Diaphorina citri psyllid: psy925

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MNRAEMSSDEPLADVVKHVEKGYQMEAPEGCPPEEYEMMRQAWSLQPELRPTFRQLKAKLLTFMLNSLQ
cccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcc
*******SDEPLADVVKHVEKGYQMEAPEGCPPEEYEMMRQAWSLQPELRPTFRQLKAKLLTFMLNS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRAEMSSDEPLADVVKHVEKGYQMEAPEGCPPEEYEMMRQAWSLQPELRPTFRQLKAKLLTFMLNSLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.confidentP32577
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.confidentQ0VBZ0
Tyrosine-protein kinase CSK Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs). Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane.confidentP41239

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0060284 [BP]regulation of cell developmentprobableGO:0050793, GO:0050794, GO:0045595, GO:0008150, GO:0065007, GO:0050789
GO:0051017 [BP]actin filament bundle assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0030036, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0071840
GO:0051272 [BP]positive regulation of cellular component movementprobableGO:0051270, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0048522
GO:0007169 [BP]transmembrane receptor protein tyrosine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005927 [CC]muscle tendon junctionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0033673 [BP]negative regulation of kinase activityprobableGO:0042325, GO:0051348, GO:0019220, GO:0019222, GO:0050790, GO:0031323, GO:0051338, GO:0050789, GO:0051174, GO:0065007, GO:0043549, GO:0044092, GO:0008150, GO:0065009, GO:0050794, GO:0043086
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0032715 [BP]negative regulation of interleukin-6 productionprobableGO:0051241, GO:0050789, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032675, GO:0001818
GO:0019897 [CC]extrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043406 [BP]positive regulation of MAP kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0001932, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0071375 [BP]cellular response to peptide hormone stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0008150, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0044763, GO:1901698
GO:0001784 [MF]phosphotyrosine bindingprobableGO:0003674, GO:0051219, GO:0005488, GO:0005515, GO:0045309
GO:0070373 [BP]negative regulation of ERK1 and ERK2 cascadeprobableGO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0010741, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048523, GO:0010646, GO:0010627, GO:0070372, GO:0043409, GO:0043408
GO:0050731 [BP]positive regulation of peptidyl-tyrosine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0050730, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0050853 [BP]B cell receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050851, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0080134 [BP]regulation of response to stressprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045779 [BP]negative regulation of bone resorptionprobableGO:0034103, GO:0034104, GO:0051241, GO:0045124, GO:0032844, GO:0008150, GO:0046851, GO:0046850, GO:0065007, GO:0032845, GO:0051239, GO:0048519, GO:0050789
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0050715 [BP]positive regulation of cytokine secretionprobableGO:0032880, GO:0070201, GO:0032879, GO:0050708, GO:0060341, GO:0051046, GO:0050714, GO:0051049, GO:0051050, GO:0050707, GO:0050794, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0051047, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0048522
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0032526 [BP]response to retinoic acidprobableGO:1901700, GO:0033993, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0010989 [BP]negative regulation of low-density lipoprotein particle clearanceprobableGO:0010988, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0010984, GO:0010985, GO:0050789
GO:0043306 [BP]positive regulation of mast cell degranulationprobableGO:0045921, GO:0032388, GO:0060341, GO:0051047, GO:0050865, GO:0051049, GO:0032386, GO:0048583, GO:0002703, GO:0050789, GO:0032879, GO:0051046, GO:0043300, GO:0043302, GO:0043304, GO:0002684, GO:0002696, GO:0002682, GO:0048518, GO:0065007, GO:0050867, GO:0017157, GO:0051050, GO:0060627, GO:0008150, GO:0050794, GO:0002886, GO:0050776, GO:0002694, GO:0002697, GO:0033003, GO:0033005, GO:0033006, GO:0033008, GO:0002699, GO:0048522
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0050765 [BP]negative regulation of phagocytosisprobableGO:0050764, GO:0032879, GO:0051051, GO:0050794, GO:0051049, GO:0008150, GO:0009987, GO:0051129, GO:0060627, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0045806, GO:0030100, GO:0050789, GO:0048523
GO:0010669 [BP]epithelial structure maintenanceprobableGO:0032501, GO:0048871, GO:0044707, GO:0060249, GO:0042592, GO:0008150, GO:0065007, GO:0001894, GO:0065008, GO:0044699
GO:0060368 [BP]regulation of Fc receptor mediated stimulatory signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0008150, GO:0002682, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0030155 [BP]regulation of cell adhesionprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0007293 [BP]germarium-derived egg chamber formationprobableGO:0032502, GO:0007292, GO:0044702, GO:0000003, GO:0032504, GO:0022414, GO:0048856, GO:0019953, GO:0044767, GO:0003006, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0009653, GO:0048477, GO:0048646, GO:0048609
GO:0051353 [BP]positive regulation of oxidoreductase activityprobableGO:0051341, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0004715 [MF]non-membrane spanning protein tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004713, GO:0004672
GO:0032956 [BP]regulation of actin cytoskeleton organizationprobableGO:0033043, GO:0032970, GO:0051493, GO:0051128, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0043068 [BP]positive regulation of programmed cell deathprobableGO:0050794, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0042997 [BP]negative regulation of Golgi to plasma membrane protein transportprobableGO:0033157, GO:0070201, GO:0051223, GO:0060341, GO:0051051, GO:0051049, GO:0032386, GO:0032387, GO:0090317, GO:0050794, GO:0008150, GO:0065007, GO:0042996, GO:0048519, GO:0032879, GO:0060627, GO:0051224, GO:0050789, GO:0048523, GO:0032880
GO:2000145 [BP]regulation of cell motilityprobableGO:0040012, GO:0050794, GO:0051270, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0032587 [CC]ruffle membraneprobableGO:0001726, GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0034334 [BP]adherens junction maintenanceprobableGO:0009987, GO:0034332, GO:0034331, GO:0034330, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0043954, GO:0008150, GO:0044699
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0034988 [MF]Fc-gamma receptor I complex bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0034987
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045197 [BP]establishment or maintenance of epithelial cell apical/basal polarityprobableGO:0035088, GO:0061245, GO:0009987, GO:0007163, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BYG, chain A
Confidence level:very confident
Coverage over the Query: 3-68
View the alignment between query and template
View the model in PyMOL