BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy9306
         (98 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YMY|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
           Deacetylase From Escherichia Coli K12
 pdb|1YMY|B Chain B, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
           Deacetylase From Escherichia Coli K12
 pdb|1YRR|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
           Deacetylase From Escherichia Coli K12 At 2.0 A
           Resolution
 pdb|1YRR|B Chain B, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate
           Deacetylase From Escherichia Coli K12 At 2.0 A
           Resolution
 pdb|2P50|A Chain A, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
           Deacetylase Liganded With Zn
 pdb|2P50|B Chain B, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
           Deacetylase Liganded With Zn
 pdb|2P50|C Chain C, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
           Deacetylase Liganded With Zn
 pdb|2P50|D Chain D, Crystal Structure Of N-Acetyl-D-Glucosamine-6-Phosphate
           Deacetylase Liganded With Zn
          Length = 382

 Score = 25.4 bits (54), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 13  ITPLSYIAGGKIERYLGNLNFFFIRESNCIRESGGLSG 50
           +T  +  AG  IE+++      + R   C+ E+G LSG
Sbjct: 271 VTDATAPAGANIEQFIFAGKTIYYRNGLCVDENGTLSG 308


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,002,350
Number of Sequences: 62578
Number of extensions: 102677
Number of successful extensions: 183
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 1
length of query: 98
length of database: 14,973,337
effective HSP length: 64
effective length of query: 34
effective length of database: 10,968,345
effective search space: 372923730
effective search space used: 372923730
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)