Query         psy9298
Match_columns 167
No_of_seqs    104 out of 128
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 23:50:52 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy9298.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/9298hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05497 Destabilase:  Destabil 100.0 1.5E-54 3.3E-59  334.8  -1.7  114   25-159     1-118 (119)
  2 PF00404 Dockerin_1:  Dockerin   40.0      28  0.0006   19.7   1.9   18  120-137     1-18  (21)
  3 PF01464 SLT:  Transglycosylase  38.4      15 0.00033   26.4   0.9   44   23-66     10-57  (121)
  4 COG5005 Mu-like prophage prote  23.7      37 0.00079   27.7   0.8   16  126-141    86-101 (140)
  5 cd00254 LT_GEWL Lytic Transgly  20.2   1E+02  0.0022   21.1   2.4   39   30-68      4-43  (113)
  6 PF06035 Peptidase_C93:  Bacter  19.5      50  0.0011   27.4   0.8   12  124-135    75-86  (170)
  7 PF00062 Lys:  C-type lysozyme/  17.3      29 0.00062   27.3  -1.0   38   30-67     28-69  (125)
  8 COG3672 Predicted transglutami  16.8      82  0.0018   26.8   1.5   12  124-135   105-116 (191)
  9 PF11284 DUF3085:  Protein of u  16.2      96  0.0021   23.2   1.6   29  116-144    31-59  (90)
 10 cd00119 LYZ1 C-type lysozyme (  12.1 1.6E+02  0.0035   23.2   1.9   43   25-67     21-67  (123)

No 1  
>PF05497 Destabilase:  Destabilase;  InterPro: IPR008597 Destabilase (3.5.1.44 from EC) is an endo-epsilon(gamma-Glu)-Lys isopeptidase, which cleaves isopeptide bonds formed by transglutaminase (Factor XIIIa) between glutamine gamma-carboxamide and the epsilon-amino group of lysine [].; GO: 0003796 lysozyme activity; PDB: 2DQA_B 3AB6_A 3AYQ_A.
Probab=100.00  E-value=1.5e-54  Score=334.82  Aligned_cols=114  Identities=45%  Similarity=0.889  Sum_probs=92.0

Q ss_pred             ccHhHHHhHhhhhcCCCCCCCCCCC----cccceeeCHHHHhhcCCCCcccccccccccCCCccccccCchhhHHHhhhh
Q psy9298          25 VDQICLGCICHGMSLCNQTIGCNGD----TCGAFKITWAYWSDAGKPTIHFHIINFLSRVLGPYRYCIPNFIALGQTVLE  100 (167)
Q Consensus        25 vs~~CL~CIC~a~SgCn~~~~C~~~----~CG~F~It~~YW~DAGkp~~~~~~~~d~~~~~~a~~~Ca~d~~CA~~tV~~  100 (167)
                      |+++||+|||+|+||||+|++|.++    +||||||||+||+|||||+       |+|+++ ||++||+|++||++||  
T Consensus         1 v~~~CL~CiC~~~SgC~~~~~C~~~~~s~~CG~f~Is~~YW~Dag~~g-------~~~~~~-a~~~Ca~d~~Ca~~tV--   70 (119)
T PF05497_consen    1 VSDDCLRCICEAESGCNMPAGCRMDVGSLSCGPFQISWPYWQDAGKPG-------DSPSRD-AYERCANDPYCAERTV--   70 (119)
T ss_dssp             S-HHHHHHHHHHHCSS-S---EEEETTEEEETTTTEEHHHHHHTT--S-------SS------HHHHHTSHHHHHHHH--
T ss_pred             CChHHHHHHhHHhhCCCCCCCCCCCCCCceeeeeEecHHHHHHcCCCC-------CCchhh-hHHHHcCCHHHHHHHH--
Confidence            7999999999999999999999988    9999999999999999986       677777 9999999999999999  


Q ss_pred             hccCCcCCCCCCCCCCcccCCCCCCCCChHHHHHHhcCCCCCCCCCCchHHHHHHHHHH
Q psy9298         101 IFCIPPFQNFPFKPVVHTYDCDADGQIDCRDYAAIHRLGGYGCNAPLDATYLARFNKCL  159 (167)
Q Consensus       101 ~~~~~~~q~Ym~r~~~y~~DCn~DG~~dCeDyarIH~~Gp~GC~~~~t~~Y~~r~~~Cl  159 (167)
                             |+||+|   |++|||+| +++||||||||++||+||++++|..||++|++|+
T Consensus        71 -------~~Ym~r---y~~dCn~d-~~dCed~ariH~~Gp~gC~~~~t~~Yw~~v~~Cl  118 (119)
T PF05497_consen   71 -------QNYMAR---YGQDCNGD-VIDCEDYARIHNGGPNGCKNPLTLGYWNRVKKCL  118 (119)
T ss_dssp             -------HHHHHH---HCCT--SS----HHHHHHHHHH-TTGGG-CHHHHHHHHHCTS-
T ss_pred             -------HHHHHH---HccCCCCC-cchHHHHHHHHcCCCCcCCCCccHHHHHHHHhcc
Confidence                   999999   99999999 9999999999999999999999999999999996


No 2  
>PF00404 Dockerin_1:  Dockerin type I repeat;  InterPro: IPR018242 Gram-positive, thermophilic anaerobes such as Clostridium thermocellum or Clostridium cellulolyticum secretes a highly active and thermostable cellulase complex (cellulosome) responsible for the degradation of crystalline cellulose [, ]. The cellulosome contains at least 30 polypeptides, the majority of the enzymes are endoglucanases (3.2.1.4 from EC), but there are also some xylanases (3.2.1.8 from EC), beta-glucosidases (3.2.1.21 from EC) and endo-beta-1,3-1,4-glucanases (3.2.1.73 from EC). Complete sequence data for many of these enzymes has been obtained. A majority of these proteins contain a highly conserved type I dockerin domain of about 65 to 70 residues, which is generally (but not always) located in the C terminus. The dockerin domain is the binding partner of the cohesin domain (see IPR002102 from INTERPRO). The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome []. The dockerin domain contains a tandem repeat of two calcium-binding loop-helix motifs (distinct from EF-hand Ca-binding motifs). These motifs are about 24 amino acids in length. This entry represents these repeated Ca-binding motifs.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3P0D_J 1OHZ_B 2CCL_B 1DAV_A 1DAQ_A 2VN5_B 2VN6_B.
Probab=40.04  E-value=28  Score=19.70  Aligned_cols=18  Identities=28%  Similarity=0.660  Sum_probs=14.8

Q ss_pred             CCCCCCCCChHHHHHHhc
Q psy9298         120 DCDADGQIDCRDYAAIHR  137 (167)
Q Consensus       120 DCn~DG~~dCeDyarIH~  137 (167)
                      |-|+||.++=-|++.+.+
T Consensus         1 DvN~DG~vna~D~~~lk~   18 (21)
T PF00404_consen    1 DVNGDGKVNAIDLALLKK   18 (21)
T ss_dssp             -TTSSSSSSHHHHHHHHH
T ss_pred             CCCCCCcCCHHHHHHHHH
Confidence            458999999999998854


No 3  
>PF01464 SLT:  Transglycosylase SLT domain;  InterPro: IPR008258 Bacterial lytic transglycosylases degrade murein via cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid and N-acetylglucosamine, with the concomitant formation of a 1,6-anhydrobond in the muramic acid residue. There are both soluble (Slt enzymes) and membrane-bound (Mlt enzymes) lytic transglycosylases that differ in size, sequence, activity, specificity and location. The multi-domain structure of the 70 Kd soluble lytic transglycosylase Slt70 is known []. Slt70 has 3 distinct domains, each rich in alpha helices: an N-terminal superhelical U-shaped domain (U-domain; IPR008939 from INTERPRO), a superhelical linker domain (L-domain, IPR012289 from INTERPRO), and a C-terminal catalytic domain (IPR008258 from INTERPRO). Both the U- and L-domain share a similar superhelical structure. These two domains are connected, and together form a closed ring with a large central hole; the catalytic domain is packed on top of, and interacts with, this ring. The catalytic domain has a lysosome-like fold.  This entry represents the catalytic domain, which is structurally conserved in some membrane-bound lytic glycosylases and in bacteriophage transglycosylases, even though their sequences can differ considerably proteins []. The most conserved part of this domain is its N-terminal extremity that contains two conserved serines and a glutamate, which have been shown [] to be involved in the catalytic mechanism. This family is distantly related to IPR001916 from INTERPRO.; PDB: 2Y8P_B 3MGW_A 1QTE_A 1SLY_A 1QSA_A 153L_A 154L_A 3BKV_A 3BKH_A 1LSP_A ....
Probab=38.42  E-value=15  Score=26.41  Aligned_cols=44  Identities=25%  Similarity=0.251  Sum_probs=36.5

Q ss_pred             CCccHhHHHhHhhhhcCCCCCCCC----CCCcccceeeCHHHHhhcCC
Q psy9298          23 QPVDQICLGCICHGMSLCNQTIGC----NGDTCGAFKITWAYWSDAGK   66 (167)
Q Consensus        23 ~~vs~~CL~CIC~a~SgCn~~~~C----~~~~CG~F~It~~YW~DAGk   66 (167)
                      ..|+..-|.-|..+||+.+..+.-    ....-|.+||+..-|.+-++
T Consensus        10 ~~v~~~~l~ai~~~ES~~~~~a~~~~~~~~~a~GlmQi~~~t~~~~~~   57 (121)
T PF01464_consen   10 YGVPPSLLAAIAYQESGFNPNAVSYNSNGSGAYGLMQINPATWKDYGR   57 (121)
T ss_dssp             HTS-HHHHHHHHHHHHTTCTTTBTTBETTTTEETTTTEETTTSHHHSH
T ss_pred             HCCCHHHHHHHHHHhcCCCCCCcCCCCCCCcceeccccCCcccchhhh
Confidence            457788899999999998877766    55689999999999999774


No 4  
>COG5005 Mu-like prophage protein gpG [General function prediction only]
Probab=23.75  E-value=37  Score=27.65  Aligned_cols=16  Identities=44%  Similarity=0.677  Sum_probs=12.7

Q ss_pred             CCChHHHHHHhcCCCC
Q psy9298         126 QIDCRDYAAIHRLGGY  141 (167)
Q Consensus       126 ~~dCeDyarIH~~Gp~  141 (167)
                      +.+=+-||+||+.|+-
T Consensus        86 vGtne~YaaiHqfGG~  101 (140)
T COG5005          86 VGTNEEYAAIHQFGGK  101 (140)
T ss_pred             ecccchhHHHHHhcCc
Confidence            3456899999999963


No 5  
>cd00254 LT_GEWL Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and  insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
Probab=20.16  E-value=1e+02  Score=21.15  Aligned_cols=39  Identities=15%  Similarity=-0.004  Sum_probs=29.5

Q ss_pred             HHhHhhhhcCCCCCCC-CCCCcccceeeCHHHHhhcCCCC
Q psy9298          30 LGCICHGMSLCNQTIG-CNGDTCGAFKITWAYWSDAGKPT   68 (167)
Q Consensus        30 L~CIC~a~SgCn~~~~-C~~~~CG~F~It~~YW~DAGkp~   68 (167)
                      |.-|-..||+-+..+. =.+..-|++||...-|.+-++..
T Consensus         4 l~ai~~~ES~~~~~a~~~~~~a~GlmQi~~~~~~~~~~~~   43 (113)
T cd00254           4 LLAIIRQESGFNPNAVNSGAGAVGLMQFMPSTARAYGVDG   43 (113)
T ss_pred             HHHHHHHHCCCCCCCccCCCCCeeeeeeCchHHHHHHHhc
Confidence            4557788998664443 33567999999999999988864


No 6  
>PF06035 Peptidase_C93:  Bacterial transglutaminase-like cysteine proteinase BTLCP;  InterPro: IPR010319 Structural analysis predicts that this family of proteins are bacterial transglutaminase-like cysteine peptidases (BTLCPs) with an invariant Cys-His-Asp catalytic triad and an N-terminal signal sequence. They are predicted to possess the papain-like cysteine proteinase fold and catalyse post-translational protein modification through transamidase, acetylase or hydrolase activity. Inspection of neighbouring genes suggests a link between this predicted activity and a type-I secretion system resembling ATP-binding cassette exporters of toxins and proteases involved in bacterial pathogenicity [].; PDB: 4FGQ_B 4FGP_B 4FGO_A.
Probab=19.54  E-value=50  Score=27.42  Aligned_cols=12  Identities=50%  Similarity=0.875  Sum_probs=8.6

Q ss_pred             CCCCChHHHHHH
Q psy9298         124 DGQIDCRDYAAI  135 (167)
Q Consensus       124 DG~~dCeDyarI  135 (167)
                      +|..||||||.+
T Consensus        75 ~g~GDCEDyai~   86 (170)
T PF06035_consen   75 RGAGDCEDYAIA   86 (170)
T ss_dssp             HTEE-HHHHHHH
T ss_pred             CCcCCcHhHHHH
Confidence            467799999865


No 7  
>PF00062 Lys:  C-type lysozyme/alpha-lactalbumin family;  InterPro: IPR001916 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 22 GH22 from CAZY comprises enzymes with two known activities; lysozyme type C (3.2.1.17 from EC) and alpha-lactalbumins. Asp and/or the carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic nucleophile/base.   Alpha-lactalbumin [, ] is a milk protein that acts as the regulatory subunit of lactose synthetase, acting to promote the conversion of galactosyltransferase to lactose synthase, which is essential for milk production. In the mammary gland, alpha-lactalbumin changes the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose.  Lysozymes (3.2.1.17 from EC) act as bacteriolytic enzymes by hydrolyzing the beta(1->4) bonds between N-acetylglucosamine and N-acetylmuramic acid in the peptidoglycan of prokaryotic cell walls. It has also been recruited for a digestive role in certain ruminants and colobine monkeys []. There are at least five different classes of lysozymes []: C (chicken type), G (goose type), phage-type (T4), fungi (Chalaropsis), and bacterial (Bacillus subtilis). There are few similarities in the sequences of the different types of lysozymes. Lysozyme type C and alpha-lactalbumin are similar both in terms of primary sequence and structure, and probably evolved from a common ancestral protein []. Around 35 to 40% of the residues are conserved in both proteins as well as the positions of the four disulphide bonds. There is, however, no similarity in function. Another significant difference between the two enzymes is that all lactalbumins have the ability to bind calcium [], while this property is restricted to only a few lysozymes [].  The binding site was deduced using high resolution X-ray structure analysis and was shown to consist of three aspartic acid residues. It was first suggested that calcium bound to lactalbumin stabilised the structure, but recently it has been claimed that calcium controls the release of lactalbumin from the golgi membrane and that the pattern of ion binding may also affect the catalytic properties of the lactose synthetase complex.; PDB: 1HFX_A 1HMK_A 1HFY_B 1FKQ_A 1FKV_A 3B0K_B 1HML_A 1B9O_A 1A4V_A 3B0O_A ....
Probab=17.30  E-value=29  Score=27.33  Aligned_cols=38  Identities=26%  Similarity=0.447  Sum_probs=27.8

Q ss_pred             HHhHhhhhcCCCCCCCC---C-CCcccceeeCHHHHhhcCCC
Q psy9298          30 LGCICHGMSLCNQTIGC---N-GDTCGAFKITWAYWSDAGKP   67 (167)
Q Consensus        30 L~CIC~a~SgCn~~~~C---~-~~~CG~F~It~~YW~DAGkp   67 (167)
                      .-||-+-||+=|..+.=   . +.--|+|||+..||=.-|+.
T Consensus        28 WvCla~~eS~f~T~a~~~~~~gS~dyGIFQIns~~WC~~~~~   69 (125)
T PF00062_consen   28 WVCLAYHESGFNTSAVNYNNDGSTDYGIFQINSRYWCSDGKT   69 (125)
T ss_dssp             HHHHHHHHHTTBTT-EEEETTSEEEETTTTEETTTTSBCSSS
T ss_pred             eeeeEecccCceeeccccCCCCccccceeecCchhhccCCCC
Confidence            45889999987654321   1 23589999999999988873


No 8  
>COG3672 Predicted transglutaminase-like cysteine proteinase [General    function prediction only]
Probab=16.77  E-value=82  Score=26.83  Aligned_cols=12  Identities=50%  Similarity=0.819  Sum_probs=9.7

Q ss_pred             CCCCChHHHHHH
Q psy9298         124 DGQIDCRDYAAI  135 (167)
Q Consensus       124 DG~~dCeDyarI  135 (167)
                      ++..|||||+-+
T Consensus       105 ~~~GDCEDyal~  116 (191)
T COG3672         105 TGAGDCEDYALE  116 (191)
T ss_pred             CCcccHHHHHHH
Confidence            567899999854


No 9  
>PF11284 DUF3085:  Protein of unknown function (DUF3085);  InterPro: IPR021436  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=16.17  E-value=96  Score=23.18  Aligned_cols=29  Identities=21%  Similarity=0.111  Sum_probs=23.5

Q ss_pred             CcccCCCCCCCCChHHHHHHhcCCCCCCC
Q psy9298         116 VHTYDCDADGQIDCRDYAAIHRLGGYGCN  144 (167)
Q Consensus       116 ~y~~DCn~DG~~dCeDyarIH~~Gp~GC~  144 (167)
                      .|+..||-+...+=-|.+|.|.||.-++.
T Consensus        31 aYA~gCnP~~d~dww~~ar~~~GGDDf~e   59 (90)
T PF11284_consen   31 AYAEGCNPDTDDDWWDRARAEFGGDDFAE   59 (90)
T ss_pred             EEeeccCCCcChhHHHHHHHHcCCcceeE
Confidence            49999997776555666999999998874


No 10 
>cd00119 LYZ1 C-type lysozyme (1, 4-beta-N-acetylmuramidase, LYZ) and alpha-lactalbumin (lactose synthase B protein, LA). They have a close evolutionary relationship and similar tertiary structure, however, functionally they are quite different. Lysozymes have primarily bacteriolytic function; hydrolysis of peptidoglycan of prokaryotic cell walls and transglycosylation. LA is a calcium-binding metalloprotein that is expressed exclusively in the mammary gland during lactation. LA is the regulatory subunit of the enzyme lactose synthase. The association of LA with the catalytic component of lactose synthase, galactosyltransferase, alters the acceptor substrate specificity of this glycosyltransferase, facilitating biosynthesis of lactose.
Probab=12.14  E-value=1.6e+02  Score=23.18  Aligned_cols=43  Identities=26%  Similarity=0.423  Sum_probs=31.5

Q ss_pred             ccHhHHHhHhhhhcCCCCCCCCC----CCcccceeeCHHHHhhcCCC
Q psy9298          25 VDQICLGCICHGMSLCNQTIGCN----GDTCGAFKITWAYWSDAGKP   67 (167)
Q Consensus        25 vs~~CL~CIC~a~SgCn~~~~C~----~~~CG~F~It~~YW~DAGkp   67 (167)
                      ++..=+-||-+.||+=|..+.=.    +.-=|.|||+-.||=.-|+.
T Consensus        21 ~~l~~Wvcia~~ES~~nt~a~~~n~~gs~dyGlfQINs~~WC~~~~~   67 (123)
T cd00119          21 ISLANWVCLAEHESGFNTQAVNNNNDGSTDYGLFQINSKYWCNDGKT   67 (123)
T ss_pred             CCHHHHHHHHHHHHCCCccceecCCCCCeeEeEEEecchhhccCCCC
Confidence            44445679999999876553211    23589999999999998873


Done!