Query         psy9284
Match_columns 82
No_of_seqs    156 out of 916
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:32:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9284.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9284hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04281 ZnMc_BMP1_TLD Zinc-dep 100.0 9.5E-32 2.1E-36  182.3   6.1   80    2-81    111-192 (200)
  2 cd04282 ZnMc_meprin Zinc-depen 100.0 1.3E-31 2.9E-36  184.8   5.7   80    2-81    144-223 (230)
  3 cd04283 ZnMc_hatching_enzyme Z 100.0 5.6E-30 1.2E-34  171.6   5.4   75    2-81    101-175 (182)
  4 cd04280 ZnMc_astacin_like Zinc 100.0 1.2E-29 2.7E-34  169.0   5.2   78    2-81     98-175 (180)
  5 KOG3714|consensus              100.0 7.4E-30 1.6E-34  187.6   4.6   80    2-81    183-262 (411)
  6 PF01400 Astacin:  Astacin (Pep  99.9 1.3E-27 2.8E-32  160.5   4.4   80    2-81    103-182 (191)
  7 cd04327 ZnMc_MMP_like_3 Zinc-d  99.6   7E-16 1.5E-20  103.8   1.5   49   18-81    143-192 (198)
  8 cd04268 ZnMc_MMP_like Zinc-dep  98.1 2.9E-06 6.3E-11   54.7   2.7   39   29-81    122-160 (165)
  9 smart00235 ZnMc Zinc-dependent  96.8 0.00087 1.9E-08   42.3   1.8   31    2-39    110-140 (140)
 10 cd00203 ZnMc Zinc-dependent me  96.1  0.0052 1.1E-07   39.3   2.5   33   31-81    130-162 (167)
 11 PF12253 CAF1A:  Chromatin asse  37.7      37 0.00081   19.8   2.3   16    8-23      6-21  (77)
 12 PF11097 DUF2883:  Protein of u  31.2      17 0.00037   20.9   0.1   10   37-46     62-71  (75)
 13 PF04930 FUN14:  FUN14 family;   24.9      17 0.00037   21.8  -0.7   16    3-18     41-56  (100)
 14 PF05880 Fiji_64_capsid:  Fijiv  23.3      28 0.00061   27.3   0.1   21   30-50    213-240 (561)
 15 COG1445 FrwB Phosphotransferas  20.8      81  0.0017   20.1   1.8   17   66-82     41-57  (122)

No 1  
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=99.97  E-value=9.5e-32  Score=182.30  Aligned_cols=80  Identities=33%  Similarity=0.537  Sum_probs=74.5

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCC--CccCCCcCCCCCHHHH
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPG--AEDTMGQRDAMSRVDQ   79 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~--~~~~iGqr~~lS~~Di   79 (82)
                      |+||+|+|+||.|+.++||+|++...++++|+||||+|||||++++||+++..|||+|+.+.  ++..||||.+||+.||
T Consensus       111 D~yV~I~~~nI~~~~~~nF~k~~~~~~~~~g~pYDy~SiMHY~~~aFs~~~~~~Ti~p~~~~~~~~~~iGqr~~lS~~Di  190 (200)
T cd04281         111 DDHVTIIRENIQPGQEYNFLKMEPEEVDSLGEPYDFDSIMHYARNTFSRGMFLDTILPKRDPNGVRPEIGQRTRLSEGDI  190 (200)
T ss_pred             cceEEEeecccCcchhhhhhhcCccccccCCCccCCCccccCCCCccccCCCCCceEECCCcccccccccccCCCCHHHH
Confidence            89999999999999999999999988889999999999999999999999877999998763  4468999999999999


Q ss_pred             hc
Q psy9284          80 KR   81 (82)
Q Consensus        80 ~k   81 (82)
                      +|
T Consensus       191 ~~  192 (200)
T cd04281         191 IQ  192 (200)
T ss_pred             HH
Confidence            86


No 2  
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily. Meprins are membrane-bound or secreted extracellular proteases, which cleave a variety of targets, including peptides such as parathyroid hormone, gastrin, and cholecystokinin, cytokines such as osteopontin, and proteins such as collagen IV, fibronectin, casein and gelatin. Meprins may also be able to release proteins from the cell surface. Closely related meprin alpha- and beta-subunits form homo- and hetero-oligomers; these complexes are found on epithelial cells of the intestine, for example, and are also expressed in certain cancer cells.
Probab=99.97  E-value=1.3e-31  Score=184.76  Aligned_cols=80  Identities=31%  Similarity=0.497  Sum_probs=75.1

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      |+||+|+|+||.++.++||+|+....+.++|+||||+|||||++++||+++..|||+|+++.++..||||.+||+.||+|
T Consensus       144 D~yV~I~~~nI~~~~~~nF~k~~~~~~~~~g~pYDy~SIMHY~~~aFs~~~~~pTi~~~~~~~~~~iGqr~~lS~~Di~~  223 (230)
T cd04282         144 DDYVKIWWDQILSGREHNFNKYDDSFSTDLNTPYDYESVMHYSPFSFNKGASEPTITTKIPEFNDIIGQRLDFSDIDLER  223 (230)
T ss_pred             ccceEEeecccCchHHHHhhhcCccccccCCCCCCcccccccCCCccccCCCCceeeecCCcccccccccCCCCHHHHHH
Confidence            89999999999999999999999988889999999999999999999999445999999987766899999999999986


No 3  
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=99.96  E-value=5.6e-30  Score=171.59  Aligned_cols=75  Identities=37%  Similarity=0.614  Sum_probs=69.1

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      |+||+|+|+||.|+.++||+|+..   .++|+||||+|||||++++||++++ |||+|+++.. ..||||.+||+.||++
T Consensus       101 D~yV~I~~~nI~~~~~~nF~~~~~---~~~~~pYDy~SiMHY~~~afs~~g~-~Ti~~~~~~~-~~iGqr~~lS~~Di~~  175 (182)
T cd04283         101 DKYVRINWENIIPDQLYNFDKQDT---NNLGTPYDYSSVMHYGRYAFSINGK-PTIVPIPDPN-VPIGQRQGMSNLDILR  175 (182)
T ss_pred             CceEEEehhhcCchHHhhhhhccc---cccCCcccceeeeccCCcccccCCC-CeEEECCccc-ccccCCCCCCHHHHHH
Confidence            899999999999999999999975   4689999999999999999999988 9999998654 3899999999999986


No 4  
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=99.96  E-value=1.2e-29  Score=168.99  Aligned_cols=78  Identities=45%  Similarity=0.755  Sum_probs=73.5

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      |+||+|+|+||.++.+.||+|++...+.++|+||||+|||||++++||++++ |||+|+++... .+|||.+||+.|+++
T Consensus        98 D~yv~i~~~ni~~~~~~nf~~~~~~~~~~~~~~YDy~SiMhY~~~~fs~~~~-~ti~~~~~~~~-~~g~~~~~S~~D~~~  175 (180)
T cd04280          98 DDYVTINWENIQPGYEHNFDKYSPDTVTTYGVPYDYGSVMHYGPTAFSKNGK-PTIVPKDPGYQ-IIGQREGLSFLDIKK  175 (180)
T ss_pred             CCeEEEeecccChhHHHHhhhcCcccccccCCcCCcceEeccCCcccccCCC-ceEEECCchhh-cccCCCCCCHHHHHH
Confidence            8999999999999999999999998888899999999999999999999977 99999998775 389999999999986


No 5  
>KOG3714|consensus
Probab=99.96  E-value=7.4e-30  Score=187.57  Aligned_cols=80  Identities=44%  Similarity=0.748  Sum_probs=76.7

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      |+||+|+|+||.++.++||+|++...+.++|+||||+|||||++++||+++..|||+|+....+.+||||.+||+.|+.|
T Consensus       183 D~yV~I~~~ni~~~~~~nF~k~~~~~~~~~~~pYDygSvMHY~~~afs~~~~~~ti~~~~~~~~~~mGqr~~~S~~Di~~  262 (411)
T KOG3714|consen  183 DNYVSINWDNIDPGQEYNFEKYSPDEVTTYGVPYDYGSVMHYAPYAFSKNGSLPTIVPKDNGFQNTMGQRERLSFYDIRK  262 (411)
T ss_pred             cCceEEeeccCChhhhhhhhhcChhhhhccCCcccCCcccccCCcccCcCCCCCceecccccccccccccCcCCHHHHHH
Confidence            89999999999999999999999988899999999999999999999999998899999988766899999999999986


No 6  
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=99.94  E-value=1.3e-27  Score=160.54  Aligned_cols=80  Identities=43%  Similarity=0.692  Sum_probs=57.5

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      |+||+|+|+||.++.+.||.+.+...+.++++||||+|||||++.+|++++..|||+|+++.....||||.+||+.|+++
T Consensus       103 d~yi~i~~~~i~~~~~~~f~~~~~~~~~~~~~pYD~~SIMHY~~~~~s~~~~~~ti~~~~~~~~~~iG~~~~lS~~D~~~  182 (191)
T PF01400_consen  103 DNYITINWDNIQPGYKHNFDKYPPSEWSTYGSPYDYGSIMHYSSYAFSKNGSQPTITPKDPKYQETIGQRNRLSFTDIKQ  182 (191)
T ss_dssp             GGTEEE-GGGB-TTSGGGG---SGGGBE-TTS---TT-TT---TTTTBSSTTS-SEEESSTTCTS-GGG-SS--HHHHHH
T ss_pred             ccEEEEehhcchhhhhhhhhccccccccccCCCcCccCeecccCcccccCCCCCeEEecCCCCcccccccCCCCHHHHHH
Confidence            89999999999999999999999878888999999999999999999999966999999987667999999999999986


No 7  
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=99.56  E-value=7e-16  Score=103.82  Aligned_cols=49  Identities=27%  Similarity=0.342  Sum_probs=42.5

Q ss_pred             ccceecCCCCcccCCCCccccccCCCC-CcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284          18 FNLERRPAGSVRTFSMPYDYGSIMHYS-GIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus        18 ~nF~k~~~~~~~~~g~pYDy~SvMHY~-~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      .+|.|+...  ..+|+||||+|||||+ +.+|++++. +|            |++.+||..|+++
T Consensus       143 ~~f~~~~~~--~~~~~~yD~~SIMHY~~~~~~t~~g~-~t------------~~~~~lS~~D~~~  192 (198)
T cd04327         143 NVFAKLDDG--DVAYSPYDPDSIMHYPFPGSLTLDGE-EV------------PPNRTLSDKDKAF  192 (198)
T ss_pred             hhhhccccc--cccCCCCCcHHHHcCCCcHHhhcCCc-cc------------CCCCCCCHHHHHH
Confidence            679998753  4689999999999999 899999887 55            6889999999986


No 8  
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=98.07  E-value=2.9e-06  Score=54.66  Aligned_cols=39  Identities=23%  Similarity=0.221  Sum_probs=32.9

Q ss_pred             ccCCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284          29 RTFSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus        29 ~~~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      ..++.+||+.|||||....|+.+              ..+|++.+||..||+.
T Consensus       122 ~~~~~~~~~~SvM~y~~~~~~~~--------------~~~~~~~~~~~~Di~a  160 (165)
T cd04268         122 DLLAEKGDTSSVMDYAPSNFSIQ--------------LGDGQKYTIGPYDIAA  160 (165)
T ss_pred             hhhccCCCCcccCCCCccccccc--------------cccccCCCCCHHHHHH
Confidence            46788999999999999999875              1568889999999974


No 9  
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=96.75  E-value=0.00087  Score=42.25  Aligned_cols=31  Identities=29%  Similarity=0.466  Sum_probs=25.5

Q ss_pred             CceEEEecCCCcccccccceecCCCCcccCCCCccccc
Q psy9284           2 SLTCQVLTENIGPGHEFNLERRPAGSVRTFSMPYDYGS   39 (82)
Q Consensus         2 D~yV~I~~~NI~~~~~~nF~k~~~~~~~~~g~pYDy~S   39 (82)
                      |+||.|+|+|+    ..+|.+...   +.+|+||||+|
T Consensus       110 d~~~~~~~~~~----~~~~~~~~~---~~~~~~~~yg~  140 (140)
T smart00235      110 DNYMYINYTNI----TRNFDLSND---DSLGIPYDYGS  140 (140)
T ss_pred             cCeEEEehhhh----hhccccccc---cCCCchhccCc
Confidence            78999999999    557777643   67889999987


No 10 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=96.07  E-value=0.0052  Score=39.31  Aligned_cols=33  Identities=36%  Similarity=0.463  Sum_probs=25.3

Q ss_pred             CCCCccccccCCCCCcccccCCCcceEEeCCCCCccCCCcCCCCCHHHHhc
Q psy9284          31 FSMPYDYGSIMHYSGIAFSKDGVSKTIVPLYPGAEDTMGQRDAMSRVDQKR   81 (82)
Q Consensus        31 ~g~pYDy~SvMHY~~~afs~~~~~~Ti~~~~~~~~~~iGqr~~lS~~Di~k   81 (82)
                      .+.+|++.|||||....|+                  ++++..||..|+.+
T Consensus       130 ~~~~~~~~siM~y~~~~~~------------------~~~~~~fS~~d~~~  162 (167)
T cd00203         130 NAEDDDYYSVMSYTKGSFS------------------DGQRKDFSQCDIDQ  162 (167)
T ss_pred             cCCCCCCCeEeccCccccC------------------cccCCCcCHHHHHH
Confidence            5669999999999876553                  56777788888654


No 11 
>PF12253 CAF1A:  Chromatin assembly factor 1 subunit A;  InterPro: IPR022043  The CAF-1 or chromatin assembly factor-1 consists of three subunits, and this is the first, or A []. The A domain is uniquely required for the progression of S phase in mouse cells [], independent of its ability to promote histone deposition [] but dependent on its ability to interact with HP1 - heterochromatin protein 1-rich heterochromatin domains next to centromeres that are crucial for chromosome segregation during mitosis. This HP1-CAF-1 interaction module functions as a built-in replication control for heterochromatin, which, like a control barrier, has an impact on S-phase progression in addition to DNA-based checkpoints []. 
Probab=37.71  E-value=37  Score=19.80  Aligned_cols=16  Identities=19%  Similarity=0.256  Sum_probs=11.8

Q ss_pred             ecCCCcccccccceec
Q psy9284           8 LTENIGPGHEFNLERR   23 (82)
Q Consensus         8 ~~~NI~~~~~~nF~k~   23 (82)
                      +.+|++|.+..-+.|.
T Consensus         6 F~e~~RPpY~GT~~k~   21 (77)
T PF12253_consen    6 FHENVRPPYYGTWTKK   21 (77)
T ss_pred             eCCCCCCCEeeEEccC
Confidence            3589999887776664


No 12 
>PF11097 DUF2883:  Protein of unknown function (DUF2883);  InterPro: IPR020112 This group of proteins currently have no known function and are found primarily in the T4-like bacteriophages.
Probab=31.24  E-value=17  Score=20.86  Aligned_cols=10  Identities=30%  Similarity=0.441  Sum_probs=7.5

Q ss_pred             ccccCCCCCc
Q psy9284          37 YGSIMHYSGI   46 (82)
Q Consensus        37 y~SvMHY~~~   46 (82)
                      -+|||||-+.
T Consensus        62 ~~~~mhykp~   71 (75)
T PF11097_consen   62 RAFVMHYKPR   71 (75)
T ss_pred             ccceeecccc
Confidence            3789999753


No 13 
>PF04930 FUN14:  FUN14 family;  InterPro: IPR007014 This is a family of short proteins found in eukaryotes and some archaea. Although the function of these proteins is not known they may contain transmembrane helices.
Probab=24.85  E-value=17  Score=21.76  Aligned_cols=16  Identities=6%  Similarity=-0.166  Sum_probs=12.4

Q ss_pred             ceEEEecCCCcccccc
Q psy9284           3 LTCQVLTENIGPGHEF   18 (82)
Q Consensus         3 ~yV~I~~~NI~~~~~~   18 (82)
                      -||+|||+.+......
T Consensus        41 G~i~Vnw~kl~~~~~~   56 (100)
T PF04930_consen   41 GYIKVNWDKLEKDVKK   56 (100)
T ss_pred             CeEEECHHHHHHHHHH
Confidence            4899999998775544


No 14 
>PF05880 Fiji_64_capsid:  Fijivirus 64 kDa capsid protein;  InterPro: IPR008618 This family consists of several Fijivirus 64 kDa capsid proteins.
Probab=23.25  E-value=28  Score=27.30  Aligned_cols=21  Identities=33%  Similarity=0.602  Sum_probs=16.4

Q ss_pred             cCCCCccc------cccCCCCCcc-ccc
Q psy9284          30 TFSMPYDY------GSIMHYSGIA-FSK   50 (82)
Q Consensus        30 ~~g~pYDy------~SvMHY~~~a-fs~   50 (82)
                      .++..|||      .||||||.+. |+.
T Consensus       213 r~~gGyd~n~~ssttdit~yG~y~~~s~  240 (561)
T PF05880_consen  213 RIDGGYDFNCPSSTTDITEYGGYDQFSI  240 (561)
T ss_pred             EeccceeccCccccchhhhhCCHhHHHH
Confidence            35667998      8999999885 664


No 15 
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism]
Probab=20.83  E-value=81  Score=20.11  Aligned_cols=17  Identities=12%  Similarity=0.259  Sum_probs=14.5

Q ss_pred             cCCCcCCCCCHHHHhcC
Q psy9284          66 DTMGQRDAMSRVDQKRG   82 (82)
Q Consensus        66 ~~iGqr~~lS~~Di~k~   82 (82)
                      ..+|-.+.||..||.+|
T Consensus        41 Gs~G~eN~LT~edI~~A   57 (122)
T COG1445          41 GAVGIENRLTAEDIAAA   57 (122)
T ss_pred             CcccccCcCCHHHHHhC
Confidence            36888899999999876


Done!