BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy9306
(98 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1YMY|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
Deacetylase From Escherichia Coli K12
pdb|1YMY|B Chain B, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
Deacetylase From Escherichia Coli K12
pdb|1YRR|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
Deacetylase From Escherichia Coli K12 At 2.0 A
Resolution
pdb|1YRR|B Chain B, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
Deacetylase From Escherichia Coli K12 At 2.0 A
Resolution
pdb|2P50|A Chain A, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
Deacetylase Liganded With Zn
pdb|2P50|B Chain B, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
Deacetylase Liganded With Zn
pdb|2P50|C Chain C, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
Deacetylase Liganded With Zn
pdb|2P50|D Chain D, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
Deacetylase Liganded With Zn
Length = 382
Score = 25.4 bits (54), Expect = 8.6, Method: Compositional matrix adjust.
Identities = 12/38 (31%), Positives = 20/38 (52%)
Query: 13 ITPLSYIAGGKIERYLGNLNFFFIRESNCIRESGGLSG 50
+T + AG IE+++ + R C+ E+G LSG
Sbjct: 271 VTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSG 308
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.140 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,002,350
Number of Sequences: 62578
Number of extensions: 102677
Number of successful extensions: 183
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 1
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)