Identities=38%  Similarity=0.843  Sum_probs=18.0

Q ss_pred             ceeecCCchhhHHHHHHHhhh
Q psy9235         115 PHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       115 ~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      ++..-|||+-=-.|.+.-++.
T Consensus       146 ~vsTkCGHvFC~~Cik~alk~  166 (187)
T KOG0320|consen  146 PVSTKCGHVFCSQCIKDALKN  166 (187)
T ss_pred             ccccccchhHHHHHHHHHHHh
Confidence            466899999999999998754


No 83 
>COG4855 Uncharacterized protein conserved in archaea [Function unknown]
Probab=33.43  E-value=22  Score=27.57  Aligned_cols=23  Identities=26%  Similarity=0.925  Sum_probs=17.3

Q ss_pred             CCCCCCCCCCCceeeceeCceecC
Q psy9235         265 CPNSDREDSRNPALCLICGDMLCS  288 (317)
Q Consensus       265 C~~c~~~~~~~P~lCL~CG~~~C~  288 (317)
                      |..=|++ ++.-+||.+||.=+|.
T Consensus        13 C~eeGKD-tdAV~iCIVCG~GlC~   35 (76)
T COG4855          13 CAEEGKD-TDAVGICIVCGMGLCM   35 (76)
T ss_pred             HHHhCCC-cccEEEEEEeCchHHH
Confidence            3334554 7788999999998875


No 84 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=33.15  E-value=30  Score=22.72  Aligned_cols=25  Identities=28%  Similarity=0.582  Sum_probs=14.4

Q ss_pred             cccCCCCCCC--CCC-----C--ceeeceeCcee
Q psy9235         262 LFTCPNSDRE--DSR-----N--PALCLICGDML  286 (317)
Q Consensus       262 ~~~C~~c~~~--~~~-----~--P~lCL~CG~~~  286 (317)
                      +.+||+|+..  ++.     .  -+-|-.||..+
T Consensus         2 ~~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQLGANGGKVRCGKCGHVW   35 (38)
T ss_pred             EEECCCCCCEEEeCHHHcCCCCCEEECCCCCCEE
Confidence            3578888872  121     1  25677777643


No 85 
>KOG0287|consensus
Probab=32.11  E-value=34  Score=34.31  Aligned_cols=21  Identities=29%  Similarity=0.706  Sum_probs=18.2

Q ss_pred             CCceeecCCchhhHHHHHHHh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      .-+.+..|||..-.=|..+|+
T Consensus        34 ~ip~itpCsHtfCSlCIR~~L   54 (442)
T KOG0287|consen   34 NIPMITPCSHTFCSLCIRKFL   54 (442)
T ss_pred             cCceeccccchHHHHHHHHHh
Confidence            346778899999999999998


No 86 
>PRK00420 hypothetical protein; Validated
Probab=31.68  E-value=32  Score=28.95  Aligned_cols=25  Identities=16%  Similarity=0.309  Sum_probs=18.4

Q ss_pred             cccCCCCCCCCC---CCceeeceeCcee
Q psy9235         262 LFTCPNSDREDS---RNPALCLICGDML  286 (317)
Q Consensus       262 ~~~C~~c~~~~~---~~P~lCL~CG~~~  286 (317)
                      ...||.||....   .-...|..||+.+
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVHGKVY   50 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCCCCee
Confidence            367999997654   3578888888754


No 87 
>KOG2845|consensus
Probab=31.13  E-value=17  Score=37.71  Aligned_cols=13  Identities=46%  Similarity=1.165  Sum_probs=11.5

Q ss_pred             eeceeCceecCCC
Q psy9235         278 LCLICGDMLCSQS  290 (317)
Q Consensus       278 lCL~CG~~~C~~~  290 (317)
                      =||.||+|+|.|-
T Consensus       172 NCL~CGkIVCeQE  184 (505)
T KOG2845|consen  172 NCLGCGKIVCEQE  184 (505)
T ss_pred             cccccceeEEEec
Confidence            6999999999874


No 88 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=30.01  E-value=29  Score=22.47  Aligned_cols=22  Identities=32%  Similarity=0.890  Sum_probs=15.3

Q ss_pred             ccCCCCCCC-CCC-CceeeceeCc
Q psy9235         263 FTCPNSDRE-DSR-NPALCLICGD  284 (317)
Q Consensus       263 ~~C~~c~~~-~~~-~P~lCL~CG~  284 (317)
                      .+|..||-+ +++ +|-.|-+||.
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCCC
Confidence            368888865 343 6778888875


No 89 
>KOG1734|consensus
Probab=29.13  E-value=26  Score=34.03  Aligned_cols=21  Identities=24%  Similarity=0.559  Sum_probs=18.2

Q ss_pred             CCceeecCCchhhHHHHHHHh
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      ...|.-+|+|+-|--|.+-..
T Consensus       245 enty~LsCnHvFHEfCIrGWc  265 (328)
T KOG1734|consen  245 ENTYKLSCNHVFHEFCIRGWC  265 (328)
T ss_pred             hhheeeecccchHHHhhhhhe
Confidence            356788999999999999885


No 90 
>KOG0269|consensus
Probab=28.23  E-value=33  Score=37.58  Aligned_cols=21  Identities=24%  Similarity=0.446  Sum_probs=17.5

Q ss_pred             ceeecCCchhhHHHHHHHhhh
Q psy9235         115 PHTSTCGHVMHSTCWSKYFDN  135 (317)
Q Consensus       115 ~~vssCGH~mH~~C~~~Y~~s  135 (317)
                      .+-..|||.+|.+|.++|+..
T Consensus       794 ~~c~~C~H~gH~sh~~sw~~~  814 (839)
T KOG0269|consen  794 VWCQVCGHGGHDSHLKSWFFK  814 (839)
T ss_pred             eecccccccccHHHHHHHHhc
Confidence            445679999999999999843


No 91 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=27.85  E-value=46  Score=23.57  Aligned_cols=29  Identities=28%  Similarity=0.511  Sum_probs=20.4

Q ss_pred             ccccCC--CCCCCCC------CCceeeceeCceecCC
Q psy9235         261 SLFTCP--NSDREDS------RNPALCLICGDMLCSQ  289 (317)
Q Consensus       261 ~~~~C~--~c~~~~~------~~P~lCL~CG~~~C~~  289 (317)
                      ..+.||  +|+..+.      ...+.|-.||..+|..
T Consensus        17 ~~~~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~fC~~   53 (64)
T smart00647       17 DLKWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFR   53 (64)
T ss_pred             CccCCCCCCCcceEEecCCCCCCeeECCCCCCeECCC
Confidence            455698  8875422      2368888899999975


No 92 
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=26.60  E-value=34  Score=28.33  Aligned_cols=19  Identities=16%  Similarity=0.331  Sum_probs=16.4

Q ss_pred             ccCCCCCCCCCCCceeece
Q psy9235         263 FTCPNSDREDSRNPALCLI  281 (317)
Q Consensus       263 ~~C~~c~~~~~~~P~lCL~  281 (317)
                      .+|.+||+..|+|.+||-.
T Consensus        21 v~CdnCg~~vPkdKAikr~   39 (108)
T COG4830          21 VRCDNCGKAVPKDKAIKRT   39 (108)
T ss_pred             eeeccccccCCccceeeEe
Confidence            4699999999999999864


No 93 
>KOG1814|consensus
Probab=26.21  E-value=34  Score=34.93  Aligned_cols=31  Identities=29%  Similarity=0.714  Sum_probs=25.4

Q ss_pred             cccCCCCCCCCCC----CceeeceeCceecCCCccccc
Q psy9235         262 LFTCPNSDREDSR----NPALCLICGDMLCSQSYCCQT  295 (317)
Q Consensus       262 ~~~C~~c~~~~~~----~P~lCL~CG~~~C~~~~CC~~  295 (317)
                      -.+||+|+.++.+    ..+-|..||..+|   ++|..
T Consensus       368 ~krCP~C~v~IEr~eGCnKM~C~~c~~~fc---~~c~~  402 (445)
T KOG1814|consen  368 SKRCPKCKVVIERSEGCNKMHCTKCGTYFC---WICAE  402 (445)
T ss_pred             CCCCCcccceeecCCCccceeeccccccce---eehhh
Confidence            4679999988765    5899999999998   56765


No 94 
>KOG3268|consensus
Probab=26.03  E-value=48  Score=30.43  Aligned_cols=40  Identities=40%  Similarity=0.848  Sum_probs=30.1

Q ss_pred             eeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCcc
Q psy9235         116 HTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCEC  167 (317)
Q Consensus       116 ~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrs  167 (317)
                      .-..||...|.-|+-.++.++...        |+  +||+-.||  ||.|.-
T Consensus       186 dN~qCgkpFHqiCL~dWLRgilTs--------RQ--SFdiiFGe--CPYCS~  225 (234)
T KOG3268|consen  186 DNIQCGKPFHQICLTDWLRGILTS--------RQ--SFDIIFGE--CPYCSD  225 (234)
T ss_pred             cccccCCcHHHHHHHHHHHHHhhc--------cc--eeeeeecc--CCCCCC
Confidence            457899999999999999887532        32  36666664  999964


No 95 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=25.75  E-value=42  Score=24.69  Aligned_cols=32  Identities=25%  Similarity=0.569  Sum_probs=16.5

Q ss_pred             ccccCCCCCCCC--CCCceeeceeCceecCCCcccc
Q psy9235         261 SLFTCPNSDRED--SRNPALCLICGDMLCSQSYCCQ  294 (317)
Q Consensus       261 ~~~~C~~c~~~~--~~~P~lCL~CG~~~C~~~~CC~  294 (317)
                      ....|..|++.-  .+..--|-.||.++|..  |..
T Consensus         8 ~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~--Cs~   41 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRRHHCRNCGRVVCSS--CSS   41 (69)
T ss_dssp             G-SB-TTT--B-BSSS-EEE-TTT--EEECC--CS-
T ss_pred             CCCcCcCcCCcCCCceeeEccCCCCCEECCc--hhC
Confidence            345688888762  34678899999999976  554


No 96 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=25.74  E-value=27  Score=39.26  Aligned_cols=25  Identities=28%  Similarity=0.741  Sum_probs=20.9

Q ss_pred             hccccCCCCCCCCCCCceeeceeCcee
Q psy9235         260 VSLFTCPNSDREDSRNPALCLICGDML  286 (317)
Q Consensus       260 ~~~~~C~~c~~~~~~~P~lCL~CG~~~  286 (317)
                      ...|+||+||+. + --..|..||+-.
T Consensus       623 v~~RKCPkCG~y-T-lk~rCP~CG~~T  647 (1095)
T TIGR00354       623 IAIRKCPQCGKE-S-FWLKCPVCGELT  647 (1095)
T ss_pred             EEEEECCCCCcc-c-ccccCCCCCCcc
Confidence            457899999998 4 678999999864


No 97 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=25.71  E-value=22  Score=26.64  Aligned_cols=14  Identities=14%  Similarity=0.280  Sum_probs=11.1

Q ss_pred             cccCCCCCCCCCCC
Q psy9235         262 LFTCPNSDREDSRN  275 (317)
Q Consensus       262 ~~~C~~c~~~~~~~  275 (317)
                      ++.|+.||+.+|.+
T Consensus         3 HkHC~~CG~~Ip~~   16 (59)
T PF09889_consen    3 HKHCPVCGKPIPPD   16 (59)
T ss_pred             CCcCCcCCCcCCcc
Confidence            57899999887754


No 98 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=25.58  E-value=31  Score=39.77  Aligned_cols=23  Identities=26%  Similarity=0.506  Sum_probs=18.6

Q ss_pred             cccCCCCCCCCCCCceeeceeCcee
Q psy9235         262 LFTCPNSDREDSRNPALCLICGDML  286 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P~lCL~CG~~~  286 (317)
                      +++||+||.+.+.  ..|..||.-.
T Consensus       667 ~rkCPkCG~~t~~--~fCP~CGs~t  689 (1337)
T PRK14714        667 RRRCPSCGTETYE--NRCPDCGTHT  689 (1337)
T ss_pred             EEECCCCCCcccc--ccCcccCCcC
Confidence            4899999998553  5999999764


No 99 
>PF05883 Baculo_RING:  Baculovirus U-box/Ring-like domain;  InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length. The function of this family is unknown, but it appears to be related to the U-box and ring finger domain by profile-profile comparison.
Probab=25.11  E-value=68  Score=27.89  Aligned_cols=22  Identities=14%  Similarity=0.199  Sum_probs=18.6

Q ss_pred             CCCceeecCC------chhhHHHHHHHh
Q psy9235         112 GPAPHTSTCG------HVMHSTCWSKYF  133 (317)
Q Consensus       112 ~~g~~vssCG------H~mH~~C~~~Y~  133 (317)
                      ..|++.-+||      |+||.+|+++|-
T Consensus        39 ~~GvV~vt~~g~lnLEkmfc~~C~~rw~   66 (134)
T PF05883_consen   39 NDGVVYVTDGGTLNLEKMFCADCDKRWR   66 (134)
T ss_pred             CCCEEEEecCCeehHHHHHHHHHHHHHH
Confidence            4588888887      899999999994


No 100
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=24.70  E-value=30  Score=40.21  Aligned_cols=24  Identities=25%  Similarity=0.779  Sum_probs=20.0

Q ss_pred             hccccCCCCCCCCCCCceeeceeCce
Q psy9235         260 VSLFTCPNSDREDSRNPALCLICGDM  285 (317)
Q Consensus       260 ~~~~~C~~c~~~~~~~P~lCL~CG~~  285 (317)
                      ...++||+||++ + --..|.+||+-
T Consensus       672 i~~~~Cp~Cg~~-~-~~~~Cp~CG~~  695 (1627)
T PRK14715        672 IAFFKCPKCGKV-G-LYHVCPFCGTR  695 (1627)
T ss_pred             EEeeeCCCCCCc-c-ccccCcccCCc
Confidence            457899999998 3 56899999975


No 101
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=23.94  E-value=48  Score=27.20  Aligned_cols=21  Identities=29%  Similarity=0.602  Sum_probs=17.3

Q ss_pred             cccCCCCCCCCCCCceeecee
Q psy9235         262 LFTCPNSDREDSRNPALCLIC  282 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P~lCL~C  282 (317)
                      ..+|.+||...|+|.||+.+=
T Consensus        20 ~V~C~nCgr~vPKDKAIkrf~   40 (95)
T PRK09335         20 YVQCDNCGRRVPRDKAVCVTK   40 (95)
T ss_pred             cEEeCCCCCcCcCCceEEEEE
Confidence            456999999989999998763


No 102
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=23.84  E-value=35  Score=22.43  Aligned_cols=22  Identities=32%  Similarity=0.847  Sum_probs=15.2

Q ss_pred             ccCCCCCCC-CCC-CceeeceeCc
Q psy9235         263 FTCPNSDRE-DSR-NPALCLICGD  284 (317)
Q Consensus       263 ~~C~~c~~~-~~~-~P~lCL~CG~  284 (317)
                      .+|..||-. +.+ .|..|-+||.
T Consensus         3 ~~C~~CG~i~~g~~~p~~CP~Cg~   26 (34)
T cd00729           3 WVCPVCGYIHEGEEAPEKCPICGA   26 (34)
T ss_pred             EECCCCCCEeECCcCCCcCcCCCC
Confidence            468888865 222 4778888885


No 103
>PRK12495 hypothetical protein; Provisional
Probab=23.38  E-value=70  Score=30.11  Aligned_cols=27  Identities=15%  Similarity=0.354  Sum_probs=17.8

Q ss_pred             hccccCCCCCCCCCCCc--eeeceeCcee
Q psy9235         260 VSLFTCPNSDREDSRNP--ALCLICGDML  286 (317)
Q Consensus       260 ~~~~~C~~c~~~~~~~P--~lCL~CG~~~  286 (317)
                      ...+.|+.||..||..|  ..|..|++++
T Consensus        40 msa~hC~~CG~PIpa~pG~~~Cp~CQ~~~   68 (226)
T PRK12495         40 MTNAHCDECGDPIFRHDGQEFCPTCQQPV   68 (226)
T ss_pred             cchhhcccccCcccCCCCeeECCCCCCcc
Confidence            45678999999988543  3355555443


No 104
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=23.24  E-value=31  Score=24.61  Aligned_cols=7  Identities=57%  Similarity=1.431  Sum_probs=3.9

Q ss_pred             eccCCcc
Q psy9235         161 LCPLCEC  167 (317)
Q Consensus       161 lCPLCrs  167 (317)
                      .||||.+
T Consensus        22 ~CPlC~r   28 (54)
T PF04423_consen   22 CCPLCGR   28 (54)
T ss_dssp             E-TTT--
T ss_pred             cCCCCCC
Confidence            9999987


No 105
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=22.82  E-value=49  Score=24.64  Aligned_cols=23  Identities=35%  Similarity=0.715  Sum_probs=17.7

Q ss_pred             ccccCCCCCCCCCCCceeeceeCc
Q psy9235         261 SLFTCPNSDREDSRNPALCLICGD  284 (317)
Q Consensus       261 ~~~~C~~c~~~~~~~P~lCL~CG~  284 (317)
                      ....|++||+. -.---+|+.||.
T Consensus        26 ~~~~c~~cG~~-~l~Hrvc~~cg~   48 (57)
T COG0333          26 TLSVCPNCGEY-KLPHRVCLKCGY   48 (57)
T ss_pred             cceeccCCCCc-ccCceEcCCCCC
Confidence            45679999987 334589999995


No 106
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=22.72  E-value=51  Score=23.02  Aligned_cols=22  Identities=32%  Similarity=0.748  Sum_probs=15.9

Q ss_pred             ccCCCCCCC---CCCCceeeceeCc
Q psy9235         263 FTCPNSDRE---DSRNPALCLICGD  284 (317)
Q Consensus       263 ~~C~~c~~~---~~~~P~lCL~CG~  284 (317)
                      ..|.+||.+   ++.+++-|-.||-
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~   27 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGY   27 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCc
Confidence            568888865   2357888888884


No 107
>KOG1785|consensus
Probab=22.69  E-value=41  Score=34.44  Aligned_cols=43  Identities=23%  Similarity=0.679  Sum_probs=30.2

Q ss_pred             CCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEecc
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPL  175 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP~  175 (317)
                      ...+-+--|||.|-..|+-.+-.+-                     +-=-||.||.-----=|+
T Consensus       379 dKdvkIEPCGHLlCt~CLa~WQ~sd---------------------~gq~CPFCRcEIKGte~v  421 (563)
T KOG1785|consen  379 DKDVKIEPCGHLLCTSCLAAWQDSD---------------------EGQTCPFCRCEIKGTEPV  421 (563)
T ss_pred             CCCcccccccchHHHHHHHhhcccC---------------------CCCCCCceeeEeccccce
Confidence            3567788999999999998885332                     122799999764433343


No 108
>PHA00626 hypothetical protein
Probab=22.26  E-value=64  Score=24.16  Aligned_cols=8  Identities=25%  Similarity=0.858  Sum_probs=6.8

Q ss_pred             cCCCCCCC
Q psy9235         264 TCPNSDRE  271 (317)
Q Consensus       264 ~C~~c~~~  271 (317)
                      .||+||+.
T Consensus         2 ~CP~CGS~    9 (59)
T PHA00626          2 SCPKCGSG    9 (59)
T ss_pred             CCCCCCCc
Confidence            69999985


No 109
>KOG0804|consensus
Probab=22.24  E-value=46  Score=34.39  Aligned_cols=24  Identities=25%  Similarity=0.567  Sum_probs=20.6

Q ss_pred             CCCCCceeecCCchhhHHHHHHHh
Q psy9235         110 HQGPAPHTSTCGHVMHSTCWSKYF  133 (317)
Q Consensus       110 ~~~~g~~vssCGH~mH~~C~~~Y~  133 (317)
                      .-..|+...-|.|.-|..|..++-
T Consensus       187 ~s~~gi~t~~c~Hsfh~~cl~~w~  210 (493)
T KOG0804|consen  187 SSTTGILTILCNHSFHCSCLMKWW  210 (493)
T ss_pred             ccccceeeeecccccchHHHhhcc
Confidence            345789999999999999998874


No 110
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=22.22  E-value=44  Score=26.36  Aligned_cols=22  Identities=18%  Similarity=0.498  Sum_probs=14.7

Q ss_pred             cccCCCCCCC-CCCCce----eeceeC
Q psy9235         262 LFTCPNSDRE-DSRNPA----LCLICG  283 (317)
Q Consensus       262 ~~~C~~c~~~-~~~~P~----lCL~CG  283 (317)
                      +.+||=||.. +...+.    ||.+|+
T Consensus         1 K~~CPCCg~~Tl~~~~~~~ydIC~VC~   27 (78)
T PF14206_consen    1 KYPCPCCGYYTLEERGEGTYDICPVCF   27 (78)
T ss_pred             CccCCCCCcEEeccCCCcCceECCCCC
Confidence            4679999954 233444    898886


No 111
>KOG1002|consensus
Probab=22.16  E-value=62  Score=34.33  Aligned_cols=72  Identities=21%  Similarity=0.485  Sum_probs=45.2

Q ss_pred             CCCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccceEeccCCCCCCC----CCCCC
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNAALPLIPALSSI----QTTTP  187 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~vLP~ip~~~~~----~~~~~  187 (317)
                      ......++|-|.----|.+.|+.+...                 ..+ ..||.|.      ||+.-+++..    ..-..
T Consensus       546 aed~i~s~ChH~FCrlCi~eyv~~f~~-----------------~~n-vtCP~C~------i~LsiDlse~alek~~l~~  601 (791)
T KOG1002|consen  546 AEDYIESSCHHKFCRLCIKEYVESFME-----------------NNN-VTCPVCH------IGLSIDLSEPALEKTDLKG  601 (791)
T ss_pred             hhhhHhhhhhHHHHHHHHHHHHHhhhc-----------------ccC-CCCcccc------ccccccccchhhhhcchhh
Confidence            346788999999999999999977531                 223 7999995      4443222211    11122


Q ss_pred             ccccccccccCHHHHHHHHH
Q psy9235         188 TENAEVFVHMDFDAWLSIVE  207 (317)
Q Consensus       188 ~e~~~~~~~~~~~~w~~~~~  207 (317)
                      ..+++...-.++++|=.+..
T Consensus       602 Fk~sSIlnRinm~~~qsSTK  621 (791)
T KOG1002|consen  602 FKASSILNRINMDDWQSSTK  621 (791)
T ss_pred             hhhHHHhhhcchhhhcchhH
Confidence            33444445588999976543


No 112
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=22.07  E-value=35  Score=24.89  Aligned_cols=23  Identities=30%  Similarity=0.694  Sum_probs=17.0

Q ss_pred             ccccCCCCCCCCCCCceeeceeCc
Q psy9235         261 SLFTCPNSDREDSRNPALCLICGD  284 (317)
Q Consensus       261 ~~~~C~~c~~~~~~~P~lCL~CG~  284 (317)
                      ....||+||.. ..--.+|.-||.
T Consensus        25 ~l~~c~~cg~~-~~~H~vc~~cG~   47 (56)
T PF01783_consen   25 NLVKCPNCGEP-KLPHRVCPSCGY   47 (56)
T ss_dssp             SEEESSSSSSE-ESTTSBCTTTBB
T ss_pred             ceeeeccCCCE-ecccEeeCCCCe
Confidence            44679999976 335588999984


No 113
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=22.05  E-value=68  Score=30.26  Aligned_cols=21  Identities=14%  Similarity=0.213  Sum_probs=18.1

Q ss_pred             CCCceeecCCchhhHHHHHHH
Q psy9235         112 GPAPHTSTCGHVMHSTCWSKY  132 (317)
Q Consensus       112 ~~g~~vssCGH~mH~~C~~~Y  132 (317)
                      ..-+++.+|||++=+.+++..
T Consensus       127 ~~fv~l~~cG~V~s~~alke~  147 (260)
T PF04641_consen  127 HKFVYLRPCGCVFSEKALKEL  147 (260)
T ss_pred             eeEEEEcCCCCEeeHHHHHhh
Confidence            356889999999999999887


No 114
>KOG2164|consensus
Probab=21.35  E-value=55  Score=34.24  Aligned_cols=46  Identities=26%  Similarity=0.689  Sum_probs=34.4

Q ss_pred             CCceeecCCchhhHHHHHHHhhhhhhhccCCccccCCCCccCCCCCeeeccCCccccce--EeccC
Q psy9235         113 PAPHTSTCGHVMHSTCWSKYFDNILAKENRRPYRLRQPTSFDIEKNEFLCPLCECLSNA--ALPLI  176 (317)
Q Consensus       113 ~g~~vssCGH~mH~~C~~~Y~~s~~~~e~rr~q~~R~~~~~d~~~~EFlCPLCrsLsN~--vLP~i  176 (317)
                      .-+..+.|||+-=..|+-.|+..-.                  -.+-=.||||++---.  |.|+.
T Consensus       197 ~~p~~t~CGHiFC~~CiLqy~~~s~------------------~~~~~~CPiC~s~I~~kdl~pv~  244 (513)
T KOG2164|consen  197 SVPVRTNCGHIFCGPCILQYWNYSA------------------IKGPCSCPICRSTITLKDLLPVF  244 (513)
T ss_pred             CcccccccCceeeHHHHHHHHhhhc------------------ccCCccCCchhhhccccceeeee
Confidence            3456667999999999999986541                  1234479999998777  77774


No 115
>KOG0804|consensus
Probab=20.92  E-value=45  Score=34.46  Aligned_cols=25  Identities=28%  Similarity=0.654  Sum_probs=21.3

Q ss_pred             cccCCCCCCCCCCCceeeceeCceecC
Q psy9235         262 LFTCPNSDREDSRNPALCLICGDMLCS  288 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P~lCL~CG~~~C~  288 (317)
                      ...|..||..  .+-.|||+||-+.|+
T Consensus       228 ~~~c~~c~~~--~~LwicliCg~vgcg  252 (493)
T KOG0804|consen  228 SSLCLACGCT--EDLWICLICGNVGCG  252 (493)
T ss_pred             hhhhhhhccc--ccEEEEEEccceecc
Confidence            3468889886  688999999999997


No 116
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=20.32  E-value=84  Score=26.23  Aligned_cols=24  Identities=25%  Similarity=0.454  Sum_probs=16.6

Q ss_pred             cccCCCCCCCC-C-----------CCceeeceeCce
Q psy9235         262 LFTCPNSDRED-S-----------RNPALCLICGDM  285 (317)
Q Consensus       262 ~~~C~~c~~~~-~-----------~~P~lCL~CG~~  285 (317)
                      +..|.+|...+ |           ..-..||-||.+
T Consensus        56 R~~CkkC~t~Lvpg~n~rvR~~~~~v~vtC~~CG~~   91 (105)
T COG2023          56 RTICKKCYTPLVPGKNARVRLRKGRVVVTCLECGTI   91 (105)
T ss_pred             HHhccccCcccccCcceEEEEcCCeEEEEecCCCcE
Confidence            34588998741 2           145789999986


No 117
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=20.19  E-value=45  Score=27.44  Aligned_cols=23  Identities=26%  Similarity=0.590  Sum_probs=16.7

Q ss_pred             ccccCCCCCCCCCCC---------ceeeceeCce
Q psy9235         261 SLFTCPNSDREDSRN---------PALCLICGDM  285 (317)
Q Consensus       261 ~~~~C~~c~~~~~~~---------P~lCL~CG~~  285 (317)
                      ..+.||+||..  ..         -..|..||..
T Consensus        20 t~f~CP~Cge~--~v~v~~~k~~~h~~C~~CG~y   51 (99)
T PRK14892         20 KIFECPRCGKV--SISVKIKKNIAIITCGNCGLY   51 (99)
T ss_pred             cEeECCCCCCe--EeeeecCCCcceEECCCCCCc
Confidence            45779999953  23         4789999874


No 118
>PRK12496 hypothetical protein; Provisional
Probab=20.08  E-value=53  Score=29.05  Aligned_cols=24  Identities=21%  Similarity=0.526  Sum_probs=18.3

Q ss_pred             cccCCCCCCCCCCCc--eeeceeCce
Q psy9235         262 LFTCPNSDREDSRNP--ALCLICGDM  285 (317)
Q Consensus       262 ~~~C~~c~~~~~~~P--~lCL~CG~~  285 (317)
                      +.+|+.||+.-+.++  -.|-.||.-
T Consensus       127 ~~~C~gC~~~~~~~~~~~~C~~CG~~  152 (164)
T PRK12496        127 RKVCKGCKKKYPEDYPDDVCEICGSP  152 (164)
T ss_pred             eEECCCCCccccCCCCCCcCCCCCCh
Confidence            467999999865443  679999964


Done!